Citrus Sinensis ID: 035721


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------31
MPIHPVAEANEQSLFGSLTPDEFYARHSVSHSSEYITNSRGLRLFTQWWTPLPPAKTLGVLCVVHGFTGESSWIVQLTAVLFAKSGFATCAIDHQGHGFSDGLVAHIPDLNPVVEDAISFFDSFRARHAPDLPAFLYSESLGGAIALYITLRQKGAWDGLILNGAMCGISQKFKPPWPLEHLLFTVAWLVPTWRVVPTRGSLPMVSFKEEWKRKLALSSPRRPVARPRAATALELLRVSRDLQGRFEEVEVPMLICHGGDDVVCDPACVEELYKRAASKDKTLSIYPGMWHQLIGEPEENVELVFGEM
ccccccccccccccccccccHHHHHcccccEEEEEEEcccccEEEEEEEEcccccccEEEEEEEcccccHHHHHHHHHHHHHHHcccEEEEccccccccccccccccccHHHHHHHHHHHHHHHHHHccccccEEEEEEcHHHHHHHHHHHHccccccEEEEEcccccccccccccHHHHHHHHHHHHHccccccccccccccccccccHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHcccccccEEEEEEcccccccHHHHHHHHHHccccccEEEEcccccccccccccccHHHHHccc
cccccccccccccccccccHHHHcccccccEEccEEEcccccEEEEEEEccccccccEEEEEEEccccccccHHHHHHHHHHHHcccEEEEEEccccccccccEEEcccHHHHHHHHHHHHHHHHHcccccccEEEEcccHHHHHHHHHHHcccccccEEEEEcccccccccccccHHHHHHHHHHHHHccccEEEccccccccHHcccHHHHHHHHccccEccccccHHHHHHHHHHHHHHHHHccccccEEEEEEccccccccHHHHHHHHHHHcccccEEEEccccHHHHccccHHHHHHHHHcc
mpihpvaeaneqslfgsltpdefyarhsvshsseyitnsrglrlftqwwtplppaktlGVLCVVhgftgessWIVQLTAVLFAKSgfatcaidhqghgfsdglvahipdlnpvvEDAISFFDSfrarhapdlpaflysESLGGAIALYITLRQKgawdglilngamcgisqkfkppwplehLLFTVAWLVptwrvvptrgslpmvsfKEEWKRKLalssprrpvarpRAATALELLRVSRDLQgrfeevevpmlichggddvvcdpaCVEELYKRAaskdktlsiypgmwhqligepeenvelvfgem
MPIHPVAEANEQSLFGSLTPDEFYARHSVSHSSEYITNSRGLRLFTQWWTPLPPAKTLGVLCVVHGFTGESSWIVQLTAVLFAKSGFATCAIDHQGHGFSDGLVAHIPDLNPVVEDAISFFDSFRARHAPDLPAFLYSESLGGAIALYITLRQKGAWDGLILNGAMCGISQKFKPPWPLEHLLFTVAWLVPTWRVVPTrgslpmvsfkeewkrklalssprrpvarprAATALELLRVSRDLQGRFEEVEVPMLICHGGDDVVCDPACVEELYKRaaskdktlsiYPGMWHQLIGEPEENVELVFGEM
MPIHPVAEANEQSLFGSLTPDEFYARHSVSHSSEYITNSRGLRLFTQWWTPLPPAKTLGVLCVVHGFTGESSWIVQLTAVLFAKSGFATCAIDHQGHGFSDGLVAHIPDLNPVVEDAISFFDSFRARHAPDLPAFLYSESLGGAIALYITLRQKGAWDGLILNGAMCGISQKFKPPWPLEHLLFTVAWLVPTWRVVPTRGSLPMVSFKEEWKRKLALSSprrpvarpraataLELLRVSRDLQGRFEEVEVPMLICHGGDDVVCDPACVEELYKRAASKDKTLSIYPGMWHQLIGEPEENVELVFGEM
**********************FYARHSVSHSSEYITNSRGLRLFTQWWTPLPPAKTLGVLCVVHGFTGESSWIVQLTAVLFAKSGFATCAIDHQGHGFSDGLVAHIPDLNPVVEDAISFFDSFRARHAPDLPAFLYSESLGGAIALYITLRQKGAWDGLILNGAMCGISQKFKPPWPLEHLLFTVAWLVPTWRVVPTRGSLPMVSFKEEWKRKL**************ATALELLRVSRDLQGRFEEVEVPMLICHGGDDVVCDPACVEELYKRAASKDKTLSIYPGMWHQLIGEP***********
**********EQSLFGSLTPDEFYARHSVSHSSEYITNSRGLRLFTQWWTPLPPAKTLGVLCVVHGFTGESSWIVQLTAVLFAKSGFATCAIDHQGHGFSDGLVAHIPDLNPVVEDAISFFDSFRARHAPDLPAFLYSESLGGAIALYITLRQKGAWDGLILNGAMCGISQKFKPPWPLEHLLFTVAWLVPTWRVVPTRGSLPMVSFKEEWKRKLALSSPRRPVARPRAATALELLRVSRDLQGRFEEVEVPMLICHGGDDVVCDPACVEELYKRAASKDKTLSIYPGMWHQLIGEPEENVELVFGEM
********ANEQSLFGSLTPDEFYARHSVSHSSEYITNSRGLRLFTQWWTPLPPAKTLGVLCVVHGFTGESSWIVQLTAVLFAKSGFATCAIDHQGHGFSDGLVAHIPDLNPVVEDAISFFDSFRARHAPDLPAFLYSESLGGAIALYITLRQKGAWDGLILNGAMCGISQKFKPPWPLEHLLFTVAWLVPTWRVVPTRGSLPMVSFKEEWKR************RPRAATALELLRVSRDLQGRFEEVEVPMLICHGGDDVVCDPACVEELYKRAASKDKTLSIYPGMWHQLIGEPEENVELVFGEM
*************LFGSLTPDEFYARHSVSHSSEYITNSRGLRLFTQWWTPLPPAKTLGVLCVVHGFTGESSWIVQLTAVLFAKSGFATCAIDHQGHGFSDGLVAHIPDLNPVVEDAISFFDSFRARHAPDLPAFLYSESLGGAIALYITLRQKGAWDGLILNGAMCGISQKFKPPWPLEHLLFTVAWLVPTWRVVPTRGSLPMVSFKEEWKRKLALSSPRRPVARPRAATALELLRVSRDLQGRFEEVEVPMLICHGGDDVVCDPACVEELYKRAASKDKTLSIYPGMWHQLIGEPEENVELVFGEM
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPIHPVAEANEQSLFGSLTPDEFYARHSVSHSSEYITNSRGLRLFTQWWTPLPPAKTLGVLCVVHGFTGESSWIVQLTAVLFAKSGFATCAIDHQGHGFSDGLVAHIPDLNPVVEDAISFFDSFRARHAPDLPAFLYSESLGGAIALYITLRQKGAWDGLILNGAMCGISQKFKPPWPLEHLLFTVAWLVPTWRVVPTRGSLPMVSFKEEWKRKLALSSPRRPVARPRAATALELLRVSRDLQGRFEEVEVPMLICHGGDDVVCDPACVEELYKRAASKDKTLSIYPGMWHQLIGEPEENVELVFGEM
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query308 2.2.26 [Sep-21-2011]
Q99685303 Monoglyceride lipase OS=H yes no 0.860 0.874 0.287 4e-18
O35678303 Monoglyceride lipase OS=M yes no 0.860 0.874 0.258 5e-14
Q55EQ3 937 Uncharacterized abhydrola no no 0.740 0.243 0.263 3e-13
Q8R431303 Monoglyceride lipase OS=R yes no 0.860 0.874 0.250 8e-13
O34705259 Phospholipase YtpA OS=Bac yes no 0.720 0.857 0.225 1e-09
P28321313 Monoglyceride lipase OS=S yes no 0.801 0.789 0.236 1e-07
O94305 378 Putative monoglyceride li yes no 0.743 0.605 0.245 3e-06
P07000340 Lysophospholipase L2 OS=E N/A no 0.415 0.376 0.256 0.0005
P59588340 Lysophospholipase L2 OS=E yes no 0.415 0.376 0.256 0.0005
>sp|Q99685|MGLL_HUMAN Monoglyceride lipase OS=Homo sapiens GN=MGLL PE=1 SV=2 Back     alignment and function desciption
 Score = 92.4 bits (228), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 79/275 (28%), Positives = 122/275 (44%), Gaps = 10/275 (3%)

Query: 35  YITNSRGLRLFTQWWTPLPPAKTLGVLCVVHGFTGESSWIVQLTAVLFAKSGFATCAIDH 94
           ++ N+ G  LF ++W P    K L  + V HG  GE S   +  A +         A DH
Sbjct: 21  HLVNADGQYLFCRYWKPTGTPKAL--IFVSHG-AGEHSGRYEELARMLMGLDLLVFAHDH 77

Query: 95  QGHGFSDGLVAHIPDLNPVVEDAISFFDSFRARHAPDLPAFLYSESLGGAIALYITLRQK 154
            GHG S+G    + D +  V D +   DS +  + P LP FL   S+GGAIA+     + 
Sbjct: 78  VGHGQSEGERMVVSDFHVFVRDVLQHVDSMQKDY-PGLPVFLLGHSMGGAIAILTAAERP 136

Query: 155 GAWDGLILNGAMCGISQKFKPPWPLEHLLFTVAWLV-PTWRVVPTRGSLPMVSFKEEWKR 213
           G + G++L   +   + +    + +  L   V  LV P   + P   S   V  + + + 
Sbjct: 137 GHFAGMVLISPLVLANPESATTFKV--LAAKVLNLVLPNLSLGPIDSS---VLSRNKTEV 191

Query: 214 KLALSSPRRPVARPRAATALELLRVSRDLQGRFEEVEVPMLICHGGDDVVCDPACVEELY 273
            +  S P    A  +    ++LL     ++    ++ VP L+  G  D +CD      L 
Sbjct: 192 DIYNSDPLICRAGLKVCFGIQLLNAVSRVERALPKLTVPFLLLQGSADRLCDSKGAYLLM 251

Query: 274 KRAASKDKTLSIYPGMWHQLIGEPEENVELVFGEM 308
           + A S+DKTL IY G +H L  E  E    VF E+
Sbjct: 252 ELAKSQDKTLKIYEGAYHVLHKELPEVTNSVFHEI 286




Converts monoacylglycerides to free fatty acids and glycerol. Hydrolyzes the endocannabinoid 2-arachidonoylglycerol, and thereby contributes to the regulation of endocannabinoid signaling, nociperception and perception of pain (By similarity). Regulates the levels of fatty acids that serve as signaling molecules and promote cancer cell migration, invasion and tumor growth.
Homo sapiens (taxid: 9606)
EC: 3EC: .EC: 1EC: .EC: 1EC: .EC: 2EC: 3
>sp|O35678|MGLL_MOUSE Monoglyceride lipase OS=Mus musculus GN=Mgll PE=1 SV=1 Back     alignment and function description
>sp|Q55EQ3|Y9086_DICDI Uncharacterized abhydrolase domain-containing protein DDB_G0269086 OS=Dictyostelium discoideum GN=DDB_G0269086 PE=1 SV=2 Back     alignment and function description
>sp|Q8R431|MGLL_RAT Monoglyceride lipase OS=Rattus norvegicus GN=Mgll PE=1 SV=1 Back     alignment and function description
>sp|O34705|PLBAC_BACSU Phospholipase YtpA OS=Bacillus subtilis (strain 168) GN=ytpA PE=1 SV=1 Back     alignment and function description
>sp|P28321|MGLL_YEAST Monoglyceride lipase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YJU3 PE=1 SV=2 Back     alignment and function description
>sp|O94305|MGLL_SCHPO Putative monoglyceride lipase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC5E4.05c PE=1 SV=1 Back     alignment and function description
>sp|P07000|PLDB_ECOLI Lysophospholipase L2 OS=Escherichia coli (strain K12) GN=pldB PE=4 SV=4 Back     alignment and function description
>sp|P59588|PLDB_ECOL6 Lysophospholipase L2 OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=pldB PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query308
147855038 1395 hypothetical protein VITISV_036229 [Viti 0.993 0.219 0.788 1e-145
224113027331 predicted protein [Populus trichocarpa] 0.990 0.921 0.769 1e-143
225449056329 PREDICTED: monoglyceride lipase [Vitis v 0.993 0.930 0.788 1e-142
15239709330 esterase/lipase/thioesterase family prot 1.0 0.933 0.763 1e-142
356535645325 PREDICTED: uncharacterized abhydrolase d 0.993 0.941 0.768 1e-141
224097929338 mtn21-like protein [Populus trichocarpa] 1.0 0.911 0.758 1e-141
357443267325 Monoglyceride lipase [Medicago truncatul 0.993 0.941 0.768 1e-140
297807987326 esterase/lipase/thioesterase family prot 1.0 0.944 0.750 1e-140
449449352333 PREDICTED: monoglyceride lipase-like [Cu 0.993 0.918 0.759 1e-139
449487195333 PREDICTED: monoglyceride lipase-like [Cu 0.993 0.918 0.753 1e-138
>gi|147855038|emb|CAN82378.1| hypothetical protein VITISV_036229 [Vitis vinifera] Back     alignment and taxonomy information
 Score =  521 bits (1342), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 243/308 (78%), Positives = 272/308 (88%), Gaps = 2/308 (0%)

Query: 3   IHPVAEANEQSLFGSLTPDEFYARHSVSHSSEYITNSRGLRLFTQWWTPLPPAKTLGVLC 62
           +HPVAEANEQS FGSL+P EFYARHSV+HSSEYITNSRG++LFTQ WTPLPP K +G L 
Sbjct: 2   VHPVAEANEQSPFGSLSPSEFYARHSVTHSSEYITNSRGMKLFTQSWTPLPPTKIIGTLA 61

Query: 63  VVHGFTGESSWIVQLTAVLFAKSGFATCAIDHQGHGFSDGLVAHIPDLNPVVEDAISFFD 122
           VVHGFTGESSW +QLTAV F K+GFATCAIDHQGHGFSDGLVAHIPD+NPVV+D I+FFD
Sbjct: 62  VVHGFTGESSWFLQLTAVHFTKAGFATCAIDHQGHGFSDGLVAHIPDINPVVDDCIAFFD 121

Query: 123 SFRARHAPDLPAFLYSESLGGAIALYITLRQKGA--WDGLILNGAMCGISQKFKPPWPLE 180
           SFRARHA  LP+FLYSESLGGAIAL ITLR+  +  WDGL+LNGAMCGIS KFKPPWPLE
Sbjct: 122 SFRARHAXSLPSFLYSESLGGAIALLITLRRGPSRPWDGLVLNGAMCGISPKFKPPWPLE 181

Query: 181 HLLFTVAWLVPTWRVVPTRGSLPMVSFKEEWKRKLALSSPRRPVARPRAATALELLRVSR 240
           H LF +A +VPTWRVVPTRG+LP +SFK EWKR LAL+SPRRPVARPRAATA ELLRV R
Sbjct: 182 HFLFLLAAVVPTWRVVPTRGALPQLSFKVEWKRNLALASPRRPVARPRAATAQELLRVCR 241

Query: 241 DLQGRFEEVEVPMLICHGGDDVVCDPACVEELYKRAASKDKTLSIYPGMWHQLIGEPEEN 300
           ++Q R+ EVEVP L+ HG DDVVCDPACVEELY+RA SKDKTL IYP M HQL+GEP+EN
Sbjct: 242 EIQNRYGEVEVPFLVVHGADDVVCDPACVEELYRRAPSKDKTLKIYPDMIHQLVGEPDEN 301

Query: 301 VELVFGEM 308
           VELVFG++
Sbjct: 302 VELVFGDI 309




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|224113027|ref|XP_002316366.1| predicted protein [Populus trichocarpa] gi|222865406|gb|EEF02537.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|225449056|ref|XP_002274887.1| PREDICTED: monoglyceride lipase [Vitis vinifera] Back     alignment and taxonomy information
>gi|15239709|ref|NP_197430.1| esterase/lipase/thioesterase family protein [Arabidopsis thaliana] gi|17380668|gb|AAL36164.1| putative phospholipase [Arabidopsis thaliana] gi|21554372|gb|AAM63479.1| phospholipase-like protein [Arabidopsis thaliana] gi|23397199|gb|AAN31882.1| putative phospholipase [Arabidopsis thaliana] gi|26983896|gb|AAN86200.1| putative phospholipase [Arabidopsis thaliana] gi|332005298|gb|AED92681.1| esterase/lipase/thioesterase family protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|356535645|ref|XP_003536355.1| PREDICTED: uncharacterized abhydrolase domain-containing protein DDB_G0269086-like [Glycine max] Back     alignment and taxonomy information
>gi|224097929|ref|XP_002311094.1| mtn21-like protein [Populus trichocarpa] gi|222850914|gb|EEE88461.1| mtn21-like protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|357443267|ref|XP_003591911.1| Monoglyceride lipase [Medicago truncatula] gi|355480959|gb|AES62162.1| Monoglyceride lipase [Medicago truncatula] Back     alignment and taxonomy information
>gi|297807987|ref|XP_002871877.1| esterase/lipase/thioesterase family protein [Arabidopsis lyrata subsp. lyrata] gi|297317714|gb|EFH48136.1| esterase/lipase/thioesterase family protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|449449352|ref|XP_004142429.1| PREDICTED: monoglyceride lipase-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449487195|ref|XP_004157524.1| PREDICTED: monoglyceride lipase-like [Cucumis sativus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query308
TAIR|locus:2150245330 AT5G19290 "AT5G19290" [Arabido 1.0 0.933 0.728 2.2e-128
TAIR|locus:2147790327 AT5G14980 "AT5G14980" [Arabido 0.990 0.932 0.700 6.9e-118
TAIR|locus:2197369324 AT1G11090 [Arabidopsis thalian 0.951 0.904 0.385 9.9e-55
TAIR|locus:2039822317 AT2G39410 [Arabidopsis thalian 0.896 0.870 0.369 3.8e-46
TAIR|locus:2039677317 AT2G39420 "AT2G39420" [Arabido 0.902 0.876 0.355 2.1e-45
TAIR|locus:2081710348 AT3G62860 "AT3G62860" [Arabido 0.892 0.790 0.35 2.1e-45
TAIR|locus:2043278351 AT2G47630 "AT2G47630" [Arabido 0.899 0.789 0.35 2.2e-43
TAIR|locus:2039812311 AT2G39400 [Arabidopsis thalian 0.899 0.890 0.339 4e-42
TAIR|locus:2100701312 AT3G55180 "AT3G55180" [Arabido 0.905 0.894 0.333 8.4e-42
TAIR|locus:2031427382 AT1G77420 "AT1G77420" [Arabido 0.886 0.714 0.355 5.9e-41
TAIR|locus:2150245 AT5G19290 "AT5G19290" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1260 (448.6 bits), Expect = 2.2e-128, P = 2.2e-128
 Identities = 225/309 (72%), Positives = 263/309 (85%)

Query:     1 MPIHPVAEANEQSLFGSLTPDEFYARHSVSHSSEYITNSRGLRLFTQWWTPLPPAKTLGV 60
             M +HP+++ANE + FGSLT DEFYA+HSVSHSS +ITN RGL+LFTQWW+PLPP K +G+
Sbjct:     1 MGLHPISDANEHNPFGSLTADEFYAKHSVSHSSAFITNPRGLKLFTQWWSPLPPTKPIGI 60

Query:    61 LCVVHGFTGESSWIVQLTAVLFAKSGFATCAIDHQGHGFSDGLVAHIPDLNPVVEDAISF 120
             + VVHGFTGESSW +QLT++LFAKSGF TCAIDHQGHGFSDGL+AHIPD+NPVV+D ISF
Sbjct:    61 IAVVHGFTGESSWFLQLTSILFAKSGFITCAIDHQGHGFSDGLIAHIPDINPVVDDCISF 120

Query:   121 FDSFRARHAP-DLPAFLYSESLGGAIALYITLRQKGAWDGLILNGAMCGISQKFKPPWPL 179
             FD FR+R  P DLP FLYSESLGGAIALYI+LRQ+G WDGLILNGAMCGIS KFKPPWPL
Sbjct:   121 FDDFRSRQTPSDLPCFLYSESLGGAIALYISLRQRGVWDGLILNGAMCGISDKFKPPWPL 180

