Citrus Sinensis ID: 035712

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560---
CFLSLGRHSLHQPFICRRSYVRLSVNPTPLVRRKQRFALVVCVIVEVFEERPCVMGKKTLGKKGHERENGIVTEGEVDFKEEEKKRDVDLRASENEVEMKDDVDENERKINEVGGNDFEFGDSRNGVIVEGHVDTNNTGSEKERQKKKKRKLEISEDENEIPKDMRINNDEEVSEINEDSKQKQLAMDENASLQKNYQEDSGNNSELKVRKKRKKLLKEGMNNDGIGSSLSDNAEGNNKETREAIREREQLDGNMMEKVENGGKQKKKKKKNAHNDGTQAEKLCNANSRVEEIEGHAVLEEDGIKEKKKATSVKKHSGGDKKASQTKKGVEPNDLSEGSAQKERSKKVSFSNDVQVFPSSDAKNGKDDGFVRGKRFSKEEDEMIKRAVMNYIETHGLGEEGLNMVLHCRSHPEVKHCWKEIGSALPWRPYDSIYYRAHIIFQRDENRKWTPEELELVRKFHEKHGSNWKMLANALGKHRFHVKDAWRRVRLPNQKKGQWSQEEYQKLFDLVNMDLRMRALEEKKTKHGMLRDNISWEAISDKLATRSNAICCMKWYDQLTSPM
cccccccccccccccccccEEEEEEcccHHHHcccccEEEEEEEEEccccccccccccccccccccccccccccccccccHHHHHHHccccccccccccccHHHHHHHHcccccccccccccccccccccccccccccccHHHHHHHHHHHHHcccccccccccccccccHHHHHcHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHccccccccccccccccccccHHHHHHHHHHHHHccccccccccccccHHHHHcccccccHHHHHHHccccccHHccccccccccHHHHHHHHHHcccccccccccccccccccccccccccHHHHccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHcccccHHHHHHHccccccHHHHHHHHHHHHcccccHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHcccHHHHHHHHcccHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHcccccHHHHHHHHHHHccccc
cccccccccccccEEEEEEEEEEEcccccHHHHHHHEEEEEEEEEEHHcccccccccEEccccccccccEEEEccccccccHHHHHccccccccccccccccccHcccccHHcccccccccEEEccEEEcccEEcccccccccccccEcccccccccccccccccccccccHHcccccccHccccccHHHHHHHccccccccccccccHHcccccccccccccccccccccccccccccccccHHHHHHcccccccccccccccccccccccccccccHHHHHccccccccccccccccccccccccccccccEccccccHHHHHHccccccccccccccccccccEEcccccEEEcccccccccccccEEccccccHHHHHHHHHHHHHHHHHccccHHHHHHHHcccccHHHHHHHHHHHHHcccccHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHcccHHHHHHHHcccHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHccHHHHcccccccccccccccHHHHHHHHccccHHHHHHHHHHHHHccc
cflslgrhslhqpficrrsyvrlsvnptplvrrkQRFALVVCVIVEVfeerpcvmgkktlgkkgherengivtegevdfkeeekkrdvdlrasenevemkddvdENERKinevggndfefgdsrngviveghvdtnntgsekeRQKKKKRKLEisedeneipkdmrinndeevseINEDSKQKQLAMDENASLQknyqedsgnnseLKVRKKRKKLLKEgmnndgigsslsdnaegnnkETREAIREREQLDGNMMEKVenggkqkkkkkknahndgtqAEKLCNANsrveeieghavleedgikekKKATSvkkhsggdkkasqtkkgvepndlsegsaqkerskkvsfsndvqvfpssdakngkddgfvrgkrfskEEDEMIKRAVMNYIEthglgeeglnmvlhcrshpevkHCWKEigsalpwrpydsiyyRAHIIFqrdenrkwtpEELELVRKFHEKHGSNWKMLANALGkhrfhvkdawrrvrlpnqkkgqwsQEEYQKLFDLVNMDLRMRALEEkktkhgmlrdnISWEAISDKLATRSNAICCMKWydqltspm
cflslgrhslhqpficrrsyvrlsvnptplvrrkqrfALVVCVIVevfeerpcvmgkktlgkkgherengivtegevdfkeeekkrdvdlrasenevemkddvdenerkinevggndfefgdsrNGVIVeghvdtnntgsekerqkkkkrkleisedeneipkdmrinndeevseINEDSKQKQLAMDENASlqknyqedsgnnselkvRKKRKKLLkegmnndgigsslsdnaegnnkETREAIRereqldgnmmekvenggkqkkkkkknahndgtqaeklcnansrVEEIEghavleedgikekkkatsvkkhsggdkkasqtkkgvepndlsegsaqkerskkvsfsndvqvfpssdakngkddgfvrgkrfskeedemIKRAVMNYIETHGLGEEGLNMVLHCRSHPEVKHCWKEIGSALPWRPYDSIYYRAHIIFqrdenrkwTPEELELVRKFHEKHGSNWKMLANALGKHRfhvkdawrrvrlpnqkkgqwsqeeYQKLFDLVNMDLRMRALEekktkhgmlrdniSWEAISDKLATRSNAICCMKWYDQLTSPM
CFLSLGRHSLHQPFICRRSYVRLSVNPTPLVRRKQRFALVVCVIVEVFEERPCVMGKKTLGKKGHERENGIVTEGEVDFKEEEKKRDVDLRASENEVEMKDDVDENERKINEVGGNDFEFGDSRNGVIVEGHVDTNNTGSekerqkkkkrkLEISEDENEIPKDMRINNDEEVSEINEDSKQKQLAMDENASLQKNYQEDSGNNSElkvrkkrkkllkEGMNNDGIGSSLSDNAEGNNKETREAIREREQLDGNMMEKVENGGkqkkkkkkNAHNDGTQAEKLCNANSRVEEIEGHAVLEEDGIKEKKKATSVKKHSGGDKKASQTKKGVEPNDLSEGSAQKERSKKVSFSNDVQVFPSSDAKNGKDDGFVRGKRFSKEEDEMIKRAVMNYIETHGLGEEGLNMVLHCRSHPEVKHCWKEIGSALPWRPYDSIYYRAHIIFQRDENRKWTPEELELVRKFHEKHGSNWKMLANALGKHRFHVKDAWRRVRLPNQKKGQWSQEEYQKLFDLVNMDLRMRALEEKKTKHGMLRDNISWEAISDKLATRSNAICCMKWYDQLTSPM
*****GRHSLHQPFICRRSYVRLSVNPTPLVRRKQRFALVVCVIVEVFEERPCVMGKK*************************************************************************************************************************************************************************************************************************************************************************************************************************************IKRAVMNYIETHGLGEEGLNMVLHCRSHPEVKHCWKEIGSALPWRPYDSIYYRAHIIFQRDENRKWTPEELELVRKFHEKHGSNWKMLANALGKHRFHVKDAWRRVRLPNQKKGQWSQEEYQKLFDLVNMDLRMRALEEKKTKHGMLRDNISWEAISDKLATRSNAICCMKWYDQ*****
C******HSLHQPFICRRSYVRLSVNPTPLVRRKQRFALVVCVIVEVFEERPC************************************************************************************************************************************************************************************************************************************************************************************************************************************KEEDEMIKRAVMNYIETHGLGEEGLNMVLHCRSHPEVKHCWKEIGSALPWRPYDSIYYRAHIIFQRDENRKWTPEELELVRKFHEKHGSNWKMLANALGKHRFHVKDAWRRVRLPNQKKGQWSQEEYQKLFDLVNMD***************LRDNISWEAISDKLATRSNAICCMKWYDQLTSPM
CFLSLGRHSLHQPFICRRSYVRLSVNPTPLVRRKQRFALVVCVIVEVFEERPCVMGKKTLGKKGHERENGIVTEGEVDFKEEEKKRDVDLRASENEVEMKDDVDENERKINEVGGNDFEFGDSRNGVIVEGHVDTN*****************ISEDENEIPKDMRINNDEE*************AMDENASLQKN*************RKKRKKLLKEGMNNDGIGSSLS***********EAIREREQLDGNMMEKV*****************GTQAEKLCNANSRVEEIEGHAVLEEDGIK********************************************FSNDVQVFPSSDAKNGKDDGFVRGKRFSKEEDEMIKRAVMNYIETHGLGEEGLNMVLHCRSHPEVKHCWKEIGSALPWRPYDSIYYRAHIIFQRDENRKWTPEELELVRKFHEKHGSNWKMLANALGKHRFHVKDAWRRVRLPNQKKGQWSQEEYQKLFDLVNMDLRMRALEEKKTKHGMLRDNISWEAISDKLATRSNAICCMKWYDQLTSPM
*FLSLGRHSLHQPFICRRSYVRLSVNPTPLVRRKQRFALVVCVIVEVFEERPCVMGKKTLGKKGH*****I*TEGEVD****************************************EFGDSRNGVIVEGHVD*******************************************************************************************************************************************************************************************************************KKVSFSNDVQVFPSSDAKNGKDDGFVRGKRFSKEEDEMIKRAVMNYIETHGLGEEGLNMVLHCRSHPEVKHCWKEIGSALPWRPYDSIYYRAHIIFQRDENRKWTPEELELVRKFHEKHGSNWKMLANALGKHRFHVKDAWRRVRLPNQKKGQWSQEEYQKLFDLVNMDLRMRA*E*****HGMLRDNISWEAISDKLATRSNAICCMKWYDQLTSP*
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
CFLSLGRHSLHQPFICRRSYVRLSVNPTPLVRRKQRFALVVCVIVEVFEERPCVMGKKTLGKKGHERENGIVTEGEVDFKEEEKKRDVDLRASENEVEMKDDVDENERKINEVGGNDFEFGDSRNGVIVEGHVDTNNTGSEKERQKKKKRKLEISEDENEIPKDMRINNDEEVSExxxxxxxxxxxxxxxxxxxxxYQEDSGNNSELKVRKKRKKLLKEGMNNDGIGSSLSDNAEGNNKETREAIREREQLDGNMMEKVENGGKQKKKKKKNAHNDGTQAEKLCNANSRVEEIEGHAVLEEDGIKEKKKATSVKKHSGGDKKASQTKKGVEPNDLSEGSAQKERSKKVSFSNDVQVFPSSDAKNGKDDGFVRGKRFSKEEDEMIKRAVMNYIETHGLGEEGLNMVLHCRSHPEVKHCWKEIGSALPWRPYDSIYYRAHIIFQRDENRKWTPEELELVRKFHEKHGSNWKMLANALGKHRFHVKDAWRRVRLPNQKKGQWSQEEYQKLFDLVNMDLRMRALEEKKTKHGMLRDNISWEAISDKLATRSNAICCMKWYDQLTSPM
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query563 2.2.26 [Sep-21-2011]
Q9Y222 760 Cyclin-D-binding Myb-like yes no 0.305 0.226 0.279 2e-11
Q8CE22 761 Cyclin-D-binding Myb-like yes no 0.305 0.226 0.279 3e-11
Q66HG1 760 Cyclin-D-binding Myb-like no no 0.305 0.226 0.279 3e-11
Q12457570 Myb domain-containing pro yes no 0.353 0.349 0.276 3e-10
Q6DG03 645 Cyclin-D-binding Myb-like yes no 0.301 0.263 0.271 6e-10
Q62187 859 Transcription termination no no 0.335 0.220 0.231 1e-08
O14108 569 DNA-binding protein eta2 yes no 0.305 0.302 0.263 4e-07
Q05950 595 DNA-binding protein REB1 yes no 0.245 0.231 0.32 7e-07
Q15361 905 Transcription termination no no 0.335 0.208 0.227 5e-06
P52551 743 Myb-related protein B OS= N/A no 0.174 0.131 0.325 1e-05
>sp|Q9Y222|DMTF1_HUMAN Cyclin-D-binding Myb-like transcription factor 1 OS=Homo sapiens GN=DMTF1 PE=1 SV=1 Back     alignment and function desciption
 Score = 71.2 bits (173), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 52/186 (27%), Positives = 99/186 (53%), Gaps = 14/186 (7%)

Query: 376 FSKEEDEMIKRAVMNYIETHGLGEEGLNMVLHCRSHPEVKHCWKEIGSALPWRPYDSIYY 435
           +SKEE +++   +  Y++  G+ +     ++   S  E K  ++ I   L  RP  ++Y 
Sbjct: 156 WSKEEIDILMNNIERYLKARGIKDA--TEIIFEMSKDERKDFYRTIAWGLN-RPLFAVYR 212

Query: 436 RAHIIFQ-RDENRKWTPEELELVRKFHEKHGSNWKMLANALGKHRFHVKDAWRRVRLPNQ 494
           R   ++  R+   K+TPEE+E +++   KHG++W  +  ALG+    VKD  R ++    
Sbjct: 213 RVLRMYDDRNHVGKYTPEEIEKLKELRIKHGNDWATIGAALGRSASSVKDRCRLMK-DTC 271

Query: 495 KKGQWSQEEYQKLFDLVNMDLRMRALEEKKTKHG-MLRDNISWEAISDKLATRSNAICCM 553
             G+W++EE ++L ++V+        E   T+ G ++   +SW A+++++ TRS   C  
Sbjct: 272 NTGKWTEEEEKRLAEVVH--------ELTSTEPGDIVTQGVSWAAVAERVGTRSEKQCRS 323

Query: 554 KWYDQL 559
           KW + L
Sbjct: 324 KWLNYL 329
Transcriptional activator which activates the CDKN2A/ARF locus in response to Ras-Raf signaling, thereby promoting p53/TP53-dependent growth arrest (By similarity). Binds to the consensus sequence 5'-CCCG[GT]ATGT-3' (By similarity). Isoform 1 may cooperate with MYB to activate transcription of the ANPEP gene. Isoform 2 may antagonize transcriptional activation by isoform 1.
Homo sapiens (taxid: 9606)
>sp|Q8CE22|DMTF1_MOUSE Cyclin-D-binding Myb-like transcription factor 1 OS=Mus musculus GN=Dmtf1 PE=1 SV=2 Back     alignment and function description
>sp|Q66HG1|DMTF1_RAT Cyclin-D-binding Myb-like transcription factor 1 OS=Rattus norvegicus GN=Dmtf1 PE=2 SV=2 Back     alignment and function description
>sp|Q12457|YD026_YEAST Myb domain-containing protein YDR026C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YDR026C PE=1 SV=1 Back     alignment and function description
>sp|Q6DG03|DMTF1_DANRE Cyclin-D-binding Myb-like transcription factor 1 OS=Danio rerio GN=dmtf1 PE=2 SV=1 Back     alignment and function description
>sp|Q62187|TTF1_MOUSE Transcription termination factor 1 OS=Mus musculus GN=Ttf1 PE=1 SV=2 Back     alignment and function description
>sp|O14108|ETA2_SCHPO DNA-binding protein eta2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=eta2 PE=1 SV=1 Back     alignment and function description
>sp|Q05950|REB1_KLULA DNA-binding protein REB1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=REB1 PE=3 SV=2 Back     alignment and function description
>sp|Q15361|TTF1_HUMAN Transcription termination factor 1 OS=Homo sapiens GN=TTF1 PE=1 SV=3 Back     alignment and function description
>sp|P52551|MYBB_XENLA Myb-related protein B OS=Xenopus laevis GN=mybl2 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query563
224072542 697 predicted protein [Populus trichocarpa] 0.467 0.377 0.643 1e-103
225435385 686 PREDICTED: uncharacterized protein LOC10 0.788 0.647 0.448 1e-103
449433105537 PREDICTED: cyclin-D-binding Myb-like tra 0.403 0.422 0.688 5e-96
449480103530 PREDICTED: cyclin-D-binding Myb-like tra 0.403 0.428 0.688 5e-96
255577118 678 DNA binding protein, putative [Ricinus c 0.419 0.348 0.644 2e-94
356548105326 PREDICTED: cyclin-D-binding Myb-like tra 0.410 0.708 0.618 7e-86
15237544588 myb family transcription factor [Arabido 0.388 0.372 0.593 4e-76
297801470567 hypothetical protein ARALYDRAFT_916116 [ 0.388 0.386 0.590 6e-75
222635446424 hypothetical protein OsJ_21082 [Oryza sa 0.403 0.535 0.519 3e-63
218198035424 hypothetical protein OsI_22667 [Oryza sa 0.403 0.535 0.519 3e-63
>gi|224072542|ref|XP_002303776.1| predicted protein [Populus trichocarpa] gi|222841208|gb|EEE78755.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  381 bits (978), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 173/269 (64%), Positives = 213/269 (79%), Gaps = 6/269 (2%)

Query: 301 EDGIKEKKKATSVKKHSG--GDKKASQTKKGVEPNDLSEGSAQKERSKKVSFSNDVQVFP 358
           E G K KKKA S++  S     ++ ++ ++  E    SE S  K  SK+VSF  DV++FP
Sbjct: 338 EGGNKRKKKAKSLENRSKEKSSERVTEMEEDAESTRPSEKSLSKVTSKRVSFCEDVEIFP 397

Query: 359 SSDAKNGK----DDGFVRGKRFSKEEDEMIKRAVMNYIETHGLGEEGLNMVLHCRSHPEV 414
           SSD  + K    +DGFVRGKRFS EEDEM+K AV+NYI  HGLG +GLNMVL+C+ HP +
Sbjct: 398 SSDGPSDKKAVGEDGFVRGKRFSLEEDEMVKEAVLNYINVHGLGADGLNMVLNCKKHPAI 457

Query: 415 KHCWKEIGSALPWRPYDSIYYRAHIIFQRDENRKWTPEELELVRKFHEKHGSNWKMLANA 474
           KHCWKEIG+ALPWRP +S+YYRAHI+F+RD+N  WTPEE +L+RKFHEKHGS+WK LA A
Sbjct: 458 KHCWKEIGAALPWRPRESVYYRAHILFERDQNSSWTPEEYDLIRKFHEKHGSDWKTLAEA 517

Query: 475 LGKHRFHVKDAWRRVRLPNQKKGQWSQEEYQKLFDLVNMDLRMRALEEKKTKHGMLRDNI 534
           LGKHRFHVKD WRR++L N KKG+WSQ+EYQ LFD VN+DLR++A  E+KTKHGMLRDNI
Sbjct: 518 LGKHRFHVKDTWRRIKLINMKKGKWSQDEYQSLFDSVNLDLRLKAFVERKTKHGMLRDNI 577

Query: 535 SWEAISDKLATRSNAICCMKWYDQLTSPM 563
           SW AIS+KL TR++A+CC KWYDQLTSPM
Sbjct: 578 SWTAISEKLETRTDALCCQKWYDQLTSPM 606

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|225435385|ref|XP_002282624.1| PREDICTED: uncharacterized protein LOC100260316 [Vitis vinifera] Back     alignment and taxonomy information
>gi|449433105|ref|XP_004134338.1| PREDICTED: cyclin-D-binding Myb-like transcription factor 1-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449480103|ref|XP_004155800.1| PREDICTED: cyclin-D-binding Myb-like transcription factor 1-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|255577118|ref|XP_002529443.1| DNA binding protein, putative [Ricinus communis] gi|223531120|gb|EEF32969.1| DNA binding protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|356548105|ref|XP_003542444.1| PREDICTED: cyclin-D-binding Myb-like transcription factor 1-like [Glycine max] Back     alignment and taxonomy information
>gi|15237544|ref|NP_198918.1| myb family transcription factor [Arabidopsis thaliana] gi|9759148|dbj|BAB09704.1| unnamed protein product [Arabidopsis thaliana] gi|41619532|gb|AAS10123.1| MYB transcription factor [Arabidopsis thaliana] gi|225879080|dbj|BAH30610.1| hypothetical protein [Arabidopsis thaliana] gi|332007243|gb|AED94626.1| myb family transcription factor [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297801470|ref|XP_002868619.1| hypothetical protein ARALYDRAFT_916116 [Arabidopsis lyrata subsp. lyrata] gi|297314455|gb|EFH44878.1| hypothetical protein ARALYDRAFT_916116 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|222635446|gb|EEE65578.1| hypothetical protein OsJ_21082 [Oryza sativa Japonica Group] Back     alignment and taxonomy information
>gi|218198035|gb|EEC80462.1| hypothetical protein OsI_22667 [Oryza sativa Indica Group] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query563
TAIR|locus:2163066588 AT5G41020 [Arabidopsis thalian 0.859 0.823 0.356 2e-79
UNIPROTKB|E1BWU3 767 DMTF1 "Uncharacterized protein 0.385 0.282 0.266 3.2e-14
UNIPROTKB|E1BU90351 DMTF1 "Uncharacterized protein 0.385 0.618 0.266 3.5e-14
UNIPROTKB|J3QLN9365 DMTF1 "Cyclin-D-binding Myb-li 0.328 0.506 0.277 4.2e-14
UNIPROTKB|F8VXY9378 DMTF1 "Cyclin-D-binding Myb-li 0.328 0.489 0.277 4.8e-14
UNIPROTKB|D4A658 408 Dmtf1 "Cyclin-D-binding Myb-li 0.328 0.453 0.277 6.3e-14
UNIPROTKB|E7EPA0 690 DMTF1 "Cyclin-D-binding Myb-li 0.328 0.268 0.277 2.1e-13
UNIPROTKB|Q9Y222 760 DMTF1 "Cyclin-D-binding Myb-li 0.328 0.243 0.277 2.4e-13
RGD|70966 760 Dmtf1 "cyclin D binding myb-li 0.328 0.243 0.277 2.4e-13
UNIPROTKB|E1BQ00 761 DMTF1 "Uncharacterized protein 0.328 0.243 0.277 2.4e-13
TAIR|locus:2163066 AT5G41020 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 798 (286.0 bits), Expect = 2.0e-79, P = 2.0e-79
 Identities = 183/514 (35%), Positives = 266/514 (51%)