Query:   180 EHLLFTVAWLVPTWRVVPTRGSLPMVSFKEEWKRKLALSSXXXXXXXXXXXXXLELLRVS 239
             EHLLF VA L+PTWRV+PTRGS+P VSFKE WKRKLA++S              EL+RV 
Sbjct:   181 EHLLFVVANLIPTWRVIPTRGSIPDVSFKEPWKRKLAMASPRRTVAKPRAATAYELIRVC 240

Query:   240 RDLQGRFEEVEVPMLICHGGDDVVCDPACVEELYKRAASKDKTLSIYPGMWHQLIGEPEE 299
             +DLQGRFEEVEVP+LI HGG DVVCD ACVEEL++RA S+DKT+ IYP +WHQ+IGE EE
Sbjct:   241 KDLQGRFEEVEVPLLIVHGGGDVVCDVACVEELHRRAISEDKTIKIYPELWHQMIGESEE 300

Query:   300 NVELVFGEM 308
              V+LV+G+M
Sbjct:   301 KVDLVYGDM 309




GO:0003824 "catalytic activity" evidence=ISS
GO:0005737 "cytoplasm" evidence=ISM
GO:0006342 "chromatin silencing" evidence=RCA
GO:0051567 "histone H3-K9 methylation" evidence=RCA
GO:0005886 "plasma membrane" evidence=IDA
TAIR|locus:2147790 AT5G14980 "AT5G14980" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2197369 AT1G11090 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2039822 AT2G39410 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2039677 AT2G39420 "AT2G39420" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2081710 AT3G62860 "AT3G62860" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2043278 AT2G47630 "AT2G47630" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2039812 AT2G39400 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2100701 AT3G55180 "AT3G55180" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2031427 AT1G77420 "AT1G77420" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
fgenesh4_pg.C_LG_X002025
hypothetical protein (331 aa)
(Populus trichocarpa)
Predicted Functional Partners:
eugene3.31260002
Predicted protein (138 aa)
       0.451

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query308
PLN02298330 PLN02298, PLN02298, hydrolase, alpha/beta fold fam 1e-100
PLN02385349 PLN02385, PLN02385, hydrolase; alpha/beta fold fam 2e-70
COG2267298 COG2267, PldB, Lysophospholipase [Lipid metabolism 7e-32
PLN02652395 PLN02652, PLN02652, hydrolase; alpha/beta fold fam 3e-30
PHA02857276 PHA02857, PHA02857, monoglyceride lipase; Provisio 4e-19
pfam1214680 pfam12146, Hydrolase_4, Putative lysophospholipase 4e-19
pfam12697187 pfam12697, Abhydrolase_6, Alpha/beta hydrolase fam 3e-12
TIGR01607332 TIGR01607, PST-A, Plasmodium subtelomeric family ( 4e-10
COG0596282 COG0596, MhpC, Predicted hydrolases or acyltransfe 1e-09
pfam12695145 pfam12695, Abhydrolase_5, Alpha/beta hydrolase fam 2e-04
PRK10749330 PRK10749, PRK10749, lysophospholipase L2; Provisio 6e-04
pfam00561226 pfam00561, Abhydrolase_1, alpha/beta hydrolase fol 8e-04
pfam12695145 pfam12695, Abhydrolase_5, Alpha/beta hydrolase fam 0.003
>gnl|CDD|165939 PLN02298, PLN02298, hydrolase, alpha/beta fold family protein Back     alignment and domain information
 Score =  296 bits (760), Expect = e-100
 Identities = 126/304 (41%), Positives = 181/304 (59%), Gaps = 3/304 (0%)

Query: 7   AEANEQSLFGSLTPDEFYARHSVSHSSEYITNSRGLRLFTQWWTPLPPAKTLGVLCVVHG 66
           A   E   +G    +E+YA   +  S  + T+ RGL LFT+ W P   +    ++ +VHG
Sbjct: 8   ATETEVHFWGETPEEEYYALKGIKGSKSFFTSPRGLSLFTRSWLPSSSSPPRALIFMVHG 67

Query: 67  FTGESSWIVQLTAVLFAKSGFATCAIDHQGHGFSDGLVAHIPDLNPVVEDAISFFDSFRA 126
           +  + SW  Q TA+  A+ GFA  A+D +GHG S+GL A++P+++ VVED +SFF+S + 
Sbjct: 68  YGNDISWTFQSTAIFLAQMGFACFALDLEGHGRSEGLRAYVPNVDLVVEDCLSFFNSVKQ 127

Query: 127 RHA-PDLPAFLYSESLGGAIALYITLRQKGAWDGLILNGAMCGISQKFKPPWPLEHLLFT 185
           R     LP FLY ES+GGAI L I L     +DG +L   MC IS K +PPWP+  +L  
Sbjct: 128 REEFQGLPRFLYGESMGGAICLLIHLANPEGFDGAVLVAPMCKISDKIRPPWPIPQILTF 187

Query: 186 VAWLVPTWRVVPTRGSLPMVSFKEEWKRKLALSSPRRPVARPRAATALELLRVSRDLQGR 245
           VA  +PT  +VPT   L   S K   K+ +A  +P R   +PR  T +ELLRV+  L  +
Sbjct: 188 VARFLPTLAIVPT-ADLLEKSVKVPAKKIIAKRNPMRYNGKPRLGTVVELLRVTDYLGKK 246

Query: 246 FEEVEVPMLICHGGDDVVCDPACVEELYKRAASKDKTLSIYPGMWHQLI-GEPEENVELV 304
            ++V +P ++ HG  DVV DP     LY+ A S+DKT+ IY GM H L+ GEP+EN+E+V
Sbjct: 247 LKDVSIPFIVLHGSADVVTDPDVSRALYEEAKSEDKTIKIYDGMMHSLLFGEPDENIEIV 306

Query: 305 FGEM 308
             ++
Sbjct: 307 RRDI 310


Length = 330

>gnl|CDD|215216 PLN02385, PLN02385, hydrolase; alpha/beta fold family protein Back     alignment and domain information
>gnl|CDD|225176 COG2267, PldB, Lysophospholipase [Lipid metabolism] Back     alignment and domain information
>gnl|CDD|215352 PLN02652, PLN02652, hydrolase; alpha/beta fold family protein Back     alignment and domain information
>gnl|CDD|165193 PHA02857, PHA02857, monoglyceride lipase; Provisional Back     alignment and domain information
>gnl|CDD|221442 pfam12146, Hydrolase_4, Putative lysophospholipase Back     alignment and domain information
>gnl|CDD|221720 pfam12697, Abhydrolase_6, Alpha/beta hydrolase family Back     alignment and domain information
>gnl|CDD|162444 TIGR01607, PST-A, Plasmodium subtelomeric family (PST-A) Back     alignment and domain information
>gnl|CDD|223669 COG0596, MhpC, Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) [General function prediction only] Back     alignment and domain information
>gnl|CDD|221718 pfam12695, Abhydrolase_5, Alpha/beta hydrolase family Back     alignment and domain information
>gnl|CDD|182697 PRK10749, PRK10749, lysophospholipase L2; Provisional Back     alignment and domain information
>gnl|CDD|201306 pfam00561, Abhydrolase_1, alpha/beta hydrolase fold Back     alignment and domain information
>gnl|CDD|221718 pfam12695, Abhydrolase_5, Alpha/beta hydrolase family Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 308
KOG1455313 consensus Lysophospholipase [Lipid transport and m 100.0
PLN02298330 hydrolase, alpha/beta fold family protein 100.0
PLN02385349 hydrolase; alpha/beta fold family protein 100.0
PHA02857276 monoglyceride lipase; Provisional 100.0
PLN02652395 hydrolase; alpha/beta fold family protein 100.0
PRK10749330 lysophospholipase L2; Provisional 100.0
COG2267298 PldB Lysophospholipase [Lipid metabolism] 100.0
TIGR02240276 PHA_depoly_arom poly(3-hydroxyalkanoate) depolymer 100.0
PLN02824294 hydrolase, alpha/beta fold family protein 100.0
PRK00870302 haloalkane dehalogenase; Provisional 100.0
PRK03592295 haloalkane dehalogenase; Provisional 100.0
KOG4178322 consensus Soluble epoxide hydrolase [Lipid transpo 100.0
TIGR01607332 PST-A Plasmodium subtelomeric family (PST-A). Thes 100.0
PLN03087481 BODYGUARD 1 domain containing hydrolase; Provision 100.0
PLN02679360 hydrolase, alpha/beta fold family protein 100.0
PLN02965255 Probable pheophorbidase 100.0
PRK10673255 acyl-CoA esterase; Provisional 100.0
TIGR03056278 bchO_mg_che_rel putative magnesium chelatase acces 100.0
PRK10349256 carboxylesterase BioH; Provisional 100.0
PRK03204286 haloalkane dehalogenase; Provisional 100.0
TIGR03611257 RutD pyrimidine utilization protein D. This protei 100.0
PLN03084383 alpha/beta hydrolase fold protein; Provisional 100.0
PLN02578354 hydrolase 100.0
TIGR03343282 biphenyl_bphD 2-hydroxy-6-oxo-6-phenylhexa-2,4-die 100.0
PRK06489360 hypothetical protein; Provisional 100.0
TIGR01250288 pro_imino_pep_2 proline-specific peptidases, Bacil 99.98
COG1647243 Esterase/lipase [General function prediction only] 99.97
KOG4409365 consensus Predicted hydrolase/acyltransferase (alp 99.97
PRK07581339 hypothetical protein; Validated 99.97
TIGR02427251 protocat_pcaD 3-oxoadipate enol-lactonase. Members 99.97
TIGR01392351 homoserO_Ac_trn homoserine O-acetyltransferase. Th 99.97
TIGR01738245 bioH putative pimeloyl-BioC--CoA transferase BioH. 99.97
PRK13604307 luxD acyl transferase; Provisional 99.97
PF12697228 Abhydrolase_6: Alpha/beta hydrolase family; PDB: 3 99.97
PLN02211273 methyl indole-3-acetate methyltransferase 99.97
PRK08775343 homoserine O-acetyltransferase; Provisional 99.97
PRK11126242 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxyl 99.97
PRK00175379 metX homoserine O-acetyltransferase; Provisional 99.97
PLN02511388 hydrolase 99.97
KOG1454326 consensus Predicted hydrolase/acyltransferase (alp 99.97
TIGR03695251 menH_SHCHC 2-succinyl-6-hydroxy-2,4-cyclohexadiene 99.97
PLN02894402 hydrolase, alpha/beta fold family protein 99.96
TIGR01249306 pro_imino_pep_1 proline iminopeptidase, Neisseria- 99.96
PRK05077414 frsA fermentation/respiration switch protein; Revi 99.96
PRK14875371 acetoin dehydrogenase E2 subunit dihydrolipoyllysi 99.96
PRK10985324 putative hydrolase; Provisional 99.96
PLN029801655 2-oxoglutarate decarboxylase/ hydro-lyase/ magnesi 99.95
TIGR03100274 hydr1_PEP hydrolase, ortholog 1, exosortase system 99.94
PRK05855 582 short chain dehydrogenase; Validated 99.94
KOG2382315 consensus Predicted alpha/beta hydrolase [General 99.94
PRK06765389 homoserine O-acetyltransferase; Provisional 99.93
KOG4391300 consensus Predicted alpha/beta hydrolase BEM46 [Ge 99.93
KOG2984277 consensus Predicted hydrolase [General function pr 99.93
PLN02872395 triacylglycerol lipase 99.93
PRK10566249 esterase; Provisional 99.92
TIGR01836350 PHA_synth_III_C poly(R)-hydroxyalkanoic acid synth 99.92
KOG1552258 consensus Predicted alpha/beta hydrolase [General 99.92
PF12695145 Abhydrolase_5: Alpha/beta hydrolase family; PDB: 3 99.91
KOG4667269 consensus Predicted esterase [Lipid transport and 99.91
COG0429345 Predicted hydrolase of the alpha/beta-hydrolase fo 99.9
PF00561230 Abhydrolase_1: alpha/beta hydrolase fold A web pag 99.9
TIGR01838532 PHA_synth_I poly(R)-hydroxyalkanoic acid synthase, 99.9
KOG1838409 consensus Alpha/beta hydrolase [General function p 99.89
PRK11071190 esterase YqiA; Provisional 99.89
COG1506620 DAP2 Dipeptidyl aminopeptidases/acylaminoacyl-pept 99.89
KOG2564343 consensus Predicted acetyltransferases and hydrola 99.89
TIGR03101266 hydr2_PEP hydrolase, ortholog 2, exosortase system 99.89
PRK11460232 putative hydrolase; Provisional 99.87
PF00326213 Peptidase_S9: Prolyl oligopeptidase family This fa 99.85
PRK07868 994 acyl-CoA synthetase; Validated 99.85
PF06342297 DUF1057: Alpha/beta hydrolase of unknown function 99.85
COG0596282 MhpC Predicted hydrolases or acyltransferases (alp 99.84
TIGR01840212 esterase_phb esterase, PHB depolymerase family. Th 99.84
PF01738218 DLH: Dienelactone hydrolase family; InterPro: IPR0 99.84
PLN02442283 S-formylglutathione hydrolase 99.83
COG2945210 Predicted hydrolase of the alpha/beta superfamily 99.83
TIGR02821275 fghA_ester_D S-formylglutathione hydrolase. This m 99.82
PLN00021313 chlorophyllase 99.82
PF05448320 AXE1: Acetyl xylan esterase (AXE1); InterPro: IPR0 99.82
TIGR00976 550 /NonD putative hydrolase, CocE/NonD family. This m 99.82
COG3208244 GrsT Predicted thioesterase involved in non-riboso 99.81
PF06500411 DUF1100: Alpha/beta hydrolase of unknown function 99.8
COG0412236 Dienelactone hydrolase and related enzymes [Second 99.79
PRK10115686 protease 2; Provisional 99.79
PF03096283 Ndr: Ndr family; InterPro: IPR004142 This family c 99.78
TIGR01839560 PHA_synth_II poly(R)-hydroxyalkanoic acid synthase 99.78
PF02230216 Abhydrolase_2: Phospholipase/Carboxylesterase; Int 99.78
KOG2931326 consensus Differentiation-related gene 1 protein ( 99.77
COG4757281 Predicted alpha/beta hydrolase [General function p 99.77
PF02273294 Acyl_transf_2: Acyl transferase; InterPro: IPR0031 99.76
COG3458321 Acetyl esterase (deacetylase) [Secondary metabolit 99.75
COG2021368 MET2 Homoserine acetyltransferase [Amino acid tran 99.74
PF1214679 Hydrolase_4: Putative lysophospholipase; InterPro: 99.74
PF02129272 Peptidase_S15: X-Pro dipeptidyl-peptidase (S15 fam 99.73
TIGR03230 442 lipo_lipase lipoprotein lipase. Members of this pr 99.71
PRK10162318 acetyl esterase; Provisional 99.71
PF06821171 Ser_hydrolase: Serine hydrolase; InterPro: IPR0106 99.7
COG0400207 Predicted esterase [General function prediction on 99.7
cd00707275 Pancreat_lipase_like Pancreatic lipase-like enzyme 99.68
PF08538303 DUF1749: Protein of unknown function (DUF1749); In 99.68
TIGR01849406 PHB_depoly_PhaZ polyhydroxyalkanoate depolymerase, 99.66
PF10230266 DUF2305: Uncharacterised conserved protein (DUF230 99.66
KOG2624403 consensus Triglyceride lipase-cholesterol esterase 99.65
PF09752348 DUF2048: Uncharacterized conserved protein (DUF204 99.64
PF12715390 Abhydrolase_7: Abhydrolase family; PDB: 3NUZ_C 3G8 99.63
COG3571213 Predicted hydrolase of the alpha/beta-hydrolase fo 99.6
KOG3043242 consensus Predicted hydrolase related to dienelact 99.58
PF12740259 Chlorophyllase2: Chlorophyllase enzyme; InterPro: 99.58
PF05728187 UPF0227: Uncharacterised protein family (UPF0227); 99.58
TIGR03502792 lipase_Pla1_cef extracellular lipase, Pla-1/cef fa 99.58
PF07859211 Abhydrolase_3: alpha/beta hydrolase fold A web pag 99.57
PF10503220 Esterase_phd: Esterase PHB depolymerase 99.57
PRK05371 767 x-prolyl-dipeptidyl aminopeptidase; Provisional 99.56
PF00975229 Thioesterase: Thioesterase domain; InterPro: IPR00 99.55
PF06057192 VirJ: Bacterial virulence protein (VirJ); InterPro 99.55
COG0657312 Aes Esterase/lipase [Lipid metabolism] 99.51
KOG2565469 consensus Predicted hydrolases or acyltransferases 99.49
KOG1515336 consensus Arylacetamide deacetylase [Defense mecha 99.49
COG3243445 PhaC Poly(3-hydroxyalkanoate) synthetase [Lipid me 99.46
COG3545181 Predicted esterase of the alpha/beta hydrolase fol 99.44
COG4188365 Predicted dienelactone hydrolase [General function 99.43
KOG2100755 consensus Dipeptidyl aminopeptidase [Posttranslati 99.41
PF03959212 FSH1: Serine hydrolase (FSH1); InterPro: IPR005645 99.4
COG2936 563 Predicted acyl esterases [General function predict 99.4
PTZ00472 462 serine carboxypeptidase (CBP1); Provisional 99.4
COG4099387 Predicted peptidase [General function prediction o 99.39
KOG4627270 consensus Kynurenine formamidase [Amino acid trans 99.39
KOG2281867 consensus Dipeptidyl aminopeptidases/acylaminoacyl 99.39
PF07224307 Chlorophyllase: Chlorophyllase; InterPro: IPR01082 99.36
KOG2551230 consensus Phospholipase/carboxyhydrolase [Amino ac 99.36
KOG3975301 consensus Uncharacterized conserved protein [Funct 99.34
PF03403379 PAF-AH_p_II: Platelet-activating factor acetylhydr 99.33
PF08840213 BAAT_C: BAAT / Acyl-CoA thioester hydrolase C term 99.3
PRK102521296 entF enterobactin synthase subunit F; Provisional 99.3
PF07819225 PGAP1: PGAP1-like protein; InterPro: IPR012908 The 99.26
PF06028255 DUF915: Alpha/beta hydrolase of unknown function ( 99.21
KOG2112206 consensus Lysophospholipase [Lipid transport and m 99.2
PF01674219 Lipase_2: Lipase (class 2); InterPro: IPR002918 Li 99.2
PF00151331 Lipase: Lipase; InterPro: IPR013818 Triglyceride l 99.17
COG3509312 LpqC Poly(3-hydroxybutyrate) depolymerase [Seconda 99.15
PF03583290 LIP: Secretory lipase ; InterPro: IPR005152 This e 99.14
KOG1553517 consensus Predicted alpha/beta hydrolase BAT5 [Gen 99.13
COG1505648 Serine proteases of the peptidase family S9A [Amin 99.13
PLN02733440 phosphatidylcholine-sterol O-acyltransferase 99.11
PRK10439411 enterobactin/ferric enterobactin esterase; Provisi 99.09
PF05990233 DUF900: Alpha/beta hydrolase of unknown function ( 99.06
KOG3101283 consensus Esterase D [General function prediction 99.06
PRK04940180 hypothetical protein; Provisional 99.04
COG3319257 Thioesterase domains of type I polyketide synthase 99.03
PF11339 581 DUF3141: Protein of unknown function (DUF3141); In 99.02
PF05677365 DUF818: Chlamydia CHLPS protein (DUF818); InterPro 99.0
smart00824212 PKS_TE Thioesterase. Peptide synthetases are invol 98.96
PF12048310 DUF3530: Protein of unknown function (DUF3530); In 98.95
KOG3847399 consensus Phospholipase A2 (platelet-activating fa 98.94
PF00756251 Esterase: Putative esterase; InterPro: IPR000801 T 98.91
KOG3253 784 consensus Predicted alpha/beta hydrolase [General 98.88
COG1770682 PtrB Protease II [Amino acid transport and metabol 98.87
KOG4840299 consensus Predicted hydrolases or acyltransferases 98.86
PF05705240 DUF829: Eukaryotic protein of unknown function (DU 98.78
KOG2237712 consensus Predicted serine protease [Posttranslati 98.76
COG4782377 Uncharacterized protein conserved in bacteria [Fun 98.73
cd00312 493 Esterase_lipase Esterases and lipases (includes fu 98.73
PF11144403 DUF2920: Protein of unknown function (DUF2920); In 98.7
KOG1551371 consensus Uncharacterized conserved protein [Funct 98.67
PF05577 434 Peptidase_S28: Serine carboxypeptidase S28; InterP 98.66
PF10340374 DUF2424: Protein of unknown function (DUF2424); In 98.66
COG3150191 Predicted esterase [General function prediction on 98.65
COG3946456 VirJ Type IV secretory pathway, VirJ component [In 98.65
PF02450389 LCAT: Lecithin:cholesterol acyltransferase; InterP 98.64
PF05057217 DUF676: Putative serine esterase (DUF676); InterPr 98.61
PLN02209437 serine carboxypeptidase 98.6
COG1073299 Hydrolases of the alpha/beta superfamily [General 98.49
COG1075336 LipA Predicted acetyltransferases and hydrolases w 98.49
PF00135 535 COesterase: Carboxylesterase family The prints ent 98.44
COG4814288 Uncharacterized protein with an alpha/beta hydrola 98.4
COG2272 491 PnbA Carboxylesterase type B [Lipid metabolism] 98.39
PF02089279 Palm_thioest: Palmitoyl protein thioesterase; Inte 98.39
PLN02633314 palmitoyl protein thioesterase family protein 98.29
PF00450415 Peptidase_S10: Serine carboxypeptidase; InterPro: 98.26
PF04301213 DUF452: Protein of unknown function (DUF452); Inte 98.17
KOG2183 492 consensus Prolylcarboxypeptidase (angiotensinase C 98.16
KOG3967297 consensus Uncharacterized conserved protein [Funct 98.16
PF07082250 DUF1350: Protein of unknown function (DUF1350); In 98.15
PLN02606306 palmitoyl-protein thioesterase 98.12
KOG3724 973 consensus Negative regulator of COPII vesicle form 98.09
KOG2541296 consensus Palmitoyl protein thioesterase [Lipid tr 98.03
COG0627316 Predicted esterase [General function prediction on 98.01
COG2819264 Predicted hydrolase of the alpha/beta superfamily 97.97
PF0408363 Abhydro_lipase: Partial alpha/beta-hydrolase lipas 97.97
PF08386103 Abhydrolase_4: TAP-like protein; InterPro: IPR0135 97.94
KOG2182 514 consensus Hydrolytic enzymes of the alpha/beta hyd 97.87
PF10142367 PhoPQ_related: PhoPQ-activated pathogenicity-relat 97.86
PLN03016433 sinapoylglucose-malate O-sinapoyltransferase 97.81
COG2382299 Fes Enterochelin esterase and related enzymes [Ino 97.81
cd00741153 Lipase Lipase. Lipases are esterases that can hydr 97.76
PF06259177 Abhydrolase_8: Alpha/beta hydrolase; InterPro: IPR 97.67
PLN02517 642 phosphatidylcholine-sterol O-acyltransferase 97.62
COG4553415 DepA Poly-beta-hydroxyalkanoate depolymerase [Lipi 97.54
KOG2369 473 consensus Lecithin:cholesterol acyltransferase (LC 97.5
cd00519229 Lipase_3 Lipase (class 3). Lipases are esterases t 97.44
KOG1282454 consensus Serine carboxypeptidases (lysosomal cath 97.42
PF01083179 Cutinase: Cutinase; InterPro: IPR000675 Aerial pla 97.4
COG2939 498 Carboxypeptidase C (cathepsin A) [Amino acid trans 97.4
PF01764140 Lipase_3: Lipase (class 3); InterPro: IPR002921 Tr 97.32
KOG2521350 consensus Uncharacterized conserved protein [Funct 97.26
PF11187224 DUF2974: Protein of unknown function (DUF2974); In 97.18
KOG1516 545 consensus Carboxylesterase and related proteins [G 97.08
PF11288207 DUF3089: Protein of unknown function (DUF3089); In 96.97
COG4947227 Uncharacterized protein conserved in bacteria [Fun 96.87
PF07519 474 Tannase: Tannase and feruloyl esterase; InterPro: 96.83
COG2830214 Uncharacterized protein conserved in bacteria [Fun 96.82
KOG4388 880 consensus Hormone-sensitive lipase HSL [Lipid tran 96.78
PLN02454414 triacylglycerol lipase 96.69
PF05576 448 Peptidase_S37: PS-10 peptidase S37; InterPro: IPR0 96.55
PLN02162475 triacylglycerol lipase 96.5
PLN00413479 triacylglycerol lipase 96.26
PLN02213319 sinapoylglucose-malate O-sinapoyltransferase/ carb 96.22
PLN02310405 triacylglycerol lipase 96.09
PLN02571413 triacylglycerol lipase 96.0
KOG4372405 consensus Predicted alpha/beta hydrolase [General 95.8
TIGR03712511 acc_sec_asp2 accessory Sec system protein Asp2. Th 95.7
PLN02408365 phospholipase A1 95.66
KOG12022376 consensus Animal-type fatty acid synthase and rela 95.63
PLN02934515 triacylglycerol lipase 95.57
PLN03037525 lipase class 3 family protein; Provisional 95.43
PF06441112 EHN: Epoxide hydrolase N terminus; InterPro: IPR01 95.39
KOG1283 414 consensus Serine carboxypeptidases [Posttranslatio 95.34
PLN02324415 triacylglycerol lipase 95.34
COG4287 507 PqaA PhoPQ-activated pathogenicity-related protein 95.33
PLN02847 633 triacylglycerol lipase 95.23
PF05277345 DUF726: Protein of unknown function (DUF726); Inte 95.23
PLN02753531 triacylglycerol lipase 94.93
PLN02802509 triacylglycerol lipase 94.92
PLN02761527 lipase class 3 family protein 94.74
PF08237225 PE-PPE: PE-PPE domain; InterPro: IPR013228 The hum 94.73
COG5153425 CVT17 Putative lipase essential for disintegration 94.52
KOG4540425 consensus Putative lipase essential for disintegra 94.52
PLN02719518 triacylglycerol lipase 94.45
PLN02213319 sinapoylglucose-malate O-sinapoyltransferase/ carb 93.59
KOG4569336 consensus Predicted lipase [Lipid transport and me 93.37
PF09949100 DUF2183: Uncharacterized conserved protein (DUF218 93.04
KOG2029697 consensus Uncharacterized conserved protein [Funct 92.83
PF06850202 PHB_depo_C: PHB de-polymerase C-terminus; InterPro 92.2
PF09994277 DUF2235: Uncharacterized alpha/beta hydrolase doma 91.98
PF03283361 PAE: Pectinacetylesterase 91.84
PF00450415 Peptidase_S10: Serine carboxypeptidase; InterPro: 91.47
PLN03016433 sinapoylglucose-malate O-sinapoyltransferase 91.06
COG3673 423 Uncharacterized conserved protein [Function unknow 88.94
KOG1282454 consensus Serine carboxypeptidases (lysosomal cath 88.89
) proteins. It has been suggested that torsins play a role in effectively managing protein folding and that possible breakdown in a neuroprotective mechanism that is, in part, mediated by torsins may be responsible for the neuronal dysfunction associated with dystonia [].; GO: 0005524 ATP binding, 0051085 chaperone mediated protein folding requiring cofactor" target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=PF06309">PF06309127 Torsin: Torsin; InterPro: IPR010448 This family co 87.34
COG0529197 CysC Adenylylsulfate kinase and related kinases [I 86.58
KOG2385633 consensus Uncharacterized conserved protein [Funct 86.27
COG3340224 PepE Peptidase E [Amino acid transport and metabol 85.31
>KOG1455 consensus Lysophospholipase [Lipid transport and metabolism] Back     alignment and domain information
Probab=100.00  E-value=4.3e-46  Score=273.59  Aligned_cols=298  Identities=50%  Similarity=0.853  Sum_probs=274.7

Q ss_pred             cccCccCCCCcccccccccccccceeEEcCCCcEEEEEEecCCCCCCCcceEEEEccCCCccchHHHHHHHHHHHcCCeE
Q 035721           10 NEQSLFGSLTPDEFYARHSVSHSSEYITNSRGLRLFTQWWTPLPPAKTLGVLCVVHGFTGESSWIVQLTAVLFAKSGFAT   89 (308)
Q Consensus        10 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~l~~~~~~~~~~~~~~~~vv~~hG~~~~~~~~~~~~~~~l~~~g~~v   89 (308)
                      ...++|..+..++++...++.....++++.+|.++....|.|..+.+++..|+++||++..+.+.++.++..|+..||.|
T Consensus         6 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~n~rG~~lft~~W~p~~~~~pr~lv~~~HG~g~~~s~~~~~~a~~l~~~g~~v   85 (313)
T KOG1455|consen    6 NRRSLAGELSEEEYYGDGGVTYSESFFTNPRGAKLFTQSWLPLSGTEPRGLVFLCHGYGEHSSWRYQSTAKRLAKSGFAV   85 (313)
T ss_pred             cCcccccccchhhhcCCCccceeeeeEEcCCCCEeEEEecccCCCCCCceEEEEEcCCcccchhhHHHHHHHHHhCCCeE
Confidence            34566778888888888888889999999999999999999977657789999999999998777889999999999999


Q ss_pred             EEecCCCCcCCCCccccCCCcchHHHHHHHHHHHHHHhcC-CCCCEEEEEechhhHHHHHHHHhcCCCccEEEEeCCcCC
Q 035721           90 CAIDHQGHGFSDGLVAHIPDLNPVVEDAISFFDSFRARHA-PDLPAFLYSESLGGAIALYITLRQKGAWDGLILNGAMCG  168 (308)
Q Consensus        90 ~~~d~~G~G~s~~~~~~~~~~~~~~~d~~~~l~~~~~~~~-~~~~~~l~G~S~Gg~~a~~~a~~~p~~v~~~vl~~~~~~  168 (308)
                      +++|++|||.|++...+..+++..++|+...++.+..+.. .+.+..++||||||.+++.++.++|+..+|+|+++|.+.
T Consensus        86 ~a~D~~GhG~SdGl~~yi~~~d~~v~D~~~~~~~i~~~~e~~~lp~FL~GeSMGGAV~Ll~~~k~p~~w~G~ilvaPmc~  165 (313)
T KOG1455|consen   86 YAIDYEGHGRSDGLHAYVPSFDLVVDDVISFFDSIKEREENKGLPRFLFGESMGGAVALLIALKDPNFWDGAILVAPMCK  165 (313)
T ss_pred             EEeeccCCCcCCCCcccCCcHHHHHHHHHHHHHHHhhccccCCCCeeeeecCcchHHHHHHHhhCCcccccceeeecccc
Confidence            9999999999999988888999999999999998766544 777999999999999999999999999999999999999


Q ss_pred             CCcCCCCCchhhhhHHHhhhhCCCcccccCCCCCCCcccccHHHHHHHhhCCCCCCCcchHHHHHHHHHHHHHhhhhcCC
Q 035721          169 ISQKFKPPWPLEHLLFTVAWLVPTWRVVPTRGSLPMVSFKEEWKRKLALSSPRRPVARPRAATALELLRVSRDLQGRFEE  248 (308)
Q Consensus       169 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  248 (308)
                      ..+...+.......+..+..++|+|...+.. ......+++++.+.....++..+...+++++..++++...++.+.+.+
T Consensus       166 i~~~~kp~p~v~~~l~~l~~liP~wk~vp~~-d~~~~~~kdp~~r~~~~~npl~y~g~pRl~T~~ElLr~~~~le~~l~~  244 (313)
T KOG1455|consen  166 ISEDTKPHPPVISILTLLSKLIPTWKIVPTK-DIIDVAFKDPEKRKILRSDPLCYTGKPRLKTAYELLRVTADLEKNLNE  244 (313)
T ss_pred             cCCccCCCcHHHHHHHHHHHhCCceeecCCc-cccccccCCHHHHHHhhcCCceecCCccHHHHHHHHHHHHHHHHhccc
Confidence            9999999999999999999999999977777 788999999999999999999999999999999999999999999999


Q ss_pred             CCcceEEEeeCCCcccChHHHHHHHHHhcCCCCcEEEecCCccccc-CCchhhHHHhhhcC
Q 035721          249 VEVPMLICHGGDDVVCDPACVEELYKRAASKDKTLSIYPGMWHQLI-GEPEENVELVFGEM  308 (308)
Q Consensus       249 i~~P~l~i~g~~D~~~~~~~~~~~~~~~~~~~~~~~~~~~~gH~~~-~~~~~~~~~i~~~i  308 (308)
                      +++|.+++||+.|.+++++.++.+++...+.+.++.+|||.-|.++ .++++..+.|+.+|
T Consensus       245 vtvPflilHG~dD~VTDp~~Sk~Lye~A~S~DKTlKlYpGm~H~Ll~gE~~en~e~Vf~DI  305 (313)
T KOG1455|consen  245 VTVPFLILHGTDDKVTDPKVSKELYEKASSSDKTLKLYPGMWHSLLSGEPDENVEIVFGDI  305 (313)
T ss_pred             ccccEEEEecCCCcccCcHHHHHHHHhccCCCCceeccccHHHHhhcCCCchhHHHHHHHH
Confidence            9999999999999999999999999999888999999999999999 68888787777653