Query:    57 KKTLGKKGHERENGIVTEGEVDFKEEEKKRDVDLRASENEVEMKDDVDENERKINEVGGN 116
             KK   KK   + +   T GE    E    +D + +  +N+ E KD     + +I   G  
Sbjct:     5 KKNKKKKSDAKVDSEET-GEEFISEHSSMKDKEKKRKKNKRENKDGFTGEDMEIT--GRE 61

Query:   117 DFEFGDSRNGVIVEGHVDTNNTGSXXXXXXXXXXXLEISEDENEIPKDMRINNDEEVSEI 176
               + GD       E  +      S             + +   +  K+ + +++ E   +
Sbjct:    62 SEKLGD-------EVFIVKKKKKSKKPIRIDSEAVDAVKKKSKKRSKETKADSEAEDDGV 114

Query:   177 NEDSKQKQLAMDENASLQKNYQEDSGNNSEXXXXXXXXXXXXEGMNNDGIGSSLSDNAEG 236
              + SK+K        S +     ++ +  +            + + N    S +SD  +G
Sbjct:   115 EKKSKEK--------SKETKVDSEAHDGVKRKKKKSKKESGGDVIENTE-SSKVSDKKKG 165

Query:   237 NNKETREAIREREQLDGNMMEKVENGGXXXXXXXXNAHNDGTQAEKLCNANSRVEEIEGH 296
               K     +   E +D  +  K             + + D T   K      +  E    
Sbjct:   166 KRKRDDTDLGAEENIDKEVKRKNNKKKPSVDSDVEDINLDSTNDGKKKRKKKKQSE---D 222

Query:   297 AVLEEDGIKEKKKATSVKKHSGGDKKASQTKKGVEPNDLSEG--SAQKERSKKVSFSNDV 354
             +  EE+G+   K A   +K     KK S+  +  E +D S+   +     SK+V FS+ V
Sbjct:   223 SETEENGLNSTKDAKKRRKKKK-KKKQSEVSEAEEKSDKSDEDLTTPSTSSKRVKFSDQV 281

Query:   355 QVFPSSDAKNGKDDG-----FVRGKRFSKEEDEMIKRAVMNYIETHGLGEEGLNMVLHCR 409
             + FPS D +  +DD       VRGKRF+KEEDEM+K AV+ YI+ H LG+EG+ MV+ C+
Sbjct:   282 EFFPSDDDEGTEDDDEEEVKVVRGKRFTKEEDEMVKNAVLEYIDNHALGDEGIKMVMECK 341

Query:   410 SHPEVKHCWKEIGSALPWRPYDSIYYRAHIIFQRDENRKWTPEELELVRKFHEKHGSNWK 469
             ++P++K CWKEI SALPWR Y+S+Y+RAH IF+      WT E++ELV +F + HG++WK
Sbjct:   342 AYPQLKGCWKEITSALPWRTYNSVYHRAHTIFEAGSQGIWTKEDIELVMEFQKTHGNDWK 401

Query:   470 MLANALGKHRFHVKDAWRRVRLPNQKKGQWSQEEYQKLFDLVNMDLRMRALEEKKTKHGM 529
              LA+A+GKHR HVKDAWRR RL  +KKG W +EEYQ LFDLVN DLRM+A +EK +KHGM
Sbjct:   402 TLADAMGKHRKHVKDAWRRGRLAGKKKGHWMREEYQNLFDLVNKDLRMKAFKEKHSKHGM 461

Query:   530 LRDNISWEAISDKLATRSNAICCMKWYDQLTSPM 563
             L+DNI W AISD L TR +  CC KWY+QL SPM
Sbjct:   462 LKDNIPWMAISDVLETRDHVTCCQKWYEQLISPM 495
GO:0003677 "DNA binding" evidence=IEA;ISS
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=ISS
GO:0005634 "nucleus" evidence=ISM
UNIPROTKB|E1BWU3 DMTF1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|E1BU90 DMTF1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|J3QLN9 DMTF1 "Cyclin-D-binding Myb-like transcription factor 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F8VXY9 DMTF1 "Cyclin-D-binding Myb-like transcription factor 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|D4A658 Dmtf1 "Cyclin-D-binding Myb-like transcription factor 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|E7EPA0 DMTF1 "Cyclin-D-binding Myb-like transcription factor 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q9Y222 DMTF1 "Cyclin-D-binding Myb-like transcription factor 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
RGD|70966 Dmtf1 "cyclin D binding myb-like transcription factor 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|E1BQ00 DMTF1 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00024582001
SubName- Full=Chromosome chr6 scaffold_3, whole genome shotgun sequence; (686 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query563
pfam1392159 pfam13921, Myb_DNA-bind_6, Myb-like DNA-binding do 9e-14
PTZ00121 2084 PTZ00121, PTZ00121, MAEBL; Provisional 0.004
>gnl|CDD|206092 pfam13921, Myb_DNA-bind_6, Myb-like DNA-binding domain Back     alignment and domain information 
 Score = 65.8 bits (161), Expect = 9e-14
 Identities = 25/59 (42%), Positives = 37/59 (62%)

Query: 449 WTPEELELVRKFHEKHGSNWKMLANALGKHRFHVKDAWRRVRLPNQKKGQWSQEEYQKL 507
           WT EE E + K  EK+G++WK +A  LG+     +D WRR   P + +G W++EE Q+L
Sbjct: 1   WTEEEDEKLLKLVEKYGNDWKQIAEELGRTPSACRDRWRRKLRPKRSRGPWTKEEDQRL 59

This family contains the DNA binding domains from Myb proteins, as well as the SANT domain family. Length = 59
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 563
KOG0051607 consensus RNA polymerase I termination factor, Myb 99.97
PLN03212 249 Transcription repressor MYB5; Provisional 99.89
PLN03212249 Transcription repressor MYB5; Provisional 99.87
KOG0049 939 consensus Transcription factor, Myb superfamily [T 99.85
PLN03091 459 hypothetical protein; Provisional 99.85
PLN03091 459 hypothetical protein; Provisional 99.84
KOG0049 939 consensus Transcription factor, Myb superfamily [T 99.84
KOG0048238 consensus Transcription factor, Myb superfamily [T 99.84
KOG0048 238 consensus Transcription factor, Myb superfamily [T 99.84
PF1392160 Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: 99.61
KOG0051607 consensus RNA polymerase I termination factor, Myb 99.59
COG5147 512 REB1 Myb superfamily proteins, including transcrip 99.51
PF1392160 Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: 99.32
KOG0050 617 consensus mRNA splicing protein CDC5 (Myb superfam 99.29
COG5147 512 REB1 Myb superfamily proteins, including transcrip 99.19
PF0024948 Myb_DNA-binding: Myb-like DNA-binding domain; Inte 99.15
KOG0050 617 consensus mRNA splicing protein CDC5 (Myb superfam 99.08
PF0024948 Myb_DNA-binding: Myb-like DNA-binding domain; Inte 99.0
smart0071749 SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-bindi 98.9
cd0016745 SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding do 98.76
smart0071749 SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-bindi 98.66
cd0016745 SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding do 98.5
TIGR0155757 myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF c 96.99
TIGR02894161 DNA_bind_RsfA transcription factor, RsfA family. I 96.92
PF1383790 Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; 96.76
KOG0457 438 consensus Histone acetyltransferase complex SAGA/A 96.69
PF1383790 Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; 96.54
KOG0457 438 consensus Histone acetyltransferase complex SAGA/A 96.49
PF13325199 MCRS_N: N-terminal region of micro-spherule protei 96.43
COG5259 531 RSC8 RSC chromatin remodeling complex subunit RSC8 96.19
KOG1279 506 consensus Chromatin remodeling factor subunit and 95.97
PRK13923170 putative spore coat protein regulator protein YlbO 95.63
TIGR0155757 myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF c 95.29
PF0891465 Myb_DNA-bind_2: Rap1 Myb domain; InterPro: IPR0150 95.28
PF13325199 MCRS_N: N-terminal region of micro-spherule protei 94.86
COG5259531 RSC8 RSC chromatin remodeling complex subunit RSC8 94.82
KOG1279 506 consensus Chromatin remodeling factor subunit and 94.57
PF1387378 Myb_DNA-bind_5: Myb/SANT-like DNA-binding domain 94.43
PF0891465 Myb_DNA-bind_2: Rap1 Myb domain; InterPro: IPR0150 94.22
PF1387378 Myb_DNA-bind_5: Myb/SANT-like DNA-binding domain 93.16
TIGR02894161 DNA_bind_RsfA transcription factor, RsfA family. I 93.15
PRK13923170 putative spore coat protein regulator protein YlbO 91.46
KOG4282 345 consensus Transcription factor GT-2 and related pr 90.32
COG5114 432 Histone acetyltransferase complex SAGA/ADA, subuni 90.03
COG5114 432 Histone acetyltransferase complex SAGA/ADA, subuni 90.0
KOG1194 534 consensus Predicted DNA-binding protein, contains 88.48
KOG4282 345 consensus Transcription factor GT-2 and related pr 87.85
PF0828154 Sigma70_r4_2: Sigma-70, region 4; InterPro: IPR013 83.65
PF09111118 SLIDE: SLIDE; InterPro: IPR015195 The SLIDE domain 83.64
PF1277696 Myb_DNA-bind_3: Myb/SANT-like DNA-binding domain; 82.68
PF1277696 Myb_DNA-bind_3: Myb/SANT-like DNA-binding domain; 82.18
PF1340442 HTH_AsnC-type: AsnC-type helix-turn-helix domain; 81.21
COG5118507 BDP1 Transcription initiation factor TFIIIB, Bdp1 80.07
>KOG0051 consensus RNA polymerase I termination factor, Myb superfamily [Transcription] Back     alignment and domain information 
Probab=99.97  E-value=7.7e-31  Score=285.72  Aligned_cols=194  Identities=31%  Similarity=0.579  Sum_probs=175.2