>PLN02298 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>PLN02385 hydrolase; alpha/beta fold family protein Back     alignment and domain information
>PHA02857 monoglyceride lipase; Provisional Back     alignment and domain information
>PLN02652 hydrolase; alpha/beta fold family protein Back     alignment and domain information
>PRK10749 lysophospholipase L2; Provisional Back     alignment and domain information
>COG2267 PldB Lysophospholipase [Lipid metabolism] Back     alignment and domain information
>TIGR02240 PHA_depoly_arom poly(3-hydroxyalkanoate) depolymerase Back     alignment and domain information
>PLN02824 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>PRK00870 haloalkane dehalogenase; Provisional Back     alignment and domain information
>PRK03592 haloalkane dehalogenase; Provisional Back     alignment and domain information
>KOG4178 consensus Soluble epoxide hydrolase [Lipid transport and metabolism] Back     alignment and domain information
>TIGR01607 PST-A Plasmodium subtelomeric family (PST-A) Back     alignment and domain information
>PLN03087 BODYGUARD 1 domain containing hydrolase; Provisional Back     alignment and domain information
>PLN02679 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>PLN02965 Probable pheophorbidase Back     alignment and domain information
>PRK10673 acyl-CoA esterase; Provisional Back     alignment and domain information
>TIGR03056 bchO_mg_che_rel putative magnesium chelatase accessory protein Back     alignment and domain information
>PRK10349 carboxylesterase BioH; Provisional Back     alignment and domain information
>PRK03204 haloalkane dehalogenase; Provisional Back     alignment and domain information
>TIGR03611 RutD pyrimidine utilization protein D Back     alignment and domain information
>PLN03084 alpha/beta hydrolase fold protein; Provisional Back     alignment and domain information
>PLN02578 hydrolase Back     alignment and domain information
>TIGR03343 biphenyl_bphD 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase Back     alignment and domain information
>PRK06489 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01250 pro_imino_pep_2 proline-specific peptidases, Bacillus coagulans-type subfamily Back     alignment and domain information
>COG1647 Esterase/lipase [General function prediction only] Back     alignment and domain information
>KOG4409 consensus Predicted hydrolase/acyltransferase (alpha/beta hydrolase superfamily) [General function prediction only] Back     alignment and domain information
>PRK07581 hypothetical protein; Validated Back     alignment and domain information
>TIGR02427 protocat_pcaD 3-oxoadipate enol-lactonase Back     alignment and domain information
>TIGR01392 homoserO_Ac_trn homoserine O-acetyltransferase Back     alignment and domain information
>TIGR01738 bioH putative pimeloyl-BioC--CoA transferase BioH Back     alignment and domain information
>PRK13604 luxD acyl transferase; Provisional Back     alignment and domain information
>PF12697 Abhydrolase_6: Alpha/beta hydrolase family; PDB: 3LLC_A 3A2N_E 3A2M_A 3A2L_A 3AFI_F 3C5V_A 3C5W_P 3E0X_A 2ZJF_A 3QYJ_A Back     alignment and domain information
>PLN02211 methyl indole-3-acetate methyltransferase Back     alignment and domain information
>PRK08775 homoserine O-acetyltransferase; Provisional Back     alignment and domain information
>PRK11126 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase; Provisional Back     alignment and domain information
>PRK00175 metX homoserine O-acetyltransferase; Provisional Back     alignment and domain information
>PLN02511 hydrolase Back     alignment and domain information
>KOG1454 consensus Predicted hydrolase/acyltransferase (alpha/beta hydrolase superfamily) [General function prediction only] Back     alignment and domain information
>TIGR03695 menH_SHCHC 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Back     alignment and domain information
>PLN02894 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>TIGR01249 pro_imino_pep_1 proline iminopeptidase, Neisseria-type subfamily Back     alignment and domain information
>PRK05077 frsA fermentation/respiration switch protein; Reviewed Back     alignment and domain information
>PRK14875 acetoin dehydrogenase E2 subunit dihydrolipoyllysine-residue acetyltransferase; Provisional Back     alignment and domain information
>PRK10985 putative hydrolase; Provisional Back     alignment and domain information
>PLN02980 2-oxoglutarate decarboxylase/ hydro-lyase/ magnesium ion binding / thiamin pyrophosphate binding Back     alignment and domain information
>TIGR03100 hydr1_PEP hydrolase, ortholog 1, exosortase system type 1 associated Back     alignment and domain information
>PRK05855 short chain dehydrogenase; Validated Back     alignment and domain information
>KOG2382 consensus Predicted alpha/beta hydrolase [General function prediction only] Back     alignment and domain information
>PRK06765 homoserine O-acetyltransferase; Provisional Back     alignment and domain information
>KOG4391 consensus Predicted alpha/beta hydrolase BEM46 [General function prediction only] Back     alignment and domain information
>KOG2984 consensus Predicted hydrolase [General function prediction only] Back     alignment and domain information
>PLN02872 triacylglycerol lipase Back     alignment and domain information
>PRK10566 esterase; Provisional Back     alignment and domain information
>TIGR01836 PHA_synth_III_C poly(R)-hydroxyalkanoic acid synthase, class III, PhaC subunit Back     alignment and domain information
>KOG1552 consensus Predicted alpha/beta hydrolase [General function prediction only] Back     alignment and domain information
>PF12695 Abhydrolase_5: Alpha/beta hydrolase family; PDB: 3D0K_B 2I3D_B 3DOH_B 3DOI_B 3PFB_A 3S2Z_B 3PFC_A 3QM1_A 3PF8_B 3PF9_A Back     alignment and domain information
>KOG4667 consensus Predicted esterase [Lipid transport and metabolism] Back     alignment and domain information
>COG0429 Predicted hydrolase of the alpha/beta-hydrolase fold [General function prediction only] Back     alignment and domain information
>PF00561 Abhydrolase_1: alpha/beta hydrolase fold A web page of Esterases and alpha/beta hydrolases Back     alignment and domain information
>TIGR01838 PHA_synth_I poly(R)-hydroxyalkanoic acid synthase, class I Back     alignment and domain information
>KOG1838 consensus Alpha/beta hydrolase [General function prediction only] Back     alignment and domain information
>PRK11071 esterase YqiA; Provisional Back     alignment and domain information
>COG1506 DAP2 Dipeptidyl aminopeptidases/acylaminoacyl-peptidases [Amino acid transport and metabolism] Back     alignment and domain information
>KOG2564 consensus Predicted acetyltransferases and hydrolases with the alpha/beta hydrolase fold [General function prediction only] Back     alignment and domain information
>TIGR03101 hydr2_PEP hydrolase, ortholog 2, exosortase system type 1 associated Back     alignment and domain information
>PRK11460 putative hydrolase; Provisional Back     alignment and domain information
>PF00326 Peptidase_S9: Prolyl oligopeptidase family This family belongs to family S9 of the peptidase classification Back     alignment and domain information
>PRK07868 acyl-CoA synthetase; Validated Back     alignment and domain information
>PF06342 DUF1057: Alpha/beta hydrolase of unknown function (DUF1057); InterPro: IPR010463 This entry consists of proteins of unknown function which have an alpha/beta hydrolase fold Back     alignment and domain information
>COG0596 MhpC Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) [General function prediction only] Back     alignment and domain information
>TIGR01840 esterase_phb esterase, PHB depolymerase family Back     alignment and domain information
>PF01738 DLH: Dienelactone hydrolase family; InterPro: IPR002925 Dienelactone hydrolases play a crucial role in chlorocatechol degradation via the modified ortho cleavage pathway Back     alignment and domain information
>PLN02442 S-formylglutathione hydrolase Back     alignment and domain information
>COG2945 Predicted hydrolase of the alpha/beta superfamily [General function prediction only] Back     alignment and domain information
>TIGR02821 fghA_ester_D S-formylglutathione hydrolase Back     alignment and domain information
>PLN00021 chlorophyllase Back     alignment and domain information
>PF05448 AXE1: Acetyl xylan esterase (AXE1); InterPro: IPR008391 This family consists of several bacterial acetyl xylan esterase proteins Back     alignment and domain information
>TIGR00976 /NonD putative hydrolase, CocE/NonD family Back     alignment and domain information
>COG3208 GrsT Predicted thioesterase involved in non-ribosomal peptide biosynthesis [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PF06500 DUF1100: Alpha/beta hydrolase of unknown function (DUF1100); InterPro: IPR010520 Proteins in this entry display esterase activity toward pNP-butyrate [] Back     alignment and domain information
>COG0412 Dienelactone hydrolase and related enzymes [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PRK10115 protease 2; Provisional Back     alignment and domain information
>PF03096 Ndr: Ndr family; InterPro: IPR004142 This family consists of proteins from different gene families: Ndr1/RTP/Drg1, Ndr2, and Ndr3 Back     alignment and domain information
>TIGR01839 PHA_synth_II poly(R)-hydroxyalkanoic acid synthase, class II Back     alignment and domain information
>PF02230 Abhydrolase_2: Phospholipase/Carboxylesterase; InterPro: IPR003140 This entry represents the alpha/beta hydrolase domain found in phospholipases [], carboxylesterases [] and thioesterases Back     alignment and domain information
>KOG2931 consensus Differentiation-related gene 1 protein (NDR1 protein), related proteins [Function unknown] Back     alignment and domain information
>COG4757 Predicted alpha/beta hydrolase [General function prediction only] Back     alignment and domain information
>PF02273 Acyl_transf_2: Acyl transferase; InterPro: IPR003157 LuxD proteins are bacterial acyl transferases Back     alignment and domain information
>COG3458 Acetyl esterase (deacetylase) [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>COG2021 MET2 Homoserine acetyltransferase [Amino acid transport and metabolism] Back     alignment and domain information
>PF12146 Hydrolase_4: Putative lysophospholipase; InterPro: IPR022742 This domain is found in bacteria and eukaryotes and is approximately 110 amino acids in length Back     alignment and domain information
>PF02129 Peptidase_S15: X-Pro dipeptidyl-peptidase (S15 family); InterPro: IPR000383 This entry represents a domain found peptidases Xaa-Pro dipeptidyl-peptidase and glutaryl-7-aminocephalosporanic-acid acylase, which belong to MEROPS peptidase families S15 and S45 respectively [] Back     alignment and domain information
>TIGR03230 lipo_lipase lipoprotein lipase Back     alignment and domain information
>PRK10162 acetyl esterase; Provisional Back     alignment and domain information
>PF06821 Ser_hydrolase: Serine hydrolase; InterPro: IPR010662 This family contains a number of hypothetical bacterial proteins of unknown function, which may be cytosolic Back     alignment and domain information
>COG0400 Predicted esterase [General function prediction only] Back     alignment and domain information
>cd00707 Pancreat_lipase_like Pancreatic lipase-like enzymes Back     alignment and domain information
>PF08538 DUF1749: Protein of unknown function (DUF1749); InterPro: IPR013744 This is a plant and fungal family of unknown function Back     alignment and domain information
>TIGR01849 PHB_depoly_PhaZ polyhydroxyalkanoate depolymerase, intracellular Back     alignment and domain information
>PF10230 DUF2305: Uncharacterised conserved protein (DUF2305); InterPro: IPR019363 This entry contains proteins that have no known function Back     alignment and domain information
>KOG2624 consensus Triglyceride lipase-cholesterol esterase [Lipid transport and metabolism] Back     alignment and domain information
>PF09752 DUF2048: Uncharacterized conserved protein (DUF2048); InterPro: IPR019149 This family of proteins has no known function Back     alignment and domain information
>PF12715 Abhydrolase_7: Abhydrolase family; PDB: 3NUZ_C 3G8Y_A Back     alignment and domain information
>COG3571 Predicted hydrolase of the alpha/beta-hydrolase fold [General function prediction only] Back     alignment and domain information
>KOG3043 consensus Predicted hydrolase related to dienelactone hydrolase [General function prediction only] Back     alignment and domain information
>PF12740 Chlorophyllase2: Chlorophyllase enzyme; InterPro: IPR010821 This family consists of several chlorophyllase proteins (3 Back     alignment and domain information
>PF05728 UPF0227: Uncharacterised protein family (UPF0227); InterPro: IPR008886 Despite being classed as uncharacterised proteins, the members of this family are almost certainly enzymes in that they contain a domain distantly related to IPR000073 from INTERPRO Back     alignment and domain information
>TIGR03502 lipase_Pla1_cef extracellular lipase, Pla-1/cef family Back     alignment and domain information
>PF07859 Abhydrolase_3: alpha/beta hydrolase fold A web page of Esterases and alpha/beta hydrolases Back     alignment and domain information
>PF10503 Esterase_phd: Esterase PHB depolymerase Back     alignment and domain information
>PRK05371 x-prolyl-dipeptidyl aminopeptidase; Provisional Back     alignment and domain information
>PF00975 Thioesterase: Thioesterase domain; InterPro: IPR001031 Thioesterase domains often occur integrated in or associated with peptide synthetases which are involved in the non-ribosomal synthesis of peptide antibiotics [] Back     alignment and domain information
>PF06057 VirJ: Bacterial virulence protein (VirJ); InterPro: IPR010333 This entry contains several bacterial VirJ virulence proteins Back     alignment and domain information
>COG0657 Aes Esterase/lipase [Lipid metabolism] Back     alignment and domain information
>KOG2565 consensus Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) [General function prediction only] Back     alignment and domain information
>KOG1515 consensus Arylacetamide deacetylase [Defense mechanisms] Back     alignment and domain information
>COG3243 PhaC Poly(3-hydroxyalkanoate) synthetase [Lipid metabolism] Back     alignment and domain information
>COG3545 Predicted esterase of the alpha/beta hydrolase fold [General function prediction only] Back     alignment and domain information
>COG4188 Predicted dienelactone hydrolase [General function prediction only] Back     alignment and domain information
>KOG2100 consensus Dipeptidyl aminopeptidase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF03959 FSH1: Serine hydrolase (FSH1); InterPro: IPR005645 This entry represents proteins belonging to the AB hydrolase family Back     alignment and domain information
>COG2936 Predicted acyl esterases [General function prediction only] Back     alignment and domain information
>PTZ00472 serine carboxypeptidase (CBP1); Provisional Back     alignment and domain information
>COG4099 Predicted peptidase [General function prediction only] Back     alignment and domain information
>KOG4627 consensus Kynurenine formamidase [Amino acid transport and metabolism] Back     alignment and domain information
>KOG2281 consensus Dipeptidyl aminopeptidases/acylaminoacyl-peptidases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF07224 Chlorophyllase: Chlorophyllase; InterPro: IPR010821 This family consists of several chlorophyllase proteins (3 Back     alignment and domain information
>KOG2551 consensus Phospholipase/carboxyhydrolase [Amino acid transport and metabolism] Back     alignment and domain information
>KOG3975 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF03403 PAF-AH_p_II: Platelet-activating factor acetylhydrolase, isoform II; PDB: 3F98_B 3F97_B 3D59_A 3F96_A 3D5E_B 3F9C_A Back     alignment and domain information
>PF08840 BAAT_C: BAAT / Acyl-CoA thioester hydrolase C terminal; InterPro: IPR014940 Acyl-CoA thioesterases are a group of enzymes that catalyse the hydrolysis of acyl-CoAs to the free fatty acid and coenzyme A (CoASH), providing the potential to regulate intracellular levels of acyl-CoAs, free fatty acids and CoASH Back     alignment and domain information
>PRK10252 entF enterobactin synthase subunit F; Provisional Back     alignment and domain information
>PF07819 PGAP1: PGAP1-like protein; InterPro: IPR012908 The sequences found in this family are similar to PGAP1 (Q765A7 from SWISSPROT) Back     alignment and domain information
>PF06028 DUF915: Alpha/beta hydrolase of unknown function (DUF915); InterPro: IPR010315 This family consists of bacterial proteins of unknown function, which are hydrolase-like Back     alignment and domain information
>KOG2112 consensus Lysophospholipase [Lipid transport and metabolism] Back     alignment and domain information
>PF01674 Lipase_2: Lipase (class 2); InterPro: IPR002918 Lipases or triacylglycerol acylhydrolases hydrolyse ester bonds in triacylglycerol giving diacylglycerol, monoacylglycerol, glycerol and free fatty acids [] Back     alignment and domain information
>PF00151 Lipase: Lipase; InterPro: IPR013818 Triglyceride lipases (3 Back     alignment and domain information
>COG3509 LpqC Poly(3-hydroxybutyrate) depolymerase [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PF03583 LIP: Secretory lipase ; InterPro: IPR005152 This entry represents a family of secreted lipases Back     alignment and domain information
>KOG1553 consensus Predicted alpha/beta hydrolase BAT5 [General function prediction only] Back     alignment and domain information
>COG1505 Serine proteases of the peptidase family S9A [Amino acid transport and metabolism] Back     alignment and domain information
>PLN02733 phosphatidylcholine-sterol O-acyltransferase Back     alignment and domain information
>PRK10439 enterobactin/ferric enterobactin esterase; Provisional Back     alignment and domain information
>PF05990 DUF900: Alpha/beta hydrolase of unknown function (DUF900); InterPro: IPR010297 This domain is associated with proteins of unknown function, which are hydrolase-like Back     alignment and domain information
>KOG3101 consensus Esterase D [General function prediction only] Back     alignment and domain information
>PRK04940 hypothetical protein; Provisional Back     alignment and domain information
>COG3319 Thioesterase domains of type I polyketide synthases or non-ribosomal peptide synthetases [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PF11339 DUF3141: Protein of unknown function (DUF3141); InterPro: IPR024501 This family of proteins appears to be predominantly expressed in Proteobacteria Back     alignment and domain information
>PF05677 DUF818: Chlamydia CHLPS protein (DUF818); InterPro: IPR008536 This family of unknown function includes several Chlamydia CHLPS proteins and Legionella SidB proteins Back     alignment and domain information
>smart00824 PKS_TE Thioesterase Back     alignment and domain information
>PF12048 DUF3530: Protein of unknown function (DUF3530); InterPro: IPR022529 This family of proteins is functionally uncharacterised Back     alignment and domain information
>KOG3847 consensus Phospholipase A2 (platelet-activating factor acetylhydrolase in humans) [Lipid transport and metabolism] Back     alignment and domain information
>PF00756 Esterase: Putative esterase; InterPro: IPR000801 This family contains several seemingly unrelated proteins, including human esterase D; mycobacterial antigen 85, which is responsible for the high affinity of mycobacteria to fibronectin; Corynebacterium glutamicum major secreted protein PS1; and hypothetical proteins from Escherichia coli, yeast, mycobacteria and Haemophilus influenzae Back     alignment and domain information
>KOG3253 consensus Predicted alpha/beta hydrolase [General function prediction only] Back     alignment and domain information
>COG1770 PtrB Protease II [Amino acid transport and metabolism] Back     alignment and domain information
>KOG4840 consensus Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) [General function prediction only] Back     alignment and domain information
>PF05705 DUF829: Eukaryotic protein of unknown function (DUF829); InterPro: IPR008547 This signature identifies Transmembrane protein 53, that have no known function but are predicted to be integral membrane proteins Back     alignment and domain information
>KOG2237 consensus Predicted serine protease [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG4782 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>cd00312 Esterase_lipase Esterases and lipases (includes fungal lipases, cholinesterases, etc Back     alignment and domain information
>PF11144 DUF2920: Protein of unknown function (DUF2920); InterPro: IPR022605 This bacterial family of proteins has no known function Back     alignment and domain information
>KOG1551 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF05577 Peptidase_S28: Serine carboxypeptidase S28; InterPro: IPR008758 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF10340 DUF2424: Protein of unknown function (DUF2424); InterPro: IPR019436 Sterol homeostasis in eukaryotic cells relies on the reciprocal interconversion of free sterols and steryl esters Back     alignment and domain information
>COG3150 Predicted esterase [General function prediction only] Back     alignment and domain information
>COG3946 VirJ Type IV secretory pathway, VirJ component [Intracellular trafficking and secretion] Back     alignment and domain information
>PF02450 LCAT: Lecithin:cholesterol acyltransferase; InterPro: IPR003386 Lecithin:cholesterol acyltransferase (LACT), also known as phosphatidylcholine-sterol acyltransferase (2 Back     alignment and domain information
>PF05057 DUF676: Putative serine esterase (DUF676); InterPro: IPR007751 This domain, whose function is unknown, is found within a group of putative lipases Back     alignment and domain information
>PLN02209 serine carboxypeptidase Back     alignment and domain information
>COG1073 Hydrolases of the alpha/beta superfamily [General function prediction only] Back     alignment and domain information
>COG1075 LipA Predicted acetyltransferases and hydrolases with the alpha/beta hydrolase fold [General function prediction only] Back     alignment and domain information
>PF00135 COesterase: Carboxylesterase family The prints entry is specific to acetylcholinesterase; InterPro: IPR002018 Higher eukaryotes have many distinct esterases Back     alignment and domain information
>COG4814 Uncharacterized protein with an alpha/beta hydrolase fold [General function prediction only] Back     alignment and domain information
>COG2272 PnbA Carboxylesterase type B [Lipid metabolism] Back     alignment and domain information
>PF02089 Palm_thioest: Palmitoyl protein thioesterase; InterPro: IPR002472 Neuronal ceroid lipofuscinoses (NCL) represent a group of encephalopathies that occur in 1 in 12,500 children Back     alignment and domain information
>PLN02633 palmitoyl protein thioesterase family protein Back     alignment and domain information
>PF00450 Peptidase_S10: Serine carboxypeptidase; InterPro: IPR001563 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF04301 DUF452: Protein of unknown function (DUF452); InterPro: IPR007398 This is a family of uncharacterised proteins Back     alignment and domain information
>KOG2183 consensus Prolylcarboxypeptidase (angiotensinase C) [Posttranslational modification, protein turnover, chaperones; General function prediction only] Back     alignment and domain information
>KOG3967 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF07082 DUF1350: Protein of unknown function (DUF1350); InterPro: IPR010765 This family consists of several hypothetical proteins from both cyanobacteria and plants Back     alignment and domain information
>PLN02606 palmitoyl-protein thioesterase Back     alignment and domain information
>KOG3724 consensus Negative regulator of COPII vesicle formation [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2541 consensus Palmitoyl protein thioesterase [Lipid transport and metabolism; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0627 Predicted esterase [General function prediction only] Back     alignment and domain information
>COG2819 Predicted hydrolase of the alpha/beta superfamily [General function prediction only] Back     alignment and domain information
>PF04083 Abhydro_lipase: Partial alpha/beta-hydrolase lipase region; InterPro: IPR006693 The alpha/beta hydrolase fold is common to several hydrolytic enzymes of widely differing phylogenetic origin and catalytic function Back     alignment and domain information
>PF08386 Abhydrolase_4: TAP-like protein; InterPro: IPR013595 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>KOG2182 consensus Hydrolytic enzymes of the alpha/beta hydrolase fold [Posttranslational modification, protein turnover, chaperones; General function prediction only] Back     alignment and domain information
>PF10142 PhoPQ_related: PhoPQ-activated pathogenicity-related protein; InterPro: IPR009199 Proteins in this entry are believed to play a role in virulence/pathogenicity in Salmonella Back     alignment and domain information
>PLN03016 sinapoylglucose-malate O-sinapoyltransferase Back     alignment and domain information
>COG2382 Fes Enterochelin esterase and related enzymes [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd00741 Lipase Lipase Back     alignment and domain information
>PF06259 Abhydrolase_8: Alpha/beta hydrolase; InterPro: IPR010427 This is a family of uncharacterised proteins found in Actinobacteria Back     alignment and domain information
>PLN02517 phosphatidylcholine-sterol O-acyltransferase Back     alignment and domain information
>COG4553 DepA Poly-beta-hydroxyalkanoate depolymerase [Lipid metabolism] Back     alignment and domain information
>KOG2369 consensus Lecithin:cholesterol acyltransferase (LCAT)/Acyl-ceramide synthase [Lipid transport and metabolism] Back     alignment and domain information
>cd00519 Lipase_3 Lipase (class 3) Back     alignment and domain information
>KOG1282 consensus Serine carboxypeptidases (lysosomal cathepsin A) [Posttranslational modification, protein turnover, chaperones; Amino acid transport and metabolism] Back     alignment and domain information
>PF01083 Cutinase: Cutinase; InterPro: IPR000675 Aerial plant organs are protected by a cuticle composed of an insoluble polymeric structural compound, cutin, which is a polyester composed of hydroxy and hydroxyepoxy fatty acids [] Back     alignment and domain information
>COG2939 Carboxypeptidase C (cathepsin A) [Amino acid transport and metabolism] Back     alignment and domain information
>PF01764 Lipase_3: Lipase (class 3); InterPro: IPR002921 Triglyceride lipases are lipolytic enzymes that hydrolyse ester linkages of triglycerides [] Back     alignment and domain information
>KOG2521 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF11187 DUF2974: Protein of unknown function (DUF2974); InterPro: IPR024499 This family of proteins has no known function Back     alignment and domain information
>KOG1516 consensus Carboxylesterase and related proteins [General function prediction only] Back     alignment and domain information
>PF11288 DUF3089: Protein of unknown function (DUF3089); InterPro: IPR021440 This family of proteins has no known function Back     alignment and domain information
>COG4947 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF07519 Tannase: Tannase and feruloyl esterase; InterPro: IPR011118 This family includes fungal tannase [] and feruloyl esterase [, ] Back     alignment and domain information
>COG2830 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG4388 consensus Hormone-sensitive lipase HSL [Lipid transport and metabolism] Back     alignment and domain information
>PLN02454 triacylglycerol lipase Back     alignment and domain information
>PF05576 Peptidase_S37: PS-10 peptidase S37; InterPro: IPR008761 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PLN02162 triacylglycerol lipase Back     alignment and domain information
>PLN00413 triacylglycerol lipase Back     alignment and domain information
>PLN02213 sinapoylglucose-malate O-sinapoyltransferase/ carboxypeptidase Back     alignment and domain information
>PLN02310 triacylglycerol lipase Back     alignment and domain information
>PLN02571 triacylglycerol lipase Back     alignment and domain information
>KOG4372 consensus Predicted alpha/beta hydrolase [General function prediction only] Back     alignment and domain information
>TIGR03712 acc_sec_asp2 accessory Sec system protein Asp2 Back     alignment and domain information
>PLN02408 phospholipase A1 Back     alignment and domain information
>KOG1202 consensus Animal-type fatty acid synthase and related proteins [Lipid transport and metabolism] Back     alignment and domain information
>PLN02934 triacylglycerol lipase Back     alignment and domain information
>PLN03037 lipase class 3 family protein; Provisional Back     alignment and domain information
>PF06441 EHN: Epoxide hydrolase N terminus; InterPro: IPR010497 This entry represents the N-terminal region of the eukaryotic epoxide hydrolase protein Back     alignment and domain information
>KOG1283 consensus Serine carboxypeptidases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN02324 triacylglycerol lipase Back     alignment and domain information
>COG4287 PqaA PhoPQ-activated pathogenicity-related protein [General function prediction only] Back     alignment and domain information
>PLN02847 triacylglycerol lipase Back     alignment and domain information
>PF05277 DUF726: Protein of unknown function (DUF726); InterPro: IPR007941 This family consists of several uncharacterised eukaryotic proteins Back     alignment and domain information
>PLN02753 triacylglycerol lipase Back     alignment and domain information
>PLN02802 triacylglycerol lipase Back     alignment and domain information
>PLN02761 lipase class 3 family protein Back     alignment and domain information
>PF08237 PE-PPE: PE-PPE domain; InterPro: IPR013228 The human pathogen Mycobacterium tuberculosis harbours a large number of genes that encode proteins whose N-termini contain the characteristic motifs Pro-Glu (PE) or Pro-Pro-Glu (PPE) Back     alignment and domain information
>COG5153 CVT17 Putative lipase essential for disintegration of autophagic bodies inside the vacuole [Intracellular trafficking and secretion / Lipid metabolism] Back     alignment and domain information
>KOG4540 consensus Putative lipase essential for disintegration of autophagic bodies inside the vacuole [Intracellular trafficking, secretion, and vesicular transport; Lipid transport and metabolism] Back     alignment and domain information
>PLN02719 triacylglycerol lipase Back     alignment and domain information
>PLN02213 sinapoylglucose-malate O-sinapoyltransferase/ carboxypeptidase Back     alignment and domain information
>KOG4569 consensus Predicted lipase [Lipid transport and metabolism] Back     alignment and domain information
>PF09949 DUF2183: Uncharacterized conserved protein (DUF2183); InterPro: IPR019236 This domain, found in various bacterial and fungal proteins, has no known function Back     alignment and domain information
>KOG2029 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF06850 PHB_depo_C: PHB de-polymerase C-terminus; InterPro: IPR009656 This entry represents the C terminus of bacterial poly(3-hydroxybutyrate) (PHB) de-polymerase Back     alignment and domain information
>PF09994 DUF2235: Uncharacterized alpha/beta hydrolase domain (DUF2235); InterPro: IPR018712 This domain has no known function Back     alignment and domain information
>PF03283 PAE: Pectinacetylesterase Back     alignment and domain information
>PF00450 Peptidase_S10: Serine carboxypeptidase; InterPro: IPR001563 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PLN03016 sinapoylglucose-malate O-sinapoyltransferase Back     alignment and domain information
>COG3673 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1282 consensus Serine carboxypeptidases (lysosomal cathepsin A) [Posttranslational modification, protein turnover, chaperones; Amino acid transport and metabolism] Back     alignment and domain information
>PF06309 Torsin: Torsin; InterPro: IPR010448 This family consists of several eukaryotic torsin proteins Back     alignment and domain information
>COG0529 CysC Adenylylsulfate kinase and related kinases [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG2385 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG3340 PepE Peptidase E [Amino acid transport and metabolism] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query308
3pe6_A303 Crystal Structure Of A Soluble Form Of Human Mgll I 2e-18
3jwe_A320 Crystal Structure Of Human Mono-Glyceride Lipase In 8e-18
3hju_A342 Crystal Structure Of Human Monoglyceride Lipase Len 9e-18
3jw8_A320 Crystal Structure Of Human Mono-Glyceride Lipase Le 2e-16
>pdb|3PE6|A Chain A, Crystal Structure Of A Soluble Form Of Human Mgll In Complex With An Inhibitor Length = 303 Back     alignment and structure