Q ss_pred             CcCCCCCCHHHHHHHHHHHHHHHHHcCCCccchhhhhcccCC-CcccccHHHHHhHCCCCCHHHHHHHHHHhcCCC--CC
Q 035712          370 FVRGKRFSKEEDEMIKRAVMNYIETHGLGEEGLNMVLHCRSH-PEVKHCWKEIGSALPWRPYDSIYYRAHIIFQRD--EN  446 (563)
Q Consensus       370 ~vKkGkWT~EEDeiL~kaV~ky~~~hGlsee~L~~ll~s~r~-~e~k~~Wk~IA~~LPgRs~kqcy~Rwrr~L~p~--kK  446 (563)
                      .++.+.||++|+.+|.++|..|+..+||+..++.+.++++.+ +....+|+.|...||.|+..++|++.++.+++.  ++
T Consensus       305 e~~~~~F~~eed~ale~~V~~y~~~eg~s~~q~~~~i~s~~~~~~~~~l~n~~~~~Lp~R~~~siy~~~rR~y~~FE~~r  384 (607)
T KOG0051|consen  305 EINLKKFSKEEDAALENFVNEYLANEGWSSEQFCQRIWSKDWKTIIRNLYNNLYKLLPYRDRKSIYHHLRRAYTPFENKR  384 (607)
T ss_pred             hhhhhhccHHHHHHHHHHHHHHHHhhCcchhhhhhheeccCcchHHHHHHHhhhhhcCcccchhHHHHHHhcCCcccccc
Confidence            456689999999999999999999999999999999999988 778999999999999999999999888777753  89


Q ss_pred             CCCCHHHHHHHHHHHHHhCChhHHHHhhhCCChhhHHHHHHHhhccc--CCCCCCCHHHHHHHHHHHHhHHHHHHHHH--
Q 035712          447 RKWTPEELELVRKFHEKHGSNWKMLANALGKHRFHVKDAWRRVRLPN--QKKGQWSQEEYQKLFDLVNMDLRMRALEE--  522 (563)
Q Consensus       447 GkWT~EEDekLielV~kyGn~W~~IAk~LGRT~~QCRdRWr~iL~p~--ikkG~WTqEED~kLielV~e~Lr~k~~~e--  522 (563)
                      |.||+||++.|..+|.+||++|..|+..|||.|.+|++||+++..+.  .++|.||.+|+..|+++|+++++...++-  
T Consensus       385 g~wt~ee~eeL~~l~~~~g~~W~~Ig~~lgr~P~~crd~wr~~~~~g~~~~r~~Ws~eEe~~Llk~V~~~~~~~~q~q~~  464 (607)
T KOG0051|consen  385 GKWTPEEEEELKKLVVEHGNDWKEIGKALGRMPMDCRDRWRQYVKCGSKRNRGAWSIEEEEKLLKTVNEMIREALQPQAS  464 (607)
T ss_pred             CCCCcchHHHHHHHHHHhcccHHHHHHHHccCcHHHHHHHHHhhccccccccCcchHHHHHHHHHHHHHHHHHhhccccc
Confidence            99999999999999999999999999999999999999999998775  58999999999999999999887544331  


Q ss_pred             ------HhhhcCCCCCCCChHHHHhHcCCCCHHHHHHHHHhccCCCC
Q 035712          523 ------KKTKHGMLRDNISWEAISDKLATRSNAICCMKWYDQLTSPM  563 (563)
Q Consensus       523 ------~k~~~G~~~d~IsWs~IS~~LgtRS~~QCR~RW~~iL~p~M  563 (563)
                            .-+..+++.++|+|+.|++.++||++.|||.+|+.+++++|
T Consensus       465 n~~~~~q~sp~s~~~d~I~Wt~vse~~~TR~~~qCr~Kw~kl~~~~s  511 (607)
T KOG0051|consen  465 NTDTGLQESPESTLKDDINWTLVSEMLGTRSRIQCRYKWYKLTTSPS  511 (607)
T ss_pred             ccchhhhcCccccccCCcchhhhhHhhcCCCcchHHHHHHHHHhhHH
Confidence                  11234467799999999999999999999999999998875

>PLN03212 Transcription repressor MYB5; Provisional Back     alignment and domain information
>PLN03212 Transcription repressor MYB5; Provisional Back     alignment and domain information
>KOG0049 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information
>PLN03091 hypothetical protein; Provisional Back     alignment and domain information
>PLN03091 hypothetical protein; Provisional Back     alignment and domain information
>KOG0049 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information
>KOG0048 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information
>KOG0048 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information
>PF13921 Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: 1A5J_A 1MBH_A 1GV5_A 1H89_C 1IDY_A 1MBK_A 1IDZ_A 1H88_C 1GVD_A 1MBG_A Back     alignment and domain information
>KOG0051 consensus RNA polymerase I termination factor, Myb superfamily [Transcription] Back     alignment and domain information
>COG5147 REB1 Myb superfamily proteins, including transcription factors and mRNA splicing factors [Transcription / RNA processing and modification / Cell division and chromosome partitioning] Back     alignment and domain information
>PF13921 Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: 1A5J_A 1MBH_A 1GV5_A 1H89_C 1IDY_A 1MBK_A 1IDZ_A 1H88_C 1GVD_A 1MBG_A Back     alignment and domain information
>KOG0050 consensus mRNA splicing protein CDC5 (Myb superfamily) [RNA processing and modification; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>COG5147 REB1 Myb superfamily proteins, including transcription factors and mRNA splicing factors [Transcription / RNA processing and modification / Cell division and chromosome partitioning] Back     alignment and domain information
>PF00249 Myb_DNA-binding: Myb-like DNA-binding domain; InterPro: IPR014778 The retroviral oncogene v-myb, and its cellular counterpart c-myb, encode nuclear DNA-binding proteins Back     alignment and domain information
>KOG0050 consensus mRNA splicing protein CDC5 (Myb superfamily) [RNA processing and modification; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF00249 Myb_DNA-binding: Myb-like DNA-binding domain; InterPro: IPR014778 The retroviral oncogene v-myb, and its cellular counterpart c-myb, encode nuclear DNA-binding proteins Back     alignment and domain information
>smart00717 SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains Back     alignment and domain information
>cd00167 SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains Back     alignment and domain information
>smart00717 SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains Back     alignment and domain information
>cd00167 SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains Back     alignment and domain information
>TIGR01557 myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF class Back     alignment and domain information
>TIGR02894 DNA_bind_RsfA transcription factor, RsfA family Back     alignment and domain information
>PF13837 Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; PDB: 2EBI_A 2JMW_A Back     alignment and domain information
>KOG0457 consensus Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] Back     alignment and domain information
>PF13837 Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; PDB: 2EBI_A 2JMW_A Back     alignment and domain information
>KOG0457 consensus Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] Back     alignment and domain information
>PF13325 MCRS_N: N-terminal region of micro-spherule protein Back     alignment and domain information
>COG5259 RSC8 RSC chromatin remodeling complex subunit RSC8 [Chromatin structure and dynamics / Transcription] Back     alignment and domain information
>KOG1279 consensus Chromatin remodeling factor subunit and related transcription factors [Chromatin structure and dynamics] Back     alignment and domain information
>PRK13923 putative spore coat protein regulator protein YlbO; Provisional Back     alignment and domain information
>TIGR01557 myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF class Back     alignment and domain information
>PF08914 Myb_DNA-bind_2: Rap1 Myb domain; InterPro: IPR015010 Rap1 Myb adopts a canonical three-helix bundle tertiary structure, with the second and third helices forming a helix-turn-helix variant motif Back     alignment and domain information
>PF13325 MCRS_N: N-terminal region of micro-spherule protein Back     alignment and domain information
>COG5259 RSC8 RSC chromatin remodeling complex subunit RSC8 [Chromatin structure and dynamics / Transcription] Back     alignment and domain information
>KOG1279 consensus Chromatin remodeling factor subunit and related transcription factors [Chromatin structure and dynamics] Back     alignment and domain information
>PF13873 Myb_DNA-bind_5: Myb/SANT-like DNA-binding domain Back     alignment and domain information
>PF08914 Myb_DNA-bind_2: Rap1 Myb domain; InterPro: IPR015010 Rap1 Myb adopts a canonical three-helix bundle tertiary structure, with the second and third helices forming a helix-turn-helix variant motif Back     alignment and domain information
>PF13873 Myb_DNA-bind_5: Myb/SANT-like DNA-binding domain Back     alignment and domain information
>TIGR02894 DNA_bind_RsfA transcription factor, RsfA family Back     alignment and domain information
>PRK13923 putative spore coat protein regulator protein YlbO; Provisional Back     alignment and domain information
>KOG4282 consensus Transcription factor GT-2 and related proteins, contains trihelix DNA-binding/SANT domain [Transcription] Back     alignment and domain information
>COG5114 Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] Back     alignment and domain information
>COG5114 Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] Back     alignment and domain information
>KOG1194 consensus Predicted DNA-binding protein, contains Myb-like, SANT and ELM2 domains [Transcription] Back     alignment and domain information
>KOG4282 consensus Transcription factor GT-2 and related proteins, contains trihelix DNA-binding/SANT domain [Transcription] Back     alignment and domain information
>PF08281 Sigma70_r4_2: Sigma-70, region 4; InterPro: IPR013249 The bacterial core RNA polymerase complex, which consists of five subunits, is sufficient for transcription elongation and termination but is unable to initiate transcription Back     alignment and domain information
>PF09111 SLIDE: SLIDE; InterPro: IPR015195 The SLIDE domain adopts a secondary structure comprising a main core of three alpha-helices Back     alignment and domain information
>PF12776 Myb_DNA-bind_3: Myb/SANT-like DNA-binding domain; InterPro: IPR024752 This domain, found in a range of uncharacterised proteins, may be related to Myb/SANT-like DNA binding domains Back     alignment and domain information
>PF12776 Myb_DNA-bind_3: Myb/SANT-like DNA-binding domain; InterPro: IPR024752 This domain, found in a range of uncharacterised proteins, may be related to Myb/SANT-like DNA binding domains Back     alignment and domain information
>PF13404 HTH_AsnC-type: AsnC-type helix-turn-helix domain; PDB: 2ZNY_E 2ZNZ_G 1RI7_A 2CYY_A 2E1C_A 2VC1_B 2QZ8_A 2W29_C 2IVM_B 2VBX_B Back     alignment and domain information
>COG5118 BDP1 Transcription initiation factor TFIIIB, Bdp1 subunit [Transcription] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query563
2llk_A73 Solution Nmr Structure Of The N-Terminal Myb-Like 1 2e-04
1h88_C159 Crystal Structure Of Ternary Protein-Dna Complex1 L 6e-04
3osf_A126 The Structure Of Protozoan Parasite Trichomonas Vag 7e-04
>pdb|2LLK|A Chain A, Solution Nmr Structure Of The N-Terminal Myb-Like 1 Domain Of The Human Cyclin-D-Binding Transcription Factor 1 (Hdmp1), Northeast Structural Genomics Consortium (Nesg) Target Id Hr8011a Length = 73 Back     alignment and structure 
Iteration: 1