Iteration: 1

Score = 89.7 bits (221), Expect = 2e-18, Method: Compositional matrix adjust. Identities = 77/277 (27%), Positives = 117/277 (42%), Gaps = 14/277 (5%) Query: 35 YITNSRGLRLFTQWWTPLPPAKTLGVLCVVHGFTGESSWIVQLTAVLFAKSGFATCAIDH 94 ++ N+ G LF ++W P K L + V HG GE S + A + A DH Sbjct: 21 HLVNADGQYLFCRYWAPTGTPKAL--IFVSHG-AGEHSGRYEELARMLMGLDLLVFAHDH 77 Query: 95 QGHGFSDGLVAHIPDLNPVVEDAISFFDSFRARHAPDLPAFLYSESLGGAIALYITLRQK 154 GHG S+G + D + V D + DS + + P LP FL S+GGAIA+ + Sbjct: 78 VGHGQSEGERMVVSDFHVFVRDVLQHVDSMQKDY-PGLPVFLLGHSMGGAIAILTAAERP 136 Query: 155 GAWDGLILNGAMCGISQKFKPPWPLEHLLFTVAWLVPTWRVVPTRGSLPM---VSFKEEW 211 G + G++L + + P F V V+P S P+ V + + Sbjct: 137 GHFAGMVLISPLVLAN-------PESATTFKVLAAKVLNSVLPNLSSGPIDSSVLSRNKT 189 Query: 212 KRKLALSSXXXXXXXXXXXXXLELLRVSRDLQGRFEEVEVPMLICHGGDDVVCDPACVEE 271 + + S ++LL ++ ++ VP L+ G D +CD Sbjct: 190 EVDIYNSDPLICRAGLKVCFGIQLLNAVSRVERALPKLTVPFLLLQGSADRLCDSKGAYL 249 Query: 272 LYKRAASKDKTLSIYPGMWHQLIGEPEENVELVFGEM 308 L + A S+DKTL IY G +H L E E VF E+ Sbjct: 250 LMELAKSQDKTLKIYEGAYHVLHKELPEVTNSVFHEI 286
>pdb|3JWE|A Chain A, Crystal Structure Of Human Mono-Glyceride Lipase In Complex With Sar629 Length = 320 Back     alignment and structure
>pdb|3HJU|A Chain A, Crystal Structure Of Human Monoglyceride Lipase Length = 342 Back     alignment and structure
>pdb|3JW8|A Chain A, Crystal Structure Of Human Mono-Glyceride Lipase Length = 320 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query308
3hju_A342 Monoglyceride lipase; alpha/beta hydrolase, hydrol 1e-93
3pe6_A303 Monoglyceride lipase; alpha-beta hydrolase fold, 2 3e-89
3rm3_A270 MGLP, thermostable monoacylglycerol lipase; alpha/ 2e-34
1tqh_A247 Carboxylesterase precursor; tetrahedral intermedia 9e-30
3dkr_A251 Esterase D; alpha beta hydrolase, mechanism, catal 1e-28
1tht_A305 Thioesterase; 2.10A {Vibrio harveyi} SCOP: c.69.1. 1e-20
2wtm_A251 EST1E; hydrolase; 1.60A {Clostridium proteoclastic 2e-20
3pfb_A270 Cinnamoyl esterase; alpha/beta hydrolase fold, hyd 6e-17
2hdw_A367 Hypothetical protein PA2218; alpha/beta hydrolase 5e-14
3fsg_A272 Alpha/beta superfamily hydrolase; PF00561, MCSG, P 9e-12
3llc_A270 Putative hydrolase; structural genomics, joint cen 1e-11
2jbw_A386 Dhpon-hydrolase, 2,6-dihydroxy-pseudo-oxynicotine 2e-11
2rau_A354 Putative esterase; NP_343859.1, putative lipase, s 2e-11
2xmz_A269 Hydrolase, alpha/beta hydrolase fold family; menaq 5e-11
1vlq_A337 Acetyl xylan esterase; TM0077, structural genomics 5e-11
1u2e_A289 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase 5e-11
2ocg_A254 Valacyclovir hydrolase; alpha beta hydrolase fold; 6e-11
2puj_A286 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrola; 6e-11
3fob_A281 Bromoperoxidase; structural genomics, IDP00046, ba 2e-10
3bdi_A207 Uncharacterized protein TA0194; NP_393672.1, predi 2e-10
1iup_A282 META-cleavage product hydrolase; aromatic compound 2e-10
3fnb_A405 Acylaminoacyl peptidase SMU_737; alpha-beta-alpha 5e-10
1q0r_A298 RDMC, aclacinomycin methylesterase; anthracycline, 7e-10
3ia2_A271 Arylesterase; alpha-beta hydrolase fold, transitio 7e-10
3ksr_A290 Putative serine hydrolase; catalytic triad, struct 1e-09
3mve_A415 FRSA, UPF0255 protein VV1_0328; FRSA,fermentation/ 1e-09
1a8q_A274 Bromoperoxidase A1; haloperoxidase, oxidoreductase 2e-09
2wue_A291 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrolas 2e-09
3hss_A293 Putative bromoperoxidase; alpha beta hydrolase, ox 2e-09
1j1i_A296 META cleavage compound hydrolase; carbazole degrad 3e-09
3fcy_A346 Xylan esterase 1; alpha/beta hydrolase, carbohydra 3e-09
4f0j_A315 Probable hydrolytic enzyme; alpha/beta hydrolase f 4e-09
3e0x_A245 Lipase-esterase related protein; APC60309, clostri 2e-08
3r0v_A262 Alpha/beta hydrolase fold protein; structural geno 3e-08
3kxp_A314 Alpha-(N-acetylaminomethylene)succinic acid hydrol 4e-08
1m33_A258 BIOH protein; alpha-betta-alpha sandwich, structur 7e-08
1a8s_A273 Chloroperoxidase F; haloperoxidase, oxidoreductase 7e-08
3vdx_A 456 Designed 16NM tetrahedral protein CAGE containing 8e-08
3oos_A278 Alpha/beta hydrolase family protein; APC67239.0, p 9e-08
1c4x_A285 BPHD, protein (2-hydroxy-6-OXO-6-phenylhexa-2,4-di 1e-07
1hkh_A279 Gamma lactamase; hydrolase, alpha/beta hydrolase, 1e-07
3k2i_A422 Acyl-coenzyme A thioesterase 4; alpha/beta hydrola 1e-07
3hlk_A446 Acyl-coenzyme A thioesterase 2, mitochondrial; alp 2e-07
1ufo_A238 Hypothetical protein TT1662; alpha-beta fold, hydr 4e-07
3qit_A286 CURM TE, polyketide synthase; thioesterase, alpha/ 5e-07
1zoi_A276 Esterase; alpha/beta hydrolase fold; 1.60A {Pseudo 8e-07
1brt_A277 Bromoperoxidase A2; haloperoxidase, oxidoreductase 8e-07
1imj_A210 CIB, CCG1-interacting factor B; alpha/beta hydrola 1e-06
3v48_A268 Aminohydrolase, putative aminoacrylate hydrolase R 1e-06
2xt0_A297 Haloalkane dehalogenase; hydrolase, alpha-beta hyd 1e-06
3nwo_A330 PIP, proline iminopeptidase; structural genomics, 1e-06
3bwx_A285 Alpha/beta hydrolase; YP_496220.1, joint center fo 2e-06
4ezi_A377 Uncharacterized protein; alpha-beta hydrolases fol 2e-06
1a88_A275 Chloroperoxidase L; haloperoxidase, oxidoreductase 3e-06
2r11_A306 Carboxylesterase NP; 2632844, putative hydrolase, 3e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-06
3l80_A292 Putative uncharacterized protein SMU.1393C; alpha/ 7e-06
2qjw_A176 Uncharacterized protein XCC1541; putative hydrolas 1e-05
3c5v_A316 PME-1, protein phosphatase methylesterase 1; demet 1e-05
3qvm_A282 OLEI00960; structural genomics, PSI-biology, midwe 1e-05
2yys_A286 Proline iminopeptidase-related protein; TTHA1809, 3e-05
2xua_A266 PCAD, 3-oxoadipate ENOL-lactonase; hydrolase, cate 3e-05
2y6u_A398 Peroxisomal membrane protein LPX1; hydrolase, puta 4e-05
1r3d_A264 Conserved hypothetical protein VC1974; structural 4e-05
2o2g_A223 Dienelactone hydrolase; YP_324580.1, structural ge 6e-05
3guu_A462 Lipase A; protein structure, hydrolase; HET: 1PE; 6e-05
1l7a_A318 Cephalosporin C deacetylase; structural genomics, 7e-05
3h04_A275 Uncharacterized protein; protein with unknown func 9e-05
1xkl_A273 SABP2, salicylic acid-binding protein 2; alpha-bet 2e-04
3h2g_A397 Esterase; xanthomonas oryzae PV. oryzae, cell WALL 2e-04
1wom_A271 RSBQ, sigma factor SIGB regulation protein RSBQ; a 3e-04
3sty_A267 Methylketone synthase 1; alpha/beta hydrolase, dec 3e-04
3om8_A266 Probable hydrolase; structural genomics, PSI-2, pr 5e-04
2i3d_A249 AGR_C_3351P, hypothetical protein ATU1826; structu 5e-04
4ao6_A259 Esterase; hydrolase, thermo label; 1.60A {Unidenti 7e-04
>3hju_A Monoglyceride lipase; alpha/beta hydrolase, hydrolase, serine esterase; 2.20A {Homo sapiens} Length = 342 Back     alignment and structure
 Score =  280 bits (717), Expect = 1e-93
 Identities = 77/306 (25%), Positives = 130/306 (42%), Gaps = 9/306 (2%)

Query: 4   HPVAEANEQSLFGSLTPDEFYARHSVSHSSE-YITNSRGLRLFTQWWTPLPPAKTLGVLC 62
           H    A ++               S+ +    ++ N+ G  LF ++W P    K   ++ 
Sbjct: 7   HHHHGAGDRGPEFPEESSPRRTPQSIPYQDLPHLVNADGQYLFCRYWKPTGTPK--ALIF 64

Query: 63  VVHGFTGESSWIVQLTAVLFAKSGFATCAIDHQGHGFSDGLVAHIPDLNPVVEDAISFFD 122
           V HG  GE S   +  A +         A DH GHG S+G    + D +  V D +   D
Sbjct: 65  VSHGA-GEHSGRYEELARMLMGLDLLVFAHDHVGHGQSEGERMVVSDFHVFVRDVLQHVD 123

Query: 123 SFRARHAPDLPAFLYSESLGGAIALYITLRQKGAWDGLILNGAMCGISQKFKPPWPLEHL 182
           S +  + P LP FL   S+GGAIA+     + G + G++L   +   + +    + +   
Sbjct: 124 SMQKDY-PGLPVFLLGHSMGGAIAILTAAERPGHFAGMVLISPLVLANPESATTFKV-LA 181

Query: 183 LFTVAWLVPTWRVVPTRGSLPMVSFKEEWKRKLALSSPRRPVARPRAATALELLRVSRDL 242
              +  ++P   + P   S  ++S + + +  +  S P    A  +    ++LL     +
Sbjct: 182 AKVLNLVLPNLSLGPIDSS--VLS-RNKTEVDIYNSDPLICRAGLKVCFGIQLLNAVSRV 238

Query: 243 QGRFEEVEVPMLICHGGDDVVCDPACVEELYKRAASKDKTLSIYPGMWHQLIGEPEENVE 302
           +    ++ VP L+  G  D +CD      L + A S+DKTL IY G +H L  E  E   
Sbjct: 239 ERALPKLTVPFLLLQGSADRLCDSKGAYLLMELAKSQDKTLKIYEGAYHVLHKELPEVTN 298