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 22/57 (38%), Positives = 35/57 (61%), Gaps = 2/57 (3%)
Query: 436 RAHIIFQRDENR--KWTPEELELVRKFHEKHGSNWKMLANALGKHRFHVKDAWRRVR 490
           R ++ FQ D N   K+TPEE+E +++   KHG++W  +  ALG+    VKD  R ++
Sbjct: 11  RENLYFQGDRNHVGKYTPEEIEKLKELRIKHGNDWATIGAALGRSASSVKDRCRLMK 67
>pdb|1H88|C Chain C, Crystal Structure Of Ternary Protein-Dna Complex1 Length = 159 Back     alignment and structure
>pdb|3OSF|A Chain A, The Structure Of Protozoan Parasite Trichomonas Vaginalis Myb2 In Complex With Mre-2f-13 Dna Length = 126 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query563
1h89_C159 C-MYB, MYB proto-oncogene protein; transcription/D 1e-11
1h89_C159 C-MYB, MYB proto-oncogene protein; transcription/D 1e-07
1h89_C159 C-MYB, MYB proto-oncogene protein; transcription/D 2e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-11
2llk_A73 Cyclin-D-binding MYB-like transcription factor 1; 6e-10
3osg_A126 MYB21; transcription-DNA complex, MYB2, R2R3 domai 4e-05
1h8a_C128 AMV V-MYB, MYB transforming protein; transcription 3e-04
2k9n_A107 MYB24; R2R3 domain, DNA-binding, nucleus, DNA bind 8e-04
>1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C Length = 159 Back     alignment and structure
 Score = 62.3 bits (152), Expect = 1e-11
 Identities = 36/121 (29%), Positives = 57/121 (47%), Gaps = 31/121 (25%)

Query: 447 RKWTPEELELVRKFHEKHGS-NWKMLANALG-------KHRFHVKDAWRRVRLPNQKKGQ 498
            +WT EE E ++K  E++G+ +WK++AN L        +HR      W++V  P   KG 
Sbjct: 7   TRWTREEDEKLKKLVEQNGTDDWKVIANYLPNRTDVQCQHR------WQKVLNPELIKGP 60

Query: 499 WSQEEYQKLFDLVNMDLRMRALEEKKTKHGMLRDNISWEAISDKLATRSNAICCMKWYDQ 558
           W++EE Q++  LV              K+G  R    W  I+  L  R    C  +W++ 
Sbjct: 61  WTKEEDQRVIKLVQ-------------KYGPKR----WSVIAKHLKGRIGKQCRERWHNH 103

Query: 559 L 559
           L
Sbjct: 104 L 104
>1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C Length = 159 Back     alignment and structure
>1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C Length = 159 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2llk_A Cyclin-D-binding MYB-like transcription factor 1; helix bundle, SGC, structural genomics consortium, NESG, NOR structural genomics consortium; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>3osg_A MYB21; transcription-DNA complex, MYB2, R2R3 domain, DNA binding PR transcription factor; 2.00A {Trichomonas vaginalis} PDB: 3osf_A Length = 126 Back     alignment and structure
>1h8a_C AMV V-MYB, MYB transforming protein; transcription/DNA; 2.23A {Avian myeloblastosis virus} SCOP: a.4.1.3 a.4.1.3 Length = 128 Back     alignment and structure
>2k9n_A MYB24; R2R3 domain, DNA-binding, nucleus, DNA binding protein; NMR {Trichomonas vaginalis} PDB: 2kdz_A Length = 107 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query563
1h89_C159 C-MYB, MYB proto-oncogene protein; transcription/D 100.0
1h8a_C128 AMV V-MYB, MYB transforming protein; transcription 99.98
1gv2_A105 C-MYB, MYB proto-oncogene protein; transcription, 99.94
2k9n_A107 MYB24; R2R3 domain, DNA-binding, nucleus, DNA bind 99.93
3osg_A126 MYB21; transcription-DNA complex, MYB2, R2R3 domai 99.93
3zqc_A131 MYB3; transcription-DNA complex, DNA-binding prote 99.93
3zqc_A131 MYB3; transcription-DNA complex, DNA-binding prote 99.93
1gv2_A105 C-MYB, MYB proto-oncogene protein; transcription, 99.92
2k9n_A107 MYB24; R2R3 domain, DNA-binding, nucleus, DNA bind 99.92
3osg_A126 MYB21; transcription-DNA complex, MYB2, R2R3 domai 99.92
1h8a_C128 AMV V-MYB, MYB transforming protein; transcription 99.91
1h89_C159 C-MYB, MYB proto-oncogene protein; transcription/D 99.89
2dim_A70 Cell division cycle 5-like protein; MYB_DNA-bindin 99.68
1ign_A246 Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, 99.54
2dim_A70 Cell division cycle 5-like protein; MYB_DNA-bindin 99.53
2llk_A73 Cyclin-D-binding MYB-like transcription factor 1; 99.51
1guu_A52 C-MYB, MYB proto-oncogene protein; transcription, 99.46
2d9a_A60 B-MYB, MYB-related protein B; DNA binding, structu 99.44
1gvd_A52 MYB proto-oncogene protein; transcription, transcr 99.44
2din_A66 Cell division cycle 5-like protein; MYB_DNA-bindin 99.44
1ign_A246 Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, 99.38
3sjm_A64 Telomeric repeat-binding factor 2; human telomeric 99.38
1ity_A69 TRF1; helix-turn-helix, telomeres, DNA binding, MY 99.37
2juh_A121 Telomere binding protein TBP1; helix, nucleus, nuc 99.37
2d9a_A60 B-MYB, MYB-related protein B; DNA binding, structu 99.37
2roh_A122 RTBP1, telomere binding protein-1; plant, nucleus, 99.35
2cu7_A72 KIAA1915 protein; nuclear protein, SANT domain, DN 99.34
1x41_A60 Transcriptional adaptor 2-like, isoform B; transcr 99.34
1gvd_A52 MYB proto-oncogene protein; transcription, transcr 99.34
1w0t_A53 Telomeric repeat binding factor 1; telomere, DNA-b 99.33
1guu_A52 C-MYB, MYB proto-oncogene protein; transcription, 99.32
2elk_A58 SPCC24B10.08C protein; hypothetical protein, struc 99.27
2llk_A73 Cyclin-D-binding MYB-like transcription factor 1; 99.27
2juh_A121 Telomere binding protein TBP1; helix, nucleus, nuc 99.26
2yum_A75 ZZZ3 protein, zinc finger ZZ-type-containing prote 99.26
1x41_A60 Transcriptional adaptor 2-like, isoform B; transcr 99.23
2din_A66 Cell division cycle 5-like protein; MYB_DNA-bindin 99.21
1ity_A69 TRF1; helix-turn-helix, telomeres, DNA binding, MY 99.2
2roh_A122 RTBP1, telomere binding protein-1; plant, nucleus, 99.19
2ckx_A83 NGTRF1, telomere binding protein TBP1; nuclear pro 99.19
3sjm_A64 Telomeric repeat-binding factor 2; human telomeric 99.18
1w0t_A53 Telomeric repeat binding factor 1; telomere, DNA-b 99.16
2cu7_A72 KIAA1915 protein; nuclear protein, SANT domain, DN 99.13
2elk_A58 SPCC24B10.08C protein; hypothetical protein, struc 99.13
2yus_A79 SWI/SNF-related matrix-associated actin- dependent 99.07
2ltp_A89 Nuclear receptor corepressor 2; SMRT, TRAC, SGC, s 98.64
2yum_A75 ZZZ3 protein, zinc finger ZZ-type-containing prote 99.05
2aje_A105 Telomere repeat-binding protein; DNA-binding, Trp, 99.04
2cqr_A73 RSGI RUH-043, DNAJ homolog subfamily C member 1; m 98.99
2yus_A79 SWI/SNF-related matrix-associated actin- dependent 98.9
2ltp_A89 Nuclear receptor corepressor 2; SMRT, TRAC, SGC, s 98.42
1x58_A62 Hypothetical protein 4930532D21RIK; MUS musculus a 98.89
2cqr_A73 RSGI RUH-043, DNAJ homolog subfamily C member 1; m 98.79
2cjj_A93 Radialis; plant development, DNA-binding protein, 98.73
2ckx_A83 NGTRF1, telomere binding protein TBP1; nuclear pro 98.65
2aje_A105 Telomere repeat-binding protein; DNA-binding, Trp, 98.62
2eqr_A61 N-COR1, N-COR, nuclear receptor corepressor 1; SAN 98.59
2cjj_A93 Radialis; plant development, DNA-binding protein, 98.54
2cqq_A72 RSGI RUH-037, DNAJ homolog subfamily C member 1; m 98.43
2eqr_A61 N-COR1, N-COR, nuclear receptor corepressor 1; SAN 98.24
1x58_A62 Hypothetical protein 4930532D21RIK; MUS musculus a 98.23
2iw5_B235 Protein corest, REST corepressor 1; oxidoreductase 98.2
1wgx_A73 KIAA1903 protein; MYB DNA-binding domain, human cD 98.11
3hm5_A93 DNA methyltransferase 1-associated protein 1; DNA 98.1
2xag_B482 REST corepressor 1; amine oxidase, chromatin regul 98.06
1fex_A59 TRF2-interacting telomeric RAP1 protein; helix tur 97.94
2cqq_A72 RSGI RUH-037, DNAJ homolog subfamily C member 1; m 97.86
1wgx_A73 KIAA1903 protein; MYB DNA-binding domain, human cD 97.83
2iw5_B235 Protein corest, REST corepressor 1; oxidoreductase 97.81
1fex_A59 TRF2-interacting telomeric RAP1 protein; helix tur 97.66
3hm5_A93 DNA methyltransferase 1-associated protein 1; DNA 97.55
2lr8_A70 CAsp8-associated protein 2; structural genomics, n 96.58
1ug2_A95 2610100B20RIK gene product; hypothetical protein, 97.39
2yqk_A63 Arginine-glutamic acid dipeptide repeats protein; 97.19
1ofc_X304 ISWI protein; nuclear protein, chromatin remodelin 97.17
4eef_G74 F-HB80.4, designed hemagglutinin binding protein; 97.11
2xag_B482 REST corepressor 1; amine oxidase, chromatin regul 97.1
2ebi_A86 DNA binding protein GT-1; DNA-binding domain, phos 97.02
2crg_A70 Metastasis associated protein MTA3; transcription 96.87
4eef_G74 F-HB80.4, designed hemagglutinin binding protein; 96.84
1ofc_X304 ISWI protein; nuclear protein, chromatin remodelin 96.83
4a69_C94 Nuclear receptor corepressor 2; transcription, hyd 96.82
2ebi_A86 DNA binding protein GT-1; DNA-binding domain, phos 96.78
2yqk_A63 Arginine-glutamic acid dipeptide repeats protein; 96.55
4iej_A93 DNA methyltransferase 1-associated protein 1; DNA 96.31
1ug2_A95 2610100B20RIK gene product; hypothetical protein, 96.15
4a69_C94 Nuclear receptor corepressor 2; transcription, hyd 95.51
2crg_A70 Metastasis associated protein MTA3; transcription 95.48
4iej_A93 DNA methyltransferase 1-associated protein 1; DNA 94.87
4b4c_A211 Chromodomain-helicase-DNA-binding protein 1; chrom 94.3
2lr8_A70 CAsp8-associated protein 2; structural genomics, n 93.28
2y9y_A374 Imitation switch protein 1 (DEL_ATPase); transcrip 94.2
4b4c_A211 Chromodomain-helicase-DNA-binding protein 1; chrom 94.15
2y9y_A374 Imitation switch protein 1 (DEL_ATPase); transcrip 91.07
1irz_A64 ARR10-B; helix-turn-helix, DNA binding protein; NM 90.71
>1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C Back     alignment and structure
Probab=100.00  E-value=2.7e-37  Score=286.63  Aligned_cols=154  Identities=25%  Similarity=0.458  Sum_probs=107.8

Q ss_pred             CcCCCCCCHHHHHHHHHHHHHHHHHcCCCccchhhhhcccCCCcccccHHHHHhHCCCCCHHHHHHHHHHhcCCC-CCCC
Q 035712          370 FVRGKRFSKEEDEMIKRAVMNYIETHGLGEEGLNMVLHCRSHPEVKHCWKEIGSALPWRPYDSIYYRAHIIFQRD-ENRK  448 (563)
Q Consensus       370 ~vKkGkWT~EEDeiL~kaV~ky~~~hGlsee~L~~ll~s~r~~e~k~~Wk~IA~~LPgRs~kqcy~Rwrr~L~p~-kKGk  448 (563)
                      .+.+|+||+|||++|.++|..|+.                      .+|..||..||+|++.||+.||.++|+|. .+|+
T Consensus         3 ~~~k~~Wt~eED~~L~~~v~~~g~----------------------~~W~~Ia~~l~~Rt~~qcr~Rw~~~l~p~~~~~~   60 (159)
T 1h89_C            3 HLGKTRWTREEDEKLKKLVEQNGT----------------------DDWKVIANYLPNRTDVQCQHRWQKVLNPELIKGP   60 (159)
T ss_dssp             --------------------------------------------------------------CHHHHHHTTTCTTCCCSC
T ss_pred             CCCCCCCCHHHHHHHHHHHHHhCC----------------------CCHHHHHHHcCCCCHHHHHHHHHHccCCCcCCCC
Confidence            356789999999999999999852                      38999999999999999999999999985 8999


Q ss_pred             CCHHHHHHHHHHHHHhCC-hhHHHHhhh-CCChhhHHHHHHHhhcccCCCCCCCHHHHHHHHHHHHhHHHHHHHHHHhhh
Q 035712          449 WTPEELELVRKFHEKHGS-NWKMLANAL-GKHRFHVKDAWRRVRLPNQKKGQWSQEEYQKLFDLVNMDLRMRALEEKKTK  526 (563)
Q Consensus       449 WT~EEDekLielV~kyGn-~W~~IAk~L-GRT~~QCRdRWr~iL~p~ikkG~WTqEED~kLielV~e~Lr~k~~~e~k~~  526 (563)
                      ||+|||..|+.+|..||. +|..||..| |||+.||++||.++|.|.+.+++||++||..|+.++.             .
T Consensus        61 Wt~eEd~~L~~~v~~~g~~~W~~Ia~~l~~Rt~~qcr~Rw~~~l~p~~~~~~WT~eEd~~L~~~~~-------------~  127 (159)
T 1h89_C           61 WTKEEDQRVIKLVQKYGPKRWSVIAKHLKGRIGKQCRERWHNHLNPEVKKTSWTEEEDRIIYQAHK-------------R  127 (159)
T ss_dssp             CCHHHHHHHHHHHHHHCSCCHHHHHHTSTTCCHHHHHHHHHHTTCTTSCCSCCCHHHHHHHHHHHH-------------H
T ss_pred             CChHHHHHHHHHHHHhCcccHHHHHHHcCCCCHHHHHHHHHHHhCccccccCCChHHHHHHHHHHH-------------H
Confidence            999999999999999997 799999999 9999999999999999999999999999999999998             6