Query: 303 LVFGEM 308
            VF E+
Sbjct: 299 SVFHEI 304


>3pe6_A Monoglyceride lipase; alpha-beta hydrolase fold, 2-arachidonyl-glycerol, M associated, hydrolase, hydrolase-hydrolase inhibitor comple; HET: ZYH; 1.35A {Homo sapiens} PDB: 3jw8_A 3jwe_A* Length = 303 Back     alignment and structure
>3rm3_A MGLP, thermostable monoacylglycerol lipase; alpha/beta hydrolase fold, hydrolase; 1.20A {Bacillus SP} Length = 270 Back     alignment and structure
>1tqh_A Carboxylesterase precursor; tetrahedral intermediate, alpha/beta hydrolase; 1.63A {Geobacillus stearothermophilus} SCOP: c.69.1.29 PDB: 1r1d_A* 4diu_A Length = 247 Back     alignment and structure
>3dkr_A Esterase D; alpha beta hydrolase, mechanism, catalytic triad, rotation; 1.60A {Lactobacillus rhamnosus} PDB: 3dlt_A 3dyi_A 3dyv_A 3e1g_A Length = 251 Back     alignment and structure
>1tht_A Thioesterase; 2.10A {Vibrio harveyi} SCOP: c.69.1.13 Length = 305 Back     alignment and structure
>2wtm_A EST1E; hydrolase; 1.60A {Clostridium proteoclasticum} PDB: 2wtn_A* Length = 251 Back     alignment and structure
>3pfb_A Cinnamoyl esterase; alpha/beta hydrolase fold, hydrolase, cinnamoyl/Fe esterase, hydroxycinammates, extracellular; HET: ZYC; 1.58A {Lactobacillus johnsonii} PDB: 3pf9_A* 3pfc_A* 3s2z_A* 3pf8_A 3qm1_A* Length = 270 Back     alignment and structure
>2hdw_A Hypothetical protein PA2218; alpha/beta hydrolase fold, structural genomics, PSI, structure initiative; 2.00A {Pseudomonas aeruginosa} Length = 367 Back     alignment and structure
>3fsg_A Alpha/beta superfamily hydrolase; PF00561, MCSG, PSI, PSI-2, structural genomics, protein structure initiative, midwest for structural genomics; 2.00A {Oenococcus oeni} Length = 272 Back     alignment and structure
>3llc_A Putative hydrolase; structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE PG4; 1.80A {Agrobacterium vitis} Length = 270 Back     alignment and structure
>2jbw_A Dhpon-hydrolase, 2,6-dihydroxy-pseudo-oxynicotine hydrolase; alpha/beta hydrolase, META-cleavage pathway; 2.1A {Arthrobacter nicotinovorans} SCOP: c.69.1.41 Length = 386 Back     alignment and structure
>2rau_A Putative esterase; NP_343859.1, putative lipase, structural genomics, joint CEN structural genomics, JCSG; HET: PG4 UNL; 1.85A {Sulfolobus solfataricus P2} Length = 354 Back     alignment and structure
>2xmz_A Hydrolase, alpha/beta hydrolase fold family; menaquinone biosynthesis, lyase; 1.94A {Staphylococcus aureus} Length = 269 Back     alignment and structure
>1vlq_A Acetyl xylan esterase; TM0077, structural genomics, JCSG, PR structure initiative, PSI, joint center for structural GENO hydrolase; 2.10A {Thermotoga maritima} SCOP: c.69.1.25 PDB: 3m81_A 3m83_A* 3m82_A* Length = 337 Back     alignment and structure
>1u2e_A 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase; alpha/beta hydrolase fold; 2.10A {Escherichia coli} Length = 289 Back     alignment and structure
>2ocg_A Valacyclovir hydrolase; alpha beta hydrolase fold; 1.75A {Homo sapiens} PDB: 2oci_A* 2ock_A 2ocl_A Length = 254 Back     alignment and structure
>2puj_A 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrola; C-C bond hydrolase, hydrolase; HET: HPZ; 1.57A {Burkholderia xenovorans} PDB: 2pu7_A* 3v1m_A* 3v1l_A* 2puh_A* 3v1n_A* 3v1k_A* 2og1_A 2pu5_A 2rhw_A* 2rht_A* 2ri6_A Length = 286 Back     alignment and structure
>3fob_A Bromoperoxidase; structural genomics, IDP00046, bacillus ANT peroxidase, oxidoreductase; 1.74A {Bacillus anthracis str} Length = 281 Back     alignment and structure
>3bdi_A Uncharacterized protein TA0194; NP_393672.1, predicted CIB-like hydrolase, structural genomi center for structural genomics; HET: MSE; 1.45A {Thermoplasma acidophilum dsm 1728} Length = 207 Back     alignment and structure
>1iup_A META-cleavage product hydrolase; aromatic compounds, cumene, isopropylbenzene, META-cleavage compound hydrolase; 1.60A {Pseudomonas fluorescens} SCOP: c.69.1.10 PDB: 1iun_A 1iuo_A 1uk6_A 1uk7_A 1uk8_A 1uk9_A 1uka_A 1ukb_A 2d0d_A Length = 282 Back     alignment and structure
>3fnb_A Acylaminoacyl peptidase SMU_737; alpha-beta-alpha sandwich, helix bundle, structural genomics protein structure initiative; HET: PGE; 2.12A {Streptococcus mutans} Length = 405 Back     alignment and structure
>1q0r_A RDMC, aclacinomycin methylesterase; anthracycline, hydrolase, polyketide, tailoring enzyme, structural proteomics in europe, spine; HET: AKT 1PE; 1.45A {Streptomyces purpurascens} SCOP: c.69.1.28 PDB: 1q0z_A* Length = 298 Back     alignment and structure
>3ia2_A Arylesterase; alpha-beta hydrolase fold, transition state analog, hydrolas oxidoreductase, peroxidase; 1.65A {Pseudomonas fluorescens} PDB: 1va4_A 3hi4_A 3hea_A Length = 271 Back     alignment and structure
>3ksr_A Putative serine hydrolase; catalytic triad, structural genomics, JOIN for structural genomics, JCSG; 2.69A {Xanthomonas campestris PV} Length = 290 Back     alignment and structure
>3mve_A FRSA, UPF0255 protein VV1_0328; FRSA,fermentation/respiration switch protein, hydrolase ACTI lyase; 2.20A {Vibrio vulnificus} PDB: 3our_A Length = 415 Back     alignment and structure
>1a8q_A Bromoperoxidase A1; haloperoxidase, oxidoreductase; 1.75A {Streptomyces aureofaciens} SCOP: c.69.1.12 Length = 274 Back     alignment and structure
>2wue_A 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrolase BPHD; HET: KEK; 1.80A {Mycobacterium tuberculosis} PDB: 2wud_A* 2wuf_A* 2wug_A* 2vf2_A Length = 291 Back     alignment and structure
>3hss_A Putative bromoperoxidase; alpha beta hydrolase, oxidoreductase, hydrolase; 1.90A {Mycobacterium tuberculosis} PDB: 3e3a_A 3hys_A 3hzo_A Length = 293 Back     alignment and structure
>1j1i_A META cleavage compound hydrolase; carbazole degradation, META cleavage product hydrolase, histidine tagged protein, alpha/beta-hydrolase; 1.86A {Janthinobacterium} SCOP: c.69.1.10 Length = 296 Back     alignment and structure
>3fcy_A Xylan esterase 1; alpha/beta hydrolase, carbohydrate esterase, CE7; 2.10A {Thermoanaerobacterium SP} Length = 346 Back     alignment and structure
>4f0j_A Probable hydrolytic enzyme; alpha/beta hydrolase fold, structural genomics, joint center structural genomics, JCSG; HET: MSE; 1.50A {Pseudomonas aeruginosa} Length = 315 Back     alignment and structure
>3e0x_A Lipase-esterase related protein; APC60309, clostridium acetobutylicum ATCC 824, structural genomics, PSI-2; HET: MSE; 1.45A {Clostridium acetobutylicum} Length = 245 Back     alignment and structure
>3r0v_A Alpha/beta hydrolase fold protein; structural genomics, PSI-biology, protein structure initiati alpha/beta hydrolase; HET: MSE; 1.38A {Sphaerobacter thermophilus} Length = 262 Back     alignment and structure
>3kxp_A Alpha-(N-acetylaminomethylene)succinic acid hydrolase; alpha/beta hydrolase, PLP degradation, E-2- (acetamidomethylene)succinate; 2.26A {Mesorhizobium loti} Length = 314 Back     alignment and structure
>1m33_A BIOH protein; alpha-betta-alpha sandwich, structural genomics, PSI, protei structure initiative; HET: MSE 3OH; 1.70A {Escherichia coli} SCOP: c.69.1.26 Length = 258 Back     alignment and structure
>1a8s_A Chloroperoxidase F; haloperoxidase, oxidoreductase, propionate complex; 1.80A {Pseudomonas fluorescens} SCOP: c.69.1.12 Length = 273 Back     alignment and structure
>3vdx_A Designed 16NM tetrahedral protein CAGE containing bromoperoxidase BPO-A2 and matrix...; protein design, bionanotechnology; 3.00A {Streptomyces aureofaciens} PDB: 4d9j_A Length = 456 Back     alignment and structure
>3oos_A Alpha/beta hydrolase family protein; APC67239.0, protein structure initiative, PSI-2, structural midwest center for structural genomics, MCSG; HET: MSE PG4; 1.65A {Bacillus anthracis} Length = 278 Back     alignment and structure
>1c4x_A BPHD, protein (2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoat hydrolase); PCB degradation; 2.40A {Rhodococcus SP} SCOP: c.69.1.10 Length = 285 Back     alignment and structure
>1hkh_A Gamma lactamase; hydrolase, alpha/beta hydrolase, CO-factor free haloperoxidase,; 1.73A {Microbacterium} SCOP: c.69.1.12 PDB: 1hl7_A* Length = 279 Back     alignment and structure
>3k2i_A Acyl-coenzyme A thioesterase 4; alpha/beta hydrolase fold seven-stranded beta-sandwich, structural genomics, structural genomics consortium, SGC; 2.40A {Homo sapiens} Length = 422 Back     alignment and structure
>3hlk_A Acyl-coenzyme A thioesterase 2, mitochondrial; alpha/beta hydrolase, alternative splicing, hydrolase, mitochondrion, polymorphism, serine esterase; 2.10A {Homo sapiens} Length = 446 Back     alignment and structure
>1ufo_A Hypothetical protein TT1662; alpha-beta fold, hydrolase, structural genomics, riken structural genomics/proteomics initiative, RSGI; 1.60A {Thermus thermophilus} SCOP: c.69.1.27 Length = 238 Back     alignment and structure
>3qit_A CURM TE, polyketide synthase; thioesterase, alpha/beta hydrolase, decarboxylase, sulfate elimination, terminal alkene production; 1.68A {Lyngbya majuscula 19L} Length = 286 Back     alignment and structure
>1zoi_A Esterase; alpha/beta hydrolase fold; 1.60A {Pseudomonas putida} PDB: 4dgq_A Length = 276 Back     alignment and structure
>1brt_A Bromoperoxidase A2; haloperoxidase, oxidoreductase, alpha/beta hydrolase fold, mutant M99T; 1.50A {Streptomyces aureofaciens} SCOP: c.69.1.12 PDB: 1bro_A 1a8u_A 1a7u_A Length = 277 Back     alignment and structure
>1imj_A CIB, CCG1-interacting factor B; alpha/beta hydrolase, CCG1 interactor; 2.20A {Homo sapiens} SCOP: c.69.1.23 Length = 210 Back     alignment and structure
>3v48_A Aminohydrolase, putative aminoacrylate hydrolase RUTD; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.10A {Escherichia coli SE11} Length = 268 Back     alignment and structure
>2xt0_A Haloalkane dehalogenase; hydrolase, alpha-beta hydrolase fold; 1.90A {Plesiocystis pacifica} Length = 297 Back     alignment and structure
>3nwo_A PIP, proline iminopeptidase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, mycobac smegmatis; 1.90A {Mycobacterium smegmatis} Length = 330 Back     alignment and structure
>3bwx_A Alpha/beta hydrolase; YP_496220.1, joint center for structural genomics, protein structure initiative, PSI-2; HET: MSE; 1.50A {Novosphingobium aromaticivorans} Length = 285 Back     alignment and structure
>4ezi_A Uncharacterized protein; alpha-beta hydrolases fold, structural genomics, joint cente structural genomics, JCSG; HET: MSE; 1.15A {Legionella pneumophila subsp} Length = 377 Back     alignment and structure
>1a88_A Chloroperoxidase L; haloperoxidase, oxidoreductase; 1.90A {Streptomyces lividans} SCOP: c.69.1.12 Length = 275 Back     alignment and structure
>2r11_A Carboxylesterase NP; 2632844, putative hydrolase, structural genomics, joint center for structural genomics, JCSG; HET: MSE PGE; 1.96A {Bacillus subtilis} Length = 306 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3l80_A Putative uncharacterized protein SMU.1393C; alpha/beta hydrolase fold, carboxylesterase, Ser- hydrolase; 2.00A {Streptococcus mutans} Length = 292 Back     alignment and structure
>2qjw_A Uncharacterized protein XCC1541; putative hydrolase of the alpha/beta superfamily, structural genomics; HET: MSE TLA P6G; 1.35A {Xanthomonas campestris PV} Length = 176 Back     alignment and structure
>3c5v_A PME-1, protein phosphatase methylesterase 1; demethylase, PP2A, alternative splicing, hydrolase, phosphoprotein, serine esterase; 2.00A {Homo sapiens} PDB: 3c5w_P Length = 316 Back     alignment and structure
>3qvm_A OLEI00960; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta hydrolase fold, hydrolase; 2.00A {Oleispira antarctica} Length = 282 Back     alignment and structure
>2yys_A Proline iminopeptidase-related protein; TTHA1809, structural genomics, unknown function; 2.20A {Thermus thermophilus} Length = 286 Back     alignment and structure
>2xua_A PCAD, 3-oxoadipate ENOL-lactonase; hydrolase, catechol metabolism; 1.90A {Burkholderia xenovorans} Length = 266 Back     alignment and structure
>2y6u_A Peroxisomal membrane protein LPX1; hydrolase, putative esterase, putative lipase; HET: CME CSO; 1.90A {Saccharomyces cerevisiae} PDB: 2y6v_A* Length = 398 Back     alignment and structure
>1r3d_A Conserved hypothetical protein VC1974; structural genomics, hydrolase, NYSGXRC, NEW YORK SGX research center for structural genomics, PSI; 1.90A {Vibrio cholerae} SCOP: c.69.1.35 Length = 264 Back     alignment and structure
>2o2g_A Dienelactone hydrolase; YP_324580.1, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.92A {Anabaena variabilis} Length = 223 Back     alignment and structure
>3guu_A Lipase A; protein structure, hydrolase; HET: 1PE; 2.10A {Candida antarctica} PDB: 2veo_A* Length = 462 Back     alignment and structure
>1l7a_A Cephalosporin C deacetylase; structural genomics, alpha-beta-alpha sandwich, PSI, protein structure initiative; 1.50A {Bacillus subtilis} SCOP: c.69.1.25 PDB: 1odt_C 1ods_A 3fvt_A 3fvr_A 3fyu_A* 2xlb_A 2xlc_A 3fyt_A* 3fyu_B* Length = 318 Back     alignment and structure
>3h04_A Uncharacterized protein; protein with unknown function, structural genomics, MCSG, PS protein structure initiative; 1.90A {Staphylococcus aureus subsp} Length = 275 Back     alignment and structure
>1xkl_A SABP2, salicylic acid-binding protein 2; alpha-beta protein, structural genomics, protein structure initiative, PSI; HET: STH; 2.00A {Nicotiana tabacum} SCOP: c.69.1.20 PDB: 1y7i_A* 1y7h_A* Length = 273 Back     alignment and structure
>3h2g_A Esterase; xanthomonas oryzae PV. oryzae, cell WALL degrading enzyme, RICE, virulence, innate immune responses, pathogenesis; 1.86A {Xanthomonas oryzae PV} PDB: 3h2j_A 3h2k_A* 3h2h_A 3h2i_A Length = 397 Back     alignment and structure
>1wom_A RSBQ, sigma factor SIGB regulation protein RSBQ; alpha/beta hydrolase, signaling protein; 2.50A {Bacillus subtilis} PDB: 1wpr_A* Length = 271 Back     alignment and structure
>3sty_A Methylketone synthase 1; alpha/beta hydrolase, decarboxylase, hydrolase; HET: DKA; 1.70A {Lycopersicon hirsutum F} PDB: 3stu_A* 3stt_A* 3stv_A* 3stw_A* 3stx_A* Length = 267 Back     alignment and structure
>3om8_A Probable hydrolase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MES; 2.25A {Pseudomonas aeruginosa} Length = 266 Back     alignment and structure
>2i3d_A AGR_C_3351P, hypothetical protein ATU1826; structural genomics, APC5865, hydrolase, PSI-2, protein STRU initiative; HET: MSE; 1.50A {Agrobacterium tumefaciens str} SCOP: c.69.1.36 Length = 249 Back     alignment and structure
>4ao6_A Esterase; hydrolase, thermo label; 1.60A {Unidentified} PDB: 4ao7_A 4ao8_A Length = 259 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query308
3hju_A342 Monoglyceride lipase; alpha/beta hydrolase, hydrol 100.0
3om8_A266 Probable hydrolase; structural genomics, PSI-2, pr 100.0
3pe6_A303 Monoglyceride lipase; alpha-beta hydrolase fold, 2 100.0
1b6g_A310 Haloalkane dehalogenase; hydrolase, alpha/beta-hyd 100.0
2xt0_A297 Haloalkane dehalogenase; hydrolase, alpha-beta hyd 100.0
1zoi_A276 Esterase; alpha/beta hydrolase fold; 1.60A {Pseudo 100.0
4fbl_A281 LIPS lipolytic enzyme; thermostable, structural ge 100.0
3v48_A268 Aminohydrolase, putative aminoacrylate hydrolase R 100.0
2xua_A266 PCAD, 3-oxoadipate ENOL-lactonase; hydrolase, cate 100.0
2wue_A291 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrolas 100.0
3ia2_A271 Arylesterase; alpha-beta hydrolase fold, transitio 100.0
1a88_A275 Chloroperoxidase L; haloperoxidase, oxidoreductase 100.0
1a8q_A274 Bromoperoxidase A1; haloperoxidase, oxidoreductase 100.0
3fob_A281 Bromoperoxidase; structural genomics, IDP00046, ba 100.0
2yys_A286 Proline iminopeptidase-related protein; TTHA1809, 100.0
3bf7_A255 Esterase YBFF; thioesterase, helical CAP, hydrolas 100.0
1a8s_A273 Chloroperoxidase F; haloperoxidase, oxidoreductase 100.0
3afi_E316 Haloalkane dehalogenase; A/B-hydrolase, hydrolase; 100.0
1q0r_A298 RDMC, aclacinomycin methylesterase; anthracycline, 100.0
1ehy_A294 Protein (soluble epoxide hydrolase); alpha/beta hy 100.0
1brt_A277 Bromoperoxidase A2; haloperoxidase, oxidoreductase 100.0
1iup_A282 META-cleavage product hydrolase; aromatic compound 100.0
2ocg_A254 Valacyclovir hydrolase; alpha beta hydrolase fold; 100.0
2puj_A286 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrola; 100.0
3nwo_A330 PIP, proline iminopeptidase; structural genomics, 100.0
1tht_A305 Thioesterase; 2.10A {Vibrio harveyi} SCOP: c.69.1. 100.0
2wtm_A251 EST1E; hydrolase; 1.60A {Clostridium proteoclastic 100.0
3g9x_A299 Haloalkane dehalogenase; alpha/beta hydrolase, hel 100.0
3qit_A286 CURM TE, polyketide synthase; thioesterase, alpha/ 100.0
1c4x_A285 BPHD, protein (2-hydroxy-6-OXO-6-phenylhexa-2,4-di 100.0
3bwx_A285 Alpha/beta hydrolase; YP_496220.1, joint center fo 100.0
2cjp_A328 Epoxide hydrolase; HET: PG4 VPR; 1.95A {Solanum tu 100.0
1hkh_A279 Gamma lactamase; hydrolase, alpha/beta hydrolase, 100.0
2wfl_A264 Polyneuridine-aldehyde esterase; alkaloid metaboli 100.0
3u1t_A309 DMMA haloalkane dehalogenase; alpha/beta-hydrolase 100.0
2wj6_A276 1H-3-hydroxy-4-oxoquinaldine 2,4-dioxygenase; oxid 100.0
1tqh_A247 Carboxylesterase precursor; tetrahedral intermedia 100.0
1mtz_A293 Proline iminopeptidase; alpha-beta hydrolase, CAP 100.0
1j1i_A296 META cleavage compound hydrolase; carbazole degrad 100.0
3pfb_A270 Cinnamoyl esterase; alpha/beta hydrolase fold, hyd 100.0
1u2e_A289 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase 100.0
2xmz_A269 Hydrolase, alpha/beta hydrolase fold family; menaq 100.0
1xkl_A273 SABP2, salicylic acid-binding protein 2; alpha-bet 100.0
3r0v_A262 Alpha/beta hydrolase fold protein; structural geno 100.0
3oos_A278 Alpha/beta hydrolase family protein; APC67239.0, p 100.0
4f0j_A315 Probable hydrolytic enzyme; alpha/beta hydrolase f 100.0
3kda_A301 CFTR inhibitory factor (CIF); alpha/beta hydrolase 100.0
3c6x_A257 Hydroxynitrilase; atomic resolution, hydroxynitril 100.0
3ibt_A264 1H-3-hydroxy-4-oxoquinoline 2,4-dioxygenase; QDO, 100.0
3sty_A267 Methylketone synthase 1; alpha/beta hydrolase, dec 100.0
3rm3_A270 MGLP, thermostable monoacylglycerol lipase; alpha/ 100.0
3vdx_A 456 Designed 16NM tetrahedral protein CAGE containing 100.0
3fsg_A272 Alpha/beta superfamily hydrolase; PF00561, MCSG, P 100.0
2psd_A318 Renilla-luciferin 2-monooxygenase; alpha/beta-hydr 100.0
3dqz_A258 Alpha-hydroxynitrIle lyase-like protein; A/B-hydrl 100.0
3llc_A270 Putative hydrolase; structural genomics, joint cen 100.0
3r40_A306 Fluoroacetate dehalogenase; FACD, defluorinase, al 100.0
2y6u_A398 Peroxisomal membrane protein LPX1; hydrolase, puta 100.0
1wom_A271 RSBQ, sigma factor SIGB regulation protein RSBQ; a 100.0
2qmq_A286 Protein NDRG2, protein NDR2; alpha/beta-hydrolases 100.0
3i28_A555 Epoxide hydrolase 2; aromatic hydrocarbons catabol 100.0
3kxp_A314 Alpha-(N-acetylaminomethylene)succinic acid hydrol 100.0
1k8q_A377 Triacylglycerol lipase, gastric; APHA beta hydrola 100.0
1m33_A258 BIOH protein; alpha-betta-alpha sandwich, structur 100.0
2qvb_A297 Haloalkane dehalogenase 3; RV2579, alpha-beta hydr 100.0
3i1i_A377 Homoserine O-acetyltransferase; structural genomic 100.0
3p2m_A330 Possible hydrolase; alpha/beta hydrolase superfami 100.0
2e3j_A356 Epoxide hydrolase EPHB; epoxide hydrolase B, struc 100.0
1mj5_A302 1,3,4,6-tetrachloro-1,4-cyclohexadiene hydrolase; 100.0
3hss_A293 Putative bromoperoxidase; alpha beta hydrolase, ox 100.0
2pl5_A366 Homoserine O-acetyltransferase; alpha/beta hydrola 100.0
2r11_A306 Carboxylesterase NP; 2632844, putative hydrolase, 100.0
4g9e_A279 AHL-lactonase, alpha/beta hydrolase fold protein; 100.0
3bdi_A207 Uncharacterized protein TA0194; NP_393672.1, predi 99.98
1imj_A210 CIB, CCG1-interacting factor B; alpha/beta hydrola 99.98
3dkr_A251 Esterase D; alpha beta hydrolase, mechanism, catal 99.98
4dnp_A269 DAD2; alpha/beta hydrolase, hydrolase; 2.15A {Petu 99.98
1wm1_A317 Proline iminopeptidase; complex with inhibitor, hy 99.98
3trd_A208 Alpha/beta hydrolase; cellular processes; 1.50A {C 99.98
3e0x_A245 Lipase-esterase related protein; APC60309, clostri 99.98
3ksr_A290 Putative serine hydrolase; catalytic triad, struct 99.97
2i3d_A249 AGR_C_3351P, hypothetical protein ATU1826; structu 99.97
1azw_A313 Proline iminopeptidase; aminopeptidase, serine pro 99.97
1r3d_A264 Conserved hypothetical protein VC1974; structural 99.97
2vat_A444 Acetyl-COA--deacetylcephalosporin C acetyltransfer 99.97
3qvm_A282 OLEI00960; structural genomics, PSI-biology, midwe 99.97
3b12_A304 Fluoroacetate dehalogenase; dehalogease, hydrolase 99.95
2b61_A377 Homoserine O-acetyltransferase; acyl-enzyme, aspar 99.97
3qyj_A291 ALR0039 protein; alpha/beta fold, hydrolase; 1.78A 99.97
2fuk_A220 XC6422 protein; A/B hydrolase, structural genomics 99.97
1pja_A302 Palmitoyl-protein thioesterase 2 precursor; hydrol 99.97
2o2g_A223 Dienelactone hydrolase; YP_324580.1, structural ge 99.97
3c5v_A316 PME-1, protein phosphatase methylesterase 1; demet 99.97
1zi8_A236 Carboxymethylenebutenolidase; alpha and beta prote 99.97
3h04_A275 Uncharacterized protein; protein with unknown func 99.97
4i19_A388 Epoxide hydrolase; structural genomics, PSI-biolog 99.97
1ufo_A238 Hypothetical protein TT1662; alpha-beta fold, hydr 99.96
3fla_A267 RIFR; alpha-beta hydrolase thioesterase, hydrolase 99.96
3fcy_A346 Xylan esterase 1; alpha/beta hydrolase, carbohydra 99.96
3f67_A241 Putative dienelactone hydrolase; alpha-beta-alpha 99.96
3l80_A292 Putative uncharacterized protein SMU.1393C; alpha/ 99.96
2hdw_A367 Hypothetical protein PA2218; alpha/beta hydrolase 99.96
2rau_A354 Putative esterase; NP_343859.1, putative lipase, s 99.96
2jbw_A386 Dhpon-hydrolase, 2,6-dihydroxy-pseudo-oxynicotine 99.96
2qjw_A176 Uncharacterized protein XCC1541; putative hydrolas 99.96
2pbl_A262 Putative esterase/lipase/thioesterase; alpha/beta- 99.96
1jfr_A262 Lipase; serine hydrolase; 1.90A {Streptomyces exfo 99.96
2q0x_A335 Protein DUF1749, uncharacterized protein; alpha/be 99.96
3fnb_A405 Acylaminoacyl peptidase SMU_737; alpha-beta-alpha 99.96
3bjr_A283 Putative carboxylesterase; structural genomics, jo 99.95
3bxp_A277 Putative lipase/esterase; putative carboxylesteras 99.95
3qmv_A280 Thioesterase, REDJ; alpha/beta hydrolase fold, hyd 99.95
3hxk_A276 Sugar hydrolase; alpha-beta protein., structural g 99.95
4ao6_A259 Esterase; hydrolase, thermo label; 1.60A {Unidenti 99.95
3g02_A408 Epoxide hydrolase; alpha/beta hydrolase fold, enan 99.95
1qlw_A328 Esterase; anisotropic refinement, atomic resolutio 99.95
1l7a_A318 Cephalosporin C deacetylase; structural genomics, 99.95
1fj2_A232 Protein (acyl protein thioesterase 1); alpha/beta 99.95
1isp_A181 Lipase; alpha/beta hydrolase fold, hydrolase; 1.30 99.95
3vis_A306 Esterase; alpha/beta-hydrolase fold, polyethylene 99.95
3o4h_A582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 99.94
2h1i_A226 Carboxylesterase; structural genomics, PSI-2, prot 99.94
1uxo_A192 YDEN protein; hydrolase, A/B hydrolase, esterase, 99.94
1vlq_A337 Acetyl xylan esterase; TM0077, structural genomics 99.94
2qs9_A194 Retinoblastoma-binding protein 9; B5T overexpresse 99.94
1auo_A218 Carboxylesterase; hydrolase; 1.80A {Pseudomonas fl 99.94
3cn9_A226 Carboxylesterase; alpha/beta hydrolase fold super- 99.94
2r8b_A251 AGR_C_4453P, uncharacterized protein ATU2452; APC6 99.94
4fle_A202 Esterase; structural genomics, PSI-biology, northe 99.94
3mve_A415 FRSA, UPF0255 protein VV1_0328; FRSA,fermentation/ 99.94
2z3z_A706 Dipeptidyl aminopeptidase IV; peptidase family S9, 99.94
2ecf_A741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 99.93
3og9_A209 Protein YAHD A copper inducible hydrolase; alpha/b 99.93
1vkh_A273 Putative serine hydrolase; structural genomics, jo 99.93
3bdv_A191 Uncharacterized protein DUF1234; DUF1234 family pr 99.93
2c7b_A311 Carboxylesterase, ESTE1; carboxyesterase, thermoph 99.93
3k2i_A422 Acyl-coenzyme A thioesterase 4; alpha/beta hydrola 99.93
3azo_A662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 99.93
1jkm_A361 Brefeldin A esterase; serine hydrolase, degradatio 99.93
3ils_A265 PKS, aflatoxin biosynthesis polyketide synthase; A 99.93
3b5e_A223 MLL8374 protein; NP_108484.1, carboxylesterase, st 99.93
4h0c_A210 Phospholipase/carboxylesterase; PSI-biology, midwe 99.92
2o7r_A338 CXE carboxylesterase; alpha/beta hydrolase; 1.40A 99.92
2k2q_B242 Surfactin synthetase thioesterase subunit; A/B-hyd 99.92
2hm7_A310 Carboxylesterase; alpha/beta hydrolase fold, hydro 99.92
3hlk_A446 Acyl-coenzyme A thioesterase 2, mitochondrial; alp 99.92
2fx5_A258 Lipase; alpha-beta hydrolase; HET: TLA; 1.80A {Pse 99.92
3lcr_A319 Tautomycetin biosynthetic PKS; alpha-beta hydrolas 99.92
2wir_A313 Pesta, alpha/beta hydrolase fold-3 domain protein; 99.92
2zsh_A351 Probable gibberellin receptor GID1L1; plant hormon 99.92
1xfd_A723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 99.92
1lzl_A323 Heroin esterase; alpha/beta hydrolase; 1.30A {Rhod 99.92
3ain_A323 303AA long hypothetical esterase; carboxylesterase 99.92
4e15_A303 Kynurenine formamidase; alpha/beta hydrolase fold, 99.92
3u0v_A239 Lysophospholipase-like protein 1; alpha, beta hydr 99.92
2bkl_A695 Prolyl endopeptidase; mechanistic study, celiac sp 99.92
1z68_A719 Fibroblast activation protein, alpha subunit; sepr 99.91
4a5s_A740 Dipeptidyl peptidase 4 soluble form; hydrolase, ty 99.91
1jji_A311 Carboxylesterase; alpha-beta hydrolase fold, hydro 99.91
2xdw_A710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 99.91
4hvt_A711 Ritya.17583.B, post-proline cleaving enzyme; ssgci 99.91
1yr2_A741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 99.91
3ga7_A326 Acetyl esterase; phosphoserine, IDP00896, hydrolas 99.91
3e4d_A278 Esterase D; S-formylglutathione hydrolase, hydrola 99.9
2qru_A274 Uncharacterized protein; alpha/beta-hydrolase, str 99.9
3iuj_A693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 99.9
3d0k_A304 Putative poly(3-hydroxybutyrate) depolymerase LPQ; 99.9
1kez_A300 Erythronolide synthase; polyketide synthase, modul 99.9
3lp5_A250 Putative cell surface hydrolase; structural genom 99.9
3qh4_A317 Esterase LIPW; structural genomics, ssgcid, seattl 99.89
3fcx_A282 FGH, esterase D, S-formylglutathione hydrolase; re 99.89
4fhz_A285 Phospholipase/carboxylesterase; alpha/beta hydrola 99.89
3fak_A322 Esterase/lipase, ESTE5; HSL, hydrolase; 1.90A {Unc 99.89
2xe4_A751 Oligopeptidase B; hydrolase-inhibitor complex, hyd 99.89
2uz0_A263 Esterase, tributyrin esterase; alpha/beta hydrolas 99.89
3i6y_A280 Esterase APC40077; lipase, structural genomics, PS 99.89
3fle_A249 SE_1780 protein; structural genomics, APC61035.1, 99.89
3d7r_A326 Esterase; alpha/beta fold, hydrolase; 2.01A {Staph 99.89
3k6k_A322 Esterase/lipase; alpha/beta hydrolase fold; 2.20A 99.88
3doh_A380 Esterase; alpha-beta hydrolase, beta sheet; 2.60A 99.88
3ebl_A365 Gibberellin receptor GID1; alpha/beta hydrolase, l 99.88
1ycd_A243 Hypothetical 27.3 kDa protein in AAP1-SMF2 interge 99.87
1lns_A 763 X-prolyl dipeptidyl aminopetidase; alpha beta hydr 99.87
3ls2_A280 S-formylglutathione hydrolase; psychrophilic organ 99.87
3h2g_A397 Esterase; xanthomonas oryzae PV. oryzae, cell WALL 99.86
3ds8_A254 LIN2722 protein; unkonwn function, structural geno 99.86
3g8y_A391 SUSD/RAGB-associated esterase-like protein; struct 99.86
1ei9_A279 Palmitoyl protein thioesterase 1; alpha/beta hydro 99.85
4b6g_A283 Putative esterase; hydrolase, formaldehyde detoxif 99.85
3tej_A329 Enterobactin synthase component F; nonribosomal pe 99.85
3d59_A383 Platelet-activating factor acetylhydrolase; secret 99.85
1jjf_A268 Xylanase Z, endo-1,4-beta-xylanase Z, 1,4-beta-D-x 99.84
1mpx_A 615 Alpha-amino acid ester hydrolase; alpha/beta hydro 99.84
4f21_A246 Carboxylesterase/phospholipase family protein; str 99.84
1tca_A317 Lipase; hydrolase(carboxylic esterase); HET: NAG; 99.84
3i2k_A 587 Cocaine esterase; alpha/beta hydrolase, hydrolase; 99.84
3nuz_A398 Putative acetyl xylan esterase; structural genomic 99.83
4ezi_A377 Uncharacterized protein; alpha-beta hydrolases fol 99.83
2hfk_A319 Pikromycin, type I polyketide synthase pikaiv; alp 99.83
1jmk_C230 SRFTE, surfactin synthetase; thioesterase, non-rib 99.82
1gpl_A 432 RP2 lipase; serine esterase, hydrolase, lipid degr 99.81
2cb9_A244 Fengycin synthetase; thioesterase, non-ribosomal p 99.81
3tjm_A283 Fatty acid synthase; thioesterase domain, fatty ac 99.8
3iii_A 560 COCE/NOND family hydrolase; structural genomics, c 99.8
2b9v_A 652 Alpha-amino acid ester hydrolase; catalytic triad, 99.8
1r88_A280 MPT51/MPB51 antigen; ALFA/beta hydrolase fold, FBP 99.77
3icv_A316 Lipase B, CALB; circular permutation, cleavage on 99.77
1ys1_X320 Lipase; CIS peptide Leu 234, Ca2+ ION, inhibitor h 99.76
1bu8_A 452 Protein (pancreatic lipase related protein 2); hyd 99.76
1sfr_A304 Antigen 85-A; alpha/beta hydrolase, structural gen 99.75
1w52_X 452 Pancreatic lipase related protein 2; detergent, cl 99.75
1hpl_A 449 Lipase; hydrolase(carboxylic esterase); 2.30A {Equ 99.73
1ex9_A285 Lactonizing lipase; alpha-beta hydrolase fold, pho 99.72
2x5x_A342 PHB depolymerase PHAZ7; biopolymers, oxyanion HOLE 99.71
1dqz_A280 85C, protein (antigen 85-C); fibronectin, structur 99.71
1rp1_A 450 Pancreatic lipase related protein 1; hydrolase, li 99.7
3n2z_B 446 Lysosomal Pro-X carboxypeptidase; alpha/beta hydro 99.69
1gkl_A297 Endo-1,4-beta-xylanase Y; hydrolase, esterase fami 99.69
2zyr_A 484 Lipase, putative; fatty acid, hydrolase; HET: 1PE; 99.68
2dst_A131 Hypothetical protein TTHA1544; conserved hypotheti 99.67
3guu_A462 Lipase A; protein structure, hydrolase; HET: 1PE; 99.65
2qm0_A275 BES; alpha-beta structure, structural genomics, PS 99.65
2hih_A431 Lipase 46 kDa form; A1 phospholipase, phospholipid 99.64
3c8d_A403 Enterochelin esterase; alpha-beta-alpha sandwich, 99.56
2dsn_A387 Thermostable lipase; T1 lipase, hydrolase; 1.50A { 99.54
2px6_A316 Thioesterase domain; thioesaterse domain, orlistat 99.45
2gzs_A278 IROE protein; enterobactin, salmochelin, DFP, hydr 99.4
3gff_A331 IROE-like serine hydrolase; NP_718593.1, structura 99.27
4fol_A299 FGH, S-formylglutathione hydrolase; D-type esteras 99.23
2ogt_A 498 Thermostable carboxylesterase EST50; alpha/beta hy 99.22
1qe3_A 489 PNB esterase, para-nitrobenzyl esterase; alpha-bet 99.19
2d81_A 318 PHB depolymerase; alpha/beta hydrolase fold, circu 99.16
1p0i_A 529 Cholinesterase; serine hydrolase, butyrate, hydrol 99.01
1ea5_A 537 ACHE, acetylcholinesterase; hydrolase, serine hydr 98.99
2ha2_A 543 ACHE, acetylcholinesterase; hydrolase fold, serine 98.98
4g4g_A433 4-O-methyl-glucuronoyl methylesterase; alpha/beta 98.97
3pic_A375 CIP2; alpha/beta hydrolase fold, glucuronoyl ester 98.96
1ivy_A 452 Human protective protein; carboxypeptidase, serine 98.96
2h7c_A 542 Liver carboxylesterase 1; enzyme, cholesteryl este 98.89
1whs_A255 Serine carboxypeptidase II; HET: NAG FUC; 2.00A {T 98.84
2fj0_A 551 JuvenIle hormone esterase; manduca sexta, alpha-be 98.82
1ukc_A 522 ESTA, esterase; fungi, A/B hydrolase fold, acetylc 98.82
1thg_A 544 Lipase; hydrolase(carboxylic esterase); HET: NAG N 98.74
1llf_A 534 Lipase 3; candida cylindracea cholesterol esterase 98.72
2vsq_A1304 Surfactin synthetase subunit 3; ligase, peptidyl c 98.68
3bix_A 574 Neuroligin-1, neuroligin I; esterase domain, alpha 98.65
1dx4_A 585 ACHE, acetylcholinesterase; hydrolase, serine este 98.65
4ebb_A 472 Dipeptidyl peptidase 2; hydrolase; HET: MSE NAG; 2 98.64
1tib_A269 Lipase; hydrolase(carboxylic esterase); 1.84A {The 98.62
2bce_A 579 Cholesterol esterase; hydrolase, serine esterase, 98.55
4az3_A300 Lysosomal protective protein 32 kDa chain; hydrola 98.52
1cpy_A 421 Serine carboxypeptidase; hydrolase (carboxypeptida 98.47
1ac5_A 483 KEX1(delta)P; carboxypeptidase, hydrolase, glycopr 98.28
1tia_A279 Lipase; hydrolase(carboxylic esterase); 2.10A {Pen 98.28
2vz8_A2512 Fatty acid synthase; transferase, phosphopantethei 98.21
1gxs_A270 P-(S)-hydroxymandelonitrIle lyase chain A; inhibit 98.18
1tgl_A269 Triacyl-glycerol acylhydrolase; carboxylic esteras 97.99
1lgy_A269 Lipase, triacylglycerol lipase; hydrolase (carboxy 97.93
3hc7_A254 Gene 12 protein, GP12; alpha/beta sandwich, cell a 97.82
3qpa_A197 Cutinase; alpha-beta hydrolase fold, esterase, hyd 97.71
3dcn_A201 Cutinase, cutin hydrolase; catalytic triad, secret 97.4
1g66_A207 Acetyl xylan esterase II; serine hydrolase, acetyl 97.36
3qpd_A187 Cutinase 1; alpha-beta hydrolase fold, esterase, h 97.31
1whs_B153 Serine carboxypeptidase II; HET: NAG FUC; 2.00A {T 97.3
1qoz_A207 AXE, acetyl xylan esterase; hydrolase, xylan degra 97.24
3aja_A302 Putative uncharacterized protein; alpha-beta hydro 97.24
1uwc_A261 Feruloyl esterase A; hydrolase, serine esterase, x 97.24
2czq_A205 Cutinase-like protein; alpha/beta hydrolase fold, 97.15
3g7n_A258 Lipase; hydrolase fold, hydrolase; HET: 1PE; 1.30A 96.98
3uue_A279 LIP1, secretory lipase (family 3); LID-domain, hyd 96.97
3ngm_A319 Extracellular lipase; secret lipase, hydrolase; 2. 96.85
3o0d_A301 YALI0A20350P, triacylglycerol lipase; alpha/beta-h 96.57
4az3_B155 Lysosomal protective protein 20 kDa chain; hydrola 96.56
1gxs_B158 P-(S)-hydroxymandelonitrIle lyase chain B; inhibit 95.44
2ory_A346 Lipase; alpha/beta hydrolase, hydrolase; 2.20A {Ph 94.7
1ac5_A483 KEX1(delta)P; carboxypeptidase, hydrolase, glycopr 93.67
1cpy_A421 Serine carboxypeptidase; hydrolase (carboxypeptida 92.81
2yij_A419 Phospholipase A1-iigamma; hydrolase; 2.00A {Arabid 91.83
1ivy_A452 Human protective protein; carboxypeptidase, serine 91.5
>3hju_A Monoglyceride lipase; alpha/beta hydrolase, hydrolase, serine esterase; 2.20A {Homo sapiens} Back     alignment and structure
Probab=100.00  E-value=1.7e-36  Score=243.77  Aligned_cols=269  Identities=25%  Similarity=0.376  Sum_probs=206.2

Q ss_pred             ccccccce-eEEcCCCcEEEEEEecCCCCCCCcceEEEEccCCCccchHHHHHHHHHHHcCCeEEEecCCCCcCCCCccc
Q 035721           27 HSVSHSSE-YITNSRGLRLFTQWWTPLPPAKTLGVLCVVHGFTGESSWIVQLTAVLFAKSGFATCAIDHQGHGFSDGLVA  105 (308)
Q Consensus        27 ~~~~~~~~-~~~~~~g~~l~~~~~~~~~~~~~~~~vv~~hG~~~~~~~~~~~~~~~l~~~g~~v~~~d~~G~G~s~~~~~  105 (308)
                      .++++++. .+.+.||.+|.|..+.+.+  .++|+|||+||++++.. .|..+++.|.++||+|+++|+||+|.|.....
T Consensus        30 ~~~~~~~~~~~~~~dg~~l~~~~~~p~~--~~~p~vv~~HG~~~~~~-~~~~~~~~l~~~g~~vi~~D~~G~G~S~~~~~  106 (342)
T 3hju_A           30 QSIPYQDLPHLVNADGQYLFCRYWKPTG--TPKALIFVSHGAGEHSG-RYEELARMLMGLDLLVFAHDHVGHGQSEGERM  106 (342)
T ss_dssp             TSCBTTSSCEEECTTSCEEEEEEECCSS--CCSEEEEEECCTTCCGG-GGHHHHHHHHTTTEEEEEECCTTSTTSCSSTT
T ss_pred             CCcccccCceEEccCCeEEEEEEeCCCC--CCCcEEEEECCCCcccc-hHHHHHHHHHhCCCeEEEEcCCCCcCCCCcCC
Confidence            35667776 8899999999999998764  35889999999998887 67899999999899999999999999998665


Q ss_pred             cCCCcchHHHHHHHHHHHHHHhcCCCCCEEEEEechhhHHHHHHHHhcCCCccEEEEeCCcCCCCcCCCCCchhhhhHHH
Q 035721          106 HIPDLNPVVEDAISFFDSFRARHAPDLPAFLYSESLGGAIALYITLRQKGAWDGLILNGAMCGISQKFKPPWPLEHLLFT  185 (308)
Q Consensus       106 ~~~~~~~~~~d~~~~l~~~~~~~~~~~~~~l~G~S~Gg~~a~~~a~~~p~~v~~~vl~~~~~~~~~~~~~~~~~~~~~~~  185 (308)
                      ...++.++++|+.++++.+.... +..+++++|||+||.+++.++.++|++|+++|++++......... ..........
T Consensus       107 ~~~~~~~~~~d~~~~l~~l~~~~-~~~~v~l~G~S~Gg~~a~~~a~~~p~~v~~lvl~~~~~~~~~~~~-~~~~~~~~~~  184 (342)
T 3hju_A          107 VVSDFHVFVRDVLQHVDSMQKDY-PGLPVFLLGHSMGGAIAILTAAERPGHFAGMVLISPLVLANPESA-TTFKVLAAKV  184 (342)
T ss_dssp             CCSCTHHHHHHHHHHHHHHHHHS-TTCCEEEEEETHHHHHHHHHHHHSTTTCSEEEEESCCCSCCTTTT-SHHHHHHHHH
T ss_pred             CcCcHHHHHHHHHHHHHHHHHhC-CCCcEEEEEeChHHHHHHHHHHhCccccceEEEECcccccchhhh-hHHHHHHHHH
Confidence            55688999999999999998874 566999999999999999999999999999999999766543221 1112222222


Q ss_pred             hhhhCCCcccccCCCCCCCcccccHHHHHHHhhCCCCCCCcchHHHHHHHHHHHHHhhhhcCCCCcceEEEeeCCCcccC
Q 035721          186 VAWLVPTWRVVPTRGSLPMVSFKEEWKRKLALSSPRRPVARPRAATALELLRVSRDLQGRFEEVEVPMLICHGGDDVVCD  265 (308)
Q Consensus       186 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~P~l~i~g~~D~~~~  265 (308)
                      .....+.......   ..............+..+.....................+..+.+.++++|+++++|++|.+++
T Consensus       185 ~~~~~~~~~~~~~---~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~Pvlii~G~~D~~~~  261 (342)
T 3hju_A          185 LNLVLPNLSLGPI---DSSVLSRNKTEVDIYNSDPLICRAGLKVCFGIQLLNAVSRVERALPKLTVPFLLLQGSADRLCD  261 (342)
T ss_dssp             HHHHCTTCBCCCC---CGGGSCSCHHHHHHHHTCTTCCCSCCBHHHHHHHHHHHHHHHHHGGGCCSCEEEEEETTCSSSC
T ss_pred             HHHhccccccCcc---cccccccchHHHHHHhcCcccccccccHHHHHHHHHHHHHHHHHHHhCCcCEEEEEeCCCcccC
Confidence            3333333222111   1122233444445555555555555556666666666667777889999999999999999999


Q ss_pred             hHHHHHHHHHhcCCCCcEEEecCCccccc-CCchhhHHH
Q 035721          266 PACVEELYKRAASKDKTLSIYPGMWHQLI-GEPEENVEL  303 (308)
Q Consensus       266 ~~~~~~~~~~~~~~~~~~~~~~~~gH~~~-~~~~~~~~~  303 (308)
                      ++.++.+.+.++++++++++++++||+++ ++|+++.+.
T Consensus       262 ~~~~~~~~~~~~~~~~~~~~~~~~gH~~~~~~~~~~~~~  300 (342)
T 3hju_A          262 SKGAYLLMELAKSQDKTLKIYEGAYHVLHKELPEVTNSV  300 (342)
T ss_dssp             HHHHHHHHHHCCCSSEEEEEETTCCSCGGGSCHHHHHHH
T ss_pred             hHHHHHHHHHcCCCCceEEEECCCCchhhcCChHHHHHH
Confidence            99999999999655799999999999999 888765554



>3om8_A Probable hydrolase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MES; 2.25A {Pseudomonas aeruginosa} SCOP: c.69.1.0 Back     alignment and structure
>3pe6_A Monoglyceride lipase; alpha-beta hydrolase fold, 2-arachidonyl-glycerol, M associated, hydrolase, hydrolase-hydrolase inhibitor comple; HET: ZYH; 1.35A {Homo sapiens} PDB: 3jw8_A 3jwe_A* Back     alignment and structure
>1b6g_A Haloalkane dehalogenase; hydrolase, alpha/beta-hydrolase; 1.15A {Xanthobacter autotrophicus} SCOP: c.69.1.8 PDB: 1be0_A 1cij_A 2yxp_X 1edd_A 1edb_A 2dhc_A 2dhe_A 2eda_A 2edc_A 2had_A 1ede_A 2pky_X 1bez_A 1bee_A 2dhd_A* 1hde_A Back     alignment and structure
>2xt0_A Haloalkane dehalogenase; hydrolase, alpha-beta hydrolase fold; 1.90A {Plesiocystis pacifica} Back     alignment and structure
>1zoi_A Esterase; alpha/beta hydrolase fold; 1.60A {Pseudomonas putida} PDB: 4dgq_A Back     alignment and structure
>4fbl_A LIPS lipolytic enzyme; thermostable, structural genomics, enzyme function initiativ structural proteomics in europe, spine; HET: SPD; 1.99A {Unidentified} PDB: 4fbm_A Back     alignment and structure
>3v48_A Aminohydrolase, putative aminoacrylate hydrolase RUTD; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.10A {Escherichia coli SE11} Back     alignment and structure
>2xua_A PCAD, 3-oxoadipate ENOL-lactonase; hydrolase, catechol metabolism; 1.90A {Burkholderia xenovorans} Back     alignment and structure
>2wue_A 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrolase BPHD; HET: KEK; 1.80A {Mycobacterium tuberculosis} PDB: 2wud_A* 2wuf_A* 2wug_A* 2vf2_A Back     alignment and structure
>3ia2_A Arylesterase; alpha-beta hydrolase fold, transition state analog, hydrolas oxidoreductase, peroxidase; 1.65A {Pseudomonas fluorescens} SCOP: c.69.1.12 PDB: 1va4_A 3t52_A* 3t4u_A* 3hi4_A 3hea_A Back     alignment and structure
>1a88_A Chloroperoxidase L; haloperoxidase, oxidoreductase; 1.90A {Streptomyces lividans} SCOP: c.69.1.12 Back     alignment and structure
>1a8q_A Bromoperoxidase A1; haloperoxidase, oxidoreductase; 1.75A {Streptomyces aureofaciens} SCOP: c.69.1.12 Back     alignment and structure
>3fob_A Bromoperoxidase; structural genomics, IDP00046, bacillus ANT peroxidase, oxidoreductase; 1.74A {Bacillus anthracis str} SCOP: c.69.1.0 Back     alignment and structure
>2yys_A Proline iminopeptidase-related protein; TTHA1809, structural genomics, unknown function; 2.20A {Thermus thermophilus} Back     alignment and structure
>3bf7_A Esterase YBFF; thioesterase, helical CAP, hydrolase; 1.10A {Escherichia coli} PDB: 3bf8_A Back     alignment and structure
>1a8s_A Chloroperoxidase F; haloperoxidase, oxidoreductase, propionate complex; 1.80A {Pseudomonas fluorescens} SCOP: c.69.1.12 Back     alignment and structure
>3afi_E Haloalkane dehalogenase; A/B-hydrolase, hydrolase; 1.75A {Bradyrhizobium japonicum} PDB: 3a2m_A* 3a2n_A 3a2l_A* Back     alignment and structure
>1q0r_A RDMC, aclacinomycin methylesterase; anthracycline, hydrolase, polyketide, tailoring enzyme, structural proteomics in europe, spine; HET: AKT 1PE; 1.45A {Streptomyces purpurascens} SCOP: c.69.1.28 PDB: 1q0z_A* Back     alignment and structure
>1ehy_A Protein (soluble epoxide hydrolase); alpha/beta hydrolase fold, epoxide degradation, epichlorohydrin; 2.10A {Agrobacterium tumefaciens} SCOP: c.69.1.11 Back     alignment and structure
>1brt_A Bromoperoxidase A2; haloperoxidase, oxidoreductase, alpha/beta hydrolase fold, mutant M99T; 1.50A {Streptomyces aureofaciens} SCOP: c.69.1.12 PDB: 1bro_A 1a8u_A 1a7u_A Back     alignment and structure
>1iup_A META-cleavage product hydrolase; aromatic compounds, cumene, isopropylbenzene, META-cleavage compound hydrolase; 1.60A {Pseudomonas fluorescens} SCOP: c.69.1.10 PDB: 1iun_A 1iuo_A 1uk6_A 1uk7_A 1uk8_A 1uk9_A 1uka_A 1ukb_A 2d0d_A Back     alignment and structure
>2ocg_A Valacyclovir hydrolase; alpha beta hydrolase fold; 1.75A {Homo sapiens} PDB: 2oci_A* 2ock_A 2ocl_A Back     alignment and structure
>2puj_A 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrola; C-C bond hydrolase, hydrolase; HET: HPZ; 1.57A {Burkholderia xenovorans} PDB: 2pu7_A* 3v1m_A* 3v1l_A* 2puh_A* 3v1n_A* 3v1k_A* 2og1_A 2pu5_A 2rhw_A* 2rht_A* 2ri6_A Back     alignment and structure
>3nwo_A PIP, proline iminopeptidase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, mycobac smegmatis; 1.90A {Mycobacterium smegmatis} Back     alignment and structure
>1tht_A Thioesterase; 2.10A {Vibrio harveyi} SCOP: c.69.1.13 Back     alignment and structure
>2wtm_A EST1E; hydrolase; 1.60A {Clostridium proteoclasticum} PDB: 2wtn_A* Back     alignment and structure
>3g9x_A Haloalkane dehalogenase; alpha/beta hydrolase, helical CAP domain, catalytic triad (A His272, Glu130), mutant, I135F, haloalkanes; 0.95A {Rhodococcus SP} SCOP: c.69.1.8 PDB: 3fwh_A 3fbw_A 3rlt_A 3rk4_A 1bn6_A 1bn7_A 4fwb_A 1cqw_A 3sk0_A 2v9z_A Back     alignment and structure
>3qit_A CURM TE, polyketide synthase; thioesterase, alpha/beta hydrolase, decarboxylase, sulfate elimination, terminal alkene production; 1.68A {Lyngbya majuscula 19L} Back     alignment and structure
>1c4x_A BPHD, protein (2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoat hydrolase); PCB degradation; 2.40A {Rhodococcus SP} SCOP: c.69.1.10 Back     alignment and structure
>3bwx_A Alpha/beta hydrolase; YP_496220.1, joint center for structural genomics, protein structure initiative, PSI-2; HET: MSE; 1.50A {Novosphingobium aromaticivorans} Back     alignment and structure
>2cjp_A Epoxide hydrolase; HET: PG4 VPR; 1.95A {Solanum tuberosum} PDB: 3cxu_A* Back     alignment and structure
>1hkh_A Gamma lactamase; hydrolase, alpha/beta hydrolase, CO-factor free haloperoxidase,; 1.73A {Microbacterium} SCOP: c.69.1.12 PDB: 1hl7_A* Back     alignment and structure
>2wfl_A Polyneuridine-aldehyde esterase; alkaloid metabolism, monoterpenoid indole alkaloids, PNAE, hydrolase, serine esterase; HET: CME; 2.10A {Rauvolfia serpentina} PDB: 2wfm_A 3gzj_A* Back     alignment and structure
>3u1t_A DMMA haloalkane dehalogenase; alpha/beta-hydrolase, hydrolase; 2.20A {Unidentified} Back     alignment and structure
>2wj6_A 1H-3-hydroxy-4-oxoquinaldine 2,4-dioxygenase; oxidoreductase, alpha/beta hydrolase; HET: ZZ8 SRT; 2.00A {Arthrobacter nitroguajacolicus} PDB: 2wj4_A* 2wj3_A* 2wm2_A* Back     alignment and structure
>1tqh_A Carboxylesterase precursor; tetrahedral intermediate, alpha/beta hydrolase; 1.63A {Geobacillus stearothermophilus} SCOP: c.69.1.29 PDB: 1r1d_A* 4diu_A Back     alignment and structure
>1mtz_A Proline iminopeptidase; alpha-beta hydrolase, CAP domain, caged active site, prolyl peptidase; 1.80A {Thermoplasma acidophilum} SCOP: c.69.1.7 PDB: 1mt3_A 1mu0_A* 1xrr_A 1xrq_A 1xro_A 1xrn_A 1xrm_A 1xrp_A 1xrl_A* 1xqw_A* 1xqx_A* 1xqy_A 1xqv_A Back     alignment and structure
>1j1i_A META cleavage compound hydrolase; carbazole degradation, META cleavage product hydrolase, histidine tagged protein, alpha/beta-hydrolase; 1.86A {Janthinobacterium} SCOP: c.69.1.10 Back     alignment and structure
>3pfb_A Cinnamoyl esterase; alpha/beta hydrolase fold, hydrolase, cinnamoyl/Fe esterase, hydroxycinammates, extracellular; HET: ZYC; 1.58A {Lactobacillus johnsonii} PDB: 3pf9_A* 3pfc_A* 3s2z_A* 3pf8_A 3qm1_A* Back     alignment and structure
>1u2e_A 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase; alpha/beta hydrolase fold; 2.10A {Escherichia coli} Back     alignment and structure
>2xmz_A Hydrolase, alpha/beta hydrolase fold family; menaquinone biosynthesis, lyase; 1.94A {Staphylococcus aureus} Back     alignment and structure
>1xkl_A SABP2, salicylic acid-binding protein 2; alpha-beta protein, structural genomics, protein structure initiative, PSI; HET: STH; 2.00A {Nicotiana tabacum} SCOP: c.69.1.20 PDB: 1y7i_A* 1y7h_A* Back     alignment and structure
>3r0v_A Alpha/beta hydrolase fold protein; structural genomics, PSI-biology, protein structure initiati alpha/beta hydrolase; HET: MSE; 1.38A {Sphaerobacter thermophilus} Back     alignment and structure
>3oos_A Alpha/beta hydrolase family protein; APC67239.0, protein structure initiative, PSI-2, structural midwest center for structural genomics, MCSG; HET: MSE PG4; 1.65A {Bacillus anthracis} Back     alignment and structure
>4f0j_A Probable hydrolytic enzyme; alpha/beta hydrolase fold, structural genomics, joint center structural genomics, JCSG; HET: MSE; 1.50A {Pseudomonas aeruginosa} Back     alignment and structure
>3kda_A CFTR inhibitory factor (CIF); alpha/beta hydrolase, hydrolase; 1.50A {Pseudomonas aeruginosa ucbpp-pa14} PDB: 3kd2_A 3pi6_A Back     alignment and structure
>3c6x_A Hydroxynitrilase; atomic resolution, hydroxynitril lyase, catalysis, protonation state, AB initio calculations, substrate bindin; 1.05A {Hevea brasiliensis} SCOP: c.69.1.20 PDB: 1sc9_A 1yas_A* 2g4l_A* 2yas_A 1qj4_A 3c6y_A 3c6z_A 3c70_A 3yas_A 4yas_A 5yas_A* 6yas_A 7yas_A* 1yb6_A* 1yb7_A 1sck_A 1sci_A 1scq_A 1dwo_A 1dwp_A ... Back     alignment and structure
>3ibt_A 1H-3-hydroxy-4-oxoquinoline 2,4-dioxygenase; QDO, oxidoreductase; 2.60A {Pseudomonas putida} Back     alignment and structure
>3sty_A Methylketone synthase 1; alpha/beta hydrolase, decarboxylase, hydrolase; HET: DKA; 1.70A {Lycopersicon hirsutum F} PDB: 3stu_A* 3stt_A* 3stv_A* 3stw_A* 3stx_A* Back     alignment and structure
>3rm3_A MGLP, thermostable monoacylglycerol lipase; alpha/beta hydrolase fold, hydrolase; 1.20A {Bacillus SP} PDB: 3rli_A Back     alignment and structure
>3vdx_A Designed 16NM tetrahedral protein CAGE containing bromoperoxidase BPO-A2 and matrix...; protein design, bionanotechnology; 3.00A {Streptomyces aureofaciens} PDB: 4d9j_A Back     alignment and structure
>3fsg_A Alpha/beta superfamily hydrolase; PF00561, MCSG, PSI, PSI-2, structural genomics, protein structure initiative, midwest for structural genomics; 2.00A {Oenococcus oeni} Back     alignment and structure
>2psd_A Renilla-luciferin 2-monooxygenase; alpha/beta-hydrolase, luciferase, oxidoreductase; 1.40A {Renilla reniformis} PDB: 2pse_A 2psj_A* 2psh_A 2psf_A Back     alignment and structure
>3dqz_A Alpha-hydroxynitrIle lyase-like protein; A/B-hydrloase fold, cyanogenesis; 2.50A {Arabidopsis thaliana} SCOP: c.69.1.0 Back     alignment and structure
>3llc_A Putative hydrolase; structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE PG4; 1.80A {Agrobacterium vitis} Back     alignment and structure
>3r40_A Fluoroacetate dehalogenase; FACD, defluorinase, alpha/beta hydrolase, hydrolase; 1.05A {Rhodopseudomonas palustris} PDB: 3r3w_A 3r3x_A 3r3v_A 3r3u_A 3r3z_A 3r41_A 3r3y_A Back     alignment and structure
>2y6u_A Peroxisomal membrane protein LPX1; hydrolase, putative esterase, putative lipase; HET: CME CSO; 1.90A {Saccharomyces cerevisiae} PDB: 2y6v_A* Back     alignment and structure
>1wom_A RSBQ, sigma factor SIGB regulation protein RSBQ; alpha/beta hydrolase, signaling protein; 2.50A {Bacillus subtilis} PDB: 1wpr_A* Back     alignment and structure
>2qmq_A Protein NDRG2, protein NDR2; alpha/beta-hydrolases fold, NDR family, developmental protei differentiation, neurogenesis, phosphorylation; HET: 2PE; 1.70A {Mus musculus} PDB: 2xmq_A 2xmr_A 2xms_A Back     alignment and structure
>3i28_A Epoxide hydrolase 2; aromatic hydrocarbons catabolism, detoxification, magnesium, metal-binding, peroxisome; HET: 34N; 1.95A {Homo sapiens} PDB: 1s8o_A* 1zd2_P* 1vj5_A* 1zd4_A* 1zd5_A* 3i1y_A* 1zd3_A* 3koo_A* 3otq_A* 4hai_A* 1cqz_A 1cr6_A* 1ek1_A* 1ek2_A* 3ans_A* 3ant_A* 3pdc_A* Back     alignment and structure
>3kxp_A Alpha-(N-acetylaminomethylene)succinic acid hydrolase; alpha/beta hydrolase, PLP degradation, E-2- (acetamidomethylene)succinate; 2.26A {Mesorhizobium loti} Back     alignment and structure
>1k8q_A Triacylglycerol lipase, gastric; APHA beta hydrolase fold, hydrolase; HET: NAG BOG C11; 2.70A {Canis lupus familiaris} SCOP: c.69.1.6 PDB: 1hlg_A* Back     alignment and structure
>1m33_A BIOH protein; alpha-betta-alpha sandwich, structural genomics, PSI, protei structure initiative; HET: MSE 3OH; 1.70A {Escherichia coli} SCOP: c.69.1.26 Back     alignment and structure
>2qvb_A Haloalkane dehalogenase 3; RV2579, alpha-beta hydrolase protei structural genomics consortium, TBSGC, hydrolase; 1.19A {Mycobacterium tuberculosis} PDB: 2o2i_A 2o2h_A Back     alignment and structure
>3i1i_A Homoserine O-acetyltransferase; structural genomics, IDP01610, O-acetyltransfera bacillus anthracis; HET: MSE; 2.44A {Bacillus anthracis str} Back     alignment and structure
>3p2m_A Possible hydrolase; alpha/beta hydrolase superfamily; 2.80A {Mycobacterium tuberculosis} Back     alignment and structure
>2e3j_A Epoxide hydrolase EPHB; epoxide hydrolase B, structural mycobacterium tuberculosis structural proteomics project, X hydrolase; 2.10A {Mycobacterium tuberculosis} PDB: 2zjf_A* Back     alignment and structure
>1mj5_A 1,3,4,6-tetrachloro-1,4-cyclohexadiene hydrolase; LINB, haloalkane dehalogenase, 1, 3, 4, 4-cyclohexadiene dehalogenase; 0.95A {Sphingomonas paucimobilis} SCOP: c.69.1.8 PDB: 1cv2_A 1d07_A 2bfn_A 1g42_A* 1g4h_A* 1g5f_A* 1iz7_A 1iz8_A* 1k5p_A 1k63_A 1k6e_A Back     alignment and structure
>3hss_A Putative bromoperoxidase; alpha beta hydrolase, oxidoreductase, hydrolase; 1.90A {Mycobacterium tuberculosis} PDB: 3e3a_A 3hys_A 3hzo_A Back     alignment and structure
>2pl5_A Homoserine O-acetyltransferase; alpha/beta hydrolase superfa transferase; 2.20A {Leptospira interrogans} SCOP: c.69.1.40 Back     alignment and structure
>2r11_A Carboxylesterase NP; 2632844, putative hydrolase, structural genomics, joint center for structural genomics, JCSG; HET: MSE PGE; 1.96A {Bacillus subtilis} Back     alignment and structure
>4g9e_A AHL-lactonase, alpha/beta hydrolase fold protein; AHL-binding; HET: C4L; 1.09A {Ochrobactrum} PDB: 4g5x_A* 4g8b_A* 4g8d_A 4g8c_A* 4g9g_A Back     alignment and structure
>3bdi_A Uncharacterized protein TA0194; NP_393672.