Q ss_pred             cCCCCCCCChHHHHhHcCCCCHHHHHHHHHhccCCCC
Q 035712          527 HGMLRDNISWEAISDKLATRSNAICCMKWYDQLTSPM  563 (563)
Q Consensus       527 ~G~~~d~IsWs~IS~~LgtRS~~QCR~RW~~iL~p~M  563 (563)
                      +|     .+|+.||..||+||+.||++||+.+|.+.|
T Consensus       128 ~g-----~~W~~Ia~~l~gRt~~~~knr~~~~~r~~~  159 (159)
T 1h89_C          128 LG-----NRWAEIAKLLPGRTDNAIKNHWNSTMRRKV  159 (159)
T ss_dssp             HC-----SCHHHHHTTSTTCCHHHHHHHHHTTTCC--
T ss_pred             HC-----CCHHHHHHHCCCCCHHHHHHHHHHHHhccC
Confidence            77     599999999999999999999999998764
>1h8a_C AMV V-MYB, MYB transforming protein; transcription/DNA; 2.23A {Avian myeloblastosis virus} SCOP: a.4.1.3 a.4.1.3 Back     alignment and structure
>1gv2_A C-MYB, MYB proto-oncogene protein; transcription, DNA binding, ION binding; 1.68A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 PDB: 1mse_C* 1msf_C* 1a5j_A 1idy_A 1idz_A 1mbj_A 1mbk_A Back     alignment and structure
>2k9n_A MYB24; R2R3 domain, DNA-binding, nucleus, DNA binding protein; NMR {Trichomonas vaginalis} PDB: 2kdz_A Back     alignment and structure
>3osg_A MYB21; transcription-DNA complex, MYB2, R2R3 domain, DNA binding PR transcription factor; 2.00A {Trichomonas vaginalis} PDB: 3osf_A Back     alignment and structure
>3zqc_A MYB3; transcription-DNA complex, DNA-binding protein, nucleus; 2.90A {Trichomonas vaginalis} Back     alignment and structure
>3zqc_A MYB3; transcription-DNA complex, DNA-binding protein, nucleus; 2.90A {Trichomonas vaginalis} Back     alignment and structure
>1gv2_A C-MYB, MYB proto-oncogene protein; transcription, DNA binding, ION binding; 1.68A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 PDB: 1mse_C* 1msf_C* 1a5j_A 1idy_A 1idz_A 1mbj_A 1mbk_A Back     alignment and structure
>2k9n_A MYB24; R2R3 domain, DNA-binding, nucleus, DNA binding protein; NMR {Trichomonas vaginalis} PDB: 2kdz_A Back     alignment and structure
>3osg_A MYB21; transcription-DNA complex, MYB2, R2R3 domain, DNA binding PR transcription factor; 2.00A {Trichomonas vaginalis} PDB: 3osf_A Back     alignment and structure
>1h8a_C AMV V-MYB, MYB transforming protein; transcription/DNA; 2.23A {Avian myeloblastosis virus} SCOP: a.4.1.3 a.4.1.3 Back     alignment and structure
>1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C Back     alignment and structure
>2dim_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1ign_A Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, DNA binding protein/DNA complex; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.6 a.4.1.6 PDB: 3ukg_A Back     alignment and structure
>2dim_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2llk_A Cyclin-D-binding MYB-like transcription factor 1; helix bundle, SGC, structural genomics consortium, NESG, NOR structural genomics consortium; NMR {Homo sapiens} Back     alignment and structure
>1guu_A C-MYB, MYB proto-oncogene protein; transcription, transcription regulation, DNA binding, ION bindi proto-oncogene, nuclear protein, activator; 1.6A {Mus musculus} SCOP: a.4.1.3 PDB: 1mbe_A 1mbf_A Back     alignment and structure
>2d9a_A B-MYB, MYB-related protein B; DNA binding, structural genomics, unknown function, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1gvd_A MYB proto-oncogene protein; transcription, transcription regulation, C-MYB, DNA binding, ION binding, nuclear protein; 1.45A {Mus musculus} SCOP: a.4.1.3 PDB: 1gv5_A 1mbg_A 1mbh_A Back     alignment and structure
>2din_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1ign_A Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, DNA binding protein/DNA complex; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.6 a.4.1.6 PDB: 3ukg_A Back     alignment and structure
>3sjm_A Telomeric repeat-binding factor 2; human telomeric repeat binding protein 2, telomere, telomeri homeodomain proteins amino acid sequence; HET: DNA; 1.35A {Homo sapiens} PDB: 1xg1_A 1vfc_A 1vf9_A 1w0u_A Back     alignment and structure
>1ity_A TRF1; helix-turn-helix, telomeres, DNA binding, MYB domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1iv6_A Back     alignment and structure
>2juh_A Telomere binding protein TBP1; helix, nucleus, nuclear protein; NMR {Nicotiana glutinosa} Back     alignment and structure
>2d9a_A B-MYB, MYB-related protein B; DNA binding, structural genomics, unknown function, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2roh_A RTBP1, telomere binding protein-1; plant, nucleus, DNA binding protein; NMR {Oryza sativa} Back     alignment and structure
>2cu7_A KIAA1915 protein; nuclear protein, SANT domain, DNA binding, regulation of transcription, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>1x41_A Transcriptional adaptor 2-like, isoform B; transcriptional adaptor protein2, transcriptional activation, MYB domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1gvd_A MYB proto-oncogene protein; transcription, transcription regulation, C-MYB, DNA binding, ION binding, nuclear protein; 1.45A {Mus musculus} SCOP: a.4.1.3 PDB: 1gv5_A 1mbg_A 1mbh_A Back     alignment and structure
>1w0t_A Telomeric repeat binding factor 1; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle; 2.00A {Homo sapiens} SCOP: a.4.1.4 PDB: 1ba5_A Back     alignment and structure
>1guu_A C-MYB, MYB proto-oncogene protein; transcription, transcription regulation, DNA binding, ION bindi proto-oncogene, nuclear protein, activator; 1.6A {Mus musculus} SCOP: a.4.1.3 PDB: 1mbe_A 1mbf_A Back     alignment and structure
>2elk_A SPCC24B10.08C protein; hypothetical protein, structural genomics, NPPSFA; NMR {Schizosaccharomyces pombe} Back     alignment and structure
>2llk_A Cyclin-D-binding MYB-like transcription factor 1; helix bundle, SGC, structural genomics consortium, NESG, NOR structural genomics consortium; NMR {Homo sapiens} Back     alignment and structure
>2juh_A Telomere binding protein TBP1; helix, nucleus, nuclear protein; NMR {Nicotiana glutinosa} Back     alignment and structure
>2yum_A ZZZ3 protein, zinc finger ZZ-type-containing protein 3; transcription, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x41_A Transcriptional adaptor 2-like, isoform B; transcriptional adaptor protein2, transcriptional activation, MYB domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2din_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1ity_A TRF1; helix-turn-helix, telomeres, DNA binding, MYB domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1iv6_A Back     alignment and structure
>2roh_A RTBP1, telomere binding protein-1; plant, nucleus, DNA binding protein; NMR {Oryza sativa} Back     alignment and structure
>2ckx_A NGTRF1, telomere binding protein TBP1; nuclear protein; 1.9A {Nicotiana tabacum} SCOP: a.4.1.3 PDB: 2qhb_A Back     alignment and structure
>3sjm_A Telomeric repeat-binding factor 2; human telomeric repeat binding protein 2, telomere, telomeri homeodomain proteins amino acid sequence; HET: DNA; 1.35A {Homo sapiens} PDB: 1xg1_A 1vfc_A 1vf9_A 1w0u_A Back     alignment and structure
>1w0t_A Telomeric repeat binding factor 1; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle; 2.00A {Homo sapiens} SCOP: a.4.1.4 PDB: 1ba5_A Back     alignment and structure
>2cu7_A KIAA1915 protein; nuclear protein, SANT domain, DNA binding, regulation of transcription, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>2elk_A SPCC24B10.08C protein; hypothetical protein, structural genomics, NPPSFA; NMR {Schizosaccharomyces pombe} Back     alignment and structure
>2yus_A SWI/SNF-related matrix-associated actin- dependent regulator of chromatin subfamily...; SWI/SNF complex 155 kDa subunit, BRG1-associated factor 155; NMR {Homo sapiens} Back     alignment and structure
>2ltp_A Nuclear receptor corepressor 2; SMRT, TRAC, SGC, structural genomics consortium, NESG, north structural genomics consortium; NMR {Homo sapiens} Back     alignment and structure
>2yum_A ZZZ3 protein, zinc finger ZZ-type-containing protein 3; transcription, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2aje_A Telomere repeat-binding protein; DNA-binding, Trp, MYB motif, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.3 Back     alignment and structure
>2cqr_A RSGI RUH-043, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>2yus_A SWI/SNF-related matrix-associated actin- dependent regulator of chromatin subfamily...; SWI/SNF complex 155 kDa subunit, BRG1-associated factor 155; NMR {Homo sapiens} Back     alignment and structure
>2ltp_A Nuclear receptor corepressor 2; SMRT, TRAC, SGC, structural genomics consortium, NESG, north structural genomics consortium; NMR {Homo sapiens} Back     alignment and structure
>1x58_A Hypothetical protein 4930532D21RIK; MUS musculus adult MALE testis cDNA, riken FULL-length enriched library, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2cqr_A RSGI RUH-043, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>2cjj_A Radialis; plant development, DNA-binding protein, MYB transcription FA DNA-binding, nuclear protein, floral asymmetry; 1.9A {Antirrhinum majus} SCOP: a.4.1.3 Back     alignment and structure
>2ckx_A NGTRF1, telomere binding protein TBP1; nuclear protein; 1.9A {Nicotiana tabacum} SCOP: a.4.1.3 PDB: 2qhb_A Back     alignment and structure
>2aje_A Telomere repeat-binding protein; DNA-binding, Trp, MYB motif, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.3 Back     alignment and structure
>2eqr_A N-COR1, N-COR, nuclear receptor corepressor 1; SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cjj_A Radialis; plant development, DNA-binding protein, MYB transcription FA DNA-binding, nuclear protein, floral asymmetry; 1.9A {Antirrhinum majus} SCOP: a.4.1.3 Back     alignment and structure
>2cqq_A RSGI RUH-037, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>2eqr_A N-COR1, N-COR, nuclear receptor corepressor 1; SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x58_A Hypothetical protein 4930532D21RIK; MUS musculus adult MALE testis cDNA, riken FULL-length enriched library, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2iw5_B Protein corest, REST corepressor 1; oxidoreductase-transcription regulator complex, oxidoreductase/repressor complex, histone demethylase, FAD; HET: FAD; 2.57A {Homo sapiens} SCOP: a.4.1.3 PDB: 2uxn_B* 2uxx_B* 2y48_B* 2v1d_B* 2x0l_B* Back     alignment and structure
>1wgx_A KIAA1903 protein; MYB DNA-binding domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>3hm5_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin, structural genomics consortium, SGC, activator, chromatin regulator; HET: DNA; 1.80A {Homo sapiens} Back     alignment and structure
>2xag_B REST corepressor 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_B* 2xah_B* 2xaj_B* 2xaq_B* 2xas_B* Back     alignment and structure
>1fex_A TRF2-interacting telomeric RAP1 protein; helix turn helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Synthetic} SCOP: a.4.1.3 Back     alignment and structure
>2cqq_A RSGI RUH-037, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>1wgx_A KIAA1903 protein; MYB DNA-binding domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>2iw5_B Protein corest, REST corepressor 1; oxidoreductase-transcription regulator complex, oxidoreductase/repressor complex, histone demethylase, FAD; HET: FAD; 2.57A {Homo sapiens} SCOP: a.4.1.3 PDB: 2uxn_B* 2uxx_B* 2y48_B* 2v1d_B* 2x0l_B* Back     alignment and structure
>1fex_A TRF2-interacting telomeric RAP1 protein; helix turn helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Synthetic} SCOP: a.4.1.3 Back     alignment and structure
>3hm5_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin, structural genomics consortium, SGC, activator, chromatin regulator; HET: DNA; 1.80A {Homo sapiens} Back     alignment and structure
>2lr8_A CAsp8-associated protein 2; structural genomics, northeast structural genomics consortiu PSI-biology, apoptosis; NMR {Homo sapiens} Back     alignment and structure
>1ug2_A 2610100B20RIK gene product; hypothetical protein, MYB-like DNA binding domain, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: a.4.1.3 Back     alignment and structure
>2yqk_A Arginine-glutamic acid dipeptide repeats protein; structure genomics, SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1ofc_X ISWI protein; nuclear protein, chromatin remodeling factor, ATPase, SANT domain, nucleosome recognition; HET: GLC G4D; 1.9A {Drosophila melanogaster} SCOP: a.4.1.3 a.4.1.13 a.187.1.1 PDB: 2nog_A Back     alignment and structure
>4eef_G F-HB80.4, designed hemagglutinin binding protein; immunoglobulin, fusion of virus membrane with membrane, membrane fusion, sialic acid, virion; HET: NAG BMA; 2.70A {Artificial gene} Back     alignment and structure
>2xag_B REST corepressor 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_B* 2xah_B* 2xaj_B* 2xaq_B* 2xas_B* Back     alignment and structure
>2ebi_A DNA binding protein GT-1; DNA-binding domain, phosphorylation; HET: DNA; NMR {Arabidopsis thaliana} PDB: 2jmw_A* Back     alignment and structure
>2crg_A Metastasis associated protein MTA3; transcription factor, helix turn helix, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.3 Back     alignment and structure
>4eef_G F-HB80.4, designed hemagglutinin binding protein; immunoglobulin, fusion of virus membrane with membrane, membrane fusion, sialic acid, virion; HET: NAG BMA; 2.70A {Artificial gene} Back     alignment and structure
>1ofc_X ISWI protein; nuclear protein, chromatin remodeling factor, ATPase, SANT domain, nucleosome recognition; HET: GLC G4D; 1.9A {Drosophila melanogaster} SCOP: a.4.1.3 a.4.1.13 a.187.1.1 PDB: 2nog_A Back     alignment and structure
>4a69_C Nuclear receptor corepressor 2; transcription, hydrolase; HET: I0P; 2.06A {Homo sapiens} PDB: 1xc5_A Back     alignment and structure
>2ebi_A DNA binding protein GT-1; DNA-binding domain, phosphorylation; HET: DNA; NMR {Arabidopsis thaliana} PDB: 2jmw_A* Back     alignment and structure
>2yqk_A Arginine-glutamic acid dipeptide repeats protein; structure genomics, SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4iej_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin regulator, repressor, structural joint center for structural genomics; HET: DNA; 1.45A {Homo sapiens} PDB: 3hm5_A* Back     alignment and structure
>1ug2_A 2610100B20RIK gene product; hypothetical protein, MYB-like DNA binding domain, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: a.4.1.3 Back     alignment and structure
>4a69_C Nuclear receptor corepressor 2; transcription, hydrolase; HET: I0P; 2.06A {Homo sapiens} PDB: 1xc5_A Back     alignment and structure
>2crg_A Metastasis associated protein MTA3; transcription factor, helix turn helix, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.3 Back     alignment and structure
>4iej_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin regulator, repressor, structural joint center for structural genomics; HET: DNA; 1.45A {Homo sapiens} PDB: 3hm5_A* Back     alignment and structure
>4b4c_A Chromodomain-helicase-DNA-binding protein 1; chromatin-remodeling, histone acetylation COMP chromatin regulation, transcription; 1.62A {Homo sapiens} Back     alignment and structure
>2lr8_A CAsp8-associated protein 2; structural genomics, northeast structural genomics consortiu PSI-biology, apoptosis; NMR {Homo sapiens} Back     alignment and structure
>2y9y_A Imitation switch protein 1 (DEL_ATPase); transcription, nuclear protein complex, chromatin remodeling nucleosome remodeling; 3.25A {Saccharomyces cerevisiae} PDB: 2y9z_A Back     alignment and structure
>4b4c_A Chromodomain-helicase-DNA-binding protein 1; chromatin-remodeling, histone acetylation COMP chromatin regulation, transcription; 1.62A {Homo sapiens} Back     alignment and structure
>2y9y_A Imitation switch protein 1 (DEL_ATPase); transcription, nuclear protein complex, chromatin remodeling nucleosome remodeling; 3.25A {Saccharomyces cerevisiae} PDB: 2y9z_A Back     alignment and structure
>1irz_A ARR10-B; helix-turn-helix, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.11 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 563
d1igna186 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Ba 8e-06
d2cu7a165 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sap 6e-05
d2iw5b165 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Hu 0.004
>d1igna1 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 86 Back     information, alignment and structure

class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: DNA-binding domain of rap1
domain: DNA-binding domain of rap1
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

 Score = 42.2 bits (99), Expect = 8e-06
 Identities = 7/71 (9%), Positives = 23/71 (32%), Gaps = 7/71 (9%)

Query: 447 RKWTPEELELVRKFHEKHGS------NWKMLANAL-GKHRFHVKDAWRRVRLPNQKKGQW 499
             +T EE E +     K+ +       +  +++ +       ++  +R       +    
Sbjct: 2   ASFTDEEDEFILDVVRKNPTRRTTHTLYDEISHYVPNHTGNSIRHRFRVYLSKRLEYVYE 61

Query: 500 SQEEYQKLFDL 510
             +  + + D 
Sbjct: 62  VDKFGKLVRDD 72
>d2cu7a1 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d2iw5b1 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query563
d1igna186 DNA-binding domain of rap1 {Baker's yeast (Sacchar 99.53
d1gvda_52 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.48
d1guua_50 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.45
d1gv2a247 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.42
d1gvda_52 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.39
d1igna186 DNA-binding domain of rap1 {Baker's yeast (Sacchar 99.37
d1guua_50 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.33
d1w0ua_55 Telomeric repeat binding factor 2, TRF2 {Human (Ho 99.32
d1w0ta_52 DNA-binding domain of human telomeric protein, hTR 99.28
d2cu7a165 MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 960 99.26
d2ckxa183 Telomere binding protein TBP1 {Tobacco (Nicotiana 99.25
d1gv2a247 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.2
d1x41a147 Transcriptional adaptor 2-like, TADA2L, isoform b 99.15
d1x41a147 Transcriptional adaptor 2-like, TADA2L, isoform b 99.06
d1w0ua_55 Telomeric repeat binding factor 2, TRF2 {Human (Ho 99.05
d2cqra160 DnaJ homolog subfamily C member 1 {Human (Homo sap 99.04
d1w0ta_52 DNA-binding domain of human telomeric protein, hTR 99.01
d2ckxa183 Telomere binding protein TBP1 {Tobacco (Nicotiana 99.0
d2cjja163 Radialis {Garden snapdragon (Antirrhinum majus) [T 98.96
d2cqra160 DnaJ homolog subfamily C member 1 {Human (Homo sap 98.95
d2cu7a165 MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 960 98.87
d2iw5b165 REST corepressor 1, CoREST {Human (Homo sapiens) [ 98.86
d2cjja163 Radialis {Garden snapdragon (Antirrhinum majus) [T 98.84
d1xc5a168 Nuclear receptor corepressor 2 {Human (Homo sapien 98.77
d1ug2a_95 2610100b20rik gene product {Mouse (Mus musculus) [ 98.71
d2iw5b165 REST corepressor 1, CoREST {Human (Homo sapiens) [ 98.54
d1xc5a168 Nuclear receptor corepressor 2 {Human (Homo sapien 98.44
d1ug2a_95 2610100b20rik gene product {Mouse (Mus musculus) [ 98.3
d2cqqa159 DnaJ homolog subfamily C member 1 {Human (Homo sap 97.83
d2crga157 Metastasis associated protein MTA3 {Mouse (Mus mus 97.65
d2cqqa159 DnaJ homolog subfamily C member 1 {Human (Homo sap 97.53
d2crga157 Metastasis associated protein MTA3 {Mouse (Mus mus 96.87
d1irza_64 Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId 95.93
d1fexa_59 Rap1 {Human (Homo sapiens) [TaxId: 9606]} 95.85
d1x58a149 Hypothetical protein 4930532d21rik {Mouse (Mus mus 95.62
d1fexa_59 Rap1 {Human (Homo sapiens) [TaxId: 9606]} 95.4
d1wgxa_73 Hypothetical protein C14orf106 (KIAA1903) {Human ( 94.73
d1wgxa_73 Hypothetical protein C14orf106 (KIAA1903) {Human ( 92.61
d1irza_64 Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId 86.1
>d1igna1 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: DNA-binding domain of rap1
domain: DNA-binding domain of rap1
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

Probab=99.53  E-value=2.5e-16  Score=132.29  Aligned_cols=67  Identities=10%  Similarity=0.035  Sum_probs=62.3

Q ss_pred             CCCCCHHHHHHHHHHHHHhCCh------hHHHHhhh-CCChhhHHHHHHHhhcccCCCCCCCHHHHHHHHHHHH
Q 035712          446 NRKWTPEELELVRKFHEKHGSN------WKMLANAL-GKHRFHVKDAWRRVRLPNQKKGQWSQEEYQKLFDLVN  512 (563)
Q Consensus       446 KGkWT~EEDekLielV~kyGn~------W~~IAk~L-GRT~~QCRdRWr~iL~p~ikkG~WTqEED~kLielV~  512 (563)
                      +++||+|||++|+++|.+||+.      |..||..| |||+.||++||+++|.|.++++.||.+||..|+++..
T Consensus         1 k~~WT~eED~~L~~~v~~~g~~~~~~~~W~~IA~~lpgRt~~qcr~Rw~~~L~p~l~~~~~t~~ed~ll~d~~~   74 (86)
T d1igna1           1 KASFTDEEDEFILDVVRKNPTRRTTHTLYDEISHYVPNHTGNSIRHRFRVYLSKRLEYVYEVDKFGKLVRDDDG   74 (86)
T ss_dssp             CCCCCHHHHHHHHHHHHTSGGGTTCSHHHHHHTTTSTTSCHHHHHHHHHHTTGGGCCCEECBCTTSCBCBCTTS
T ss_pred             CCCCCHHHHHHHHHHHHHhCcCcCCccCHHHHHHHcCCCCHHHHHHHHHHHcCccccCCCCCCchhHHHHHHhh
Confidence            5899999999999999999974      99999999 9999999999999999999999999999988766543
>d1gvda_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1guua_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gv2a2 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gvda_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1igna1 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1guua_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1w0ua_ a.4.1.4 (A:) Telomeric repeat binding factor 2, TRF2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w0ta_ a.4.1.4 (A:) DNA-binding domain of human telomeric protein, hTRF1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cu7a1 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ckxa1 a.4.1.3 (A:578-660) Telomere binding protein TBP1 {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1gv2a2 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x41a1 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, TADA2L, isoform b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x41a1 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, TADA2L, isoform b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w0ua_ a.4.1.4 (A:) Telomeric repeat binding factor 2, TRF2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqra1 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w0ta_ a.4.1.4 (A:) DNA-binding domain of human telomeric protein, hTRF1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ckxa1 a.4.1.3 (A:578-660) Telomere binding protein TBP1 {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d2cjja1 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Antirrhinum majus) [TaxId: 4151]} Back     information, alignment and structure
>d2cqra1 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cu7a1 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2iw5b1 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cjja1 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Antirrhinum majus) [TaxId: 4151]} Back     information, alignment and structure
>d1xc5a1 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ug2a_ a.4.1.3 (A:) 2610100b20rik gene product {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2iw5b1 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xc5a1 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ug2a_ a.4.1.3 (A:) 2610100b20rik gene product {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqqa1 a.4.1.3 (A:8-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2crga1 a.4.1.3 (A:8-64) Metastasis associated protein MTA3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqqa1 a.4.1.3 (A:8-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2crga1 a.4.1.3 (A:8-64) Metastasis associated protein MTA3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1irza_ a.4.1.11 (A:) Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1fexa_ a.4.1.3 (A:) Rap1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x58a1 a.4.1.1 (A:8-56) Hypothetical protein 4930532d21rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fexa_ a.4.1.3 (A:) Rap1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wgxa_ a.4.1.3 (A:) Hypothetical protein C14orf106 (KIAA1903) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wgxa_ a.4.1.3 (A:) Hypothetical protein C14orf106 (KIAA1903) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1irza_ a.4.1.11 (A:) Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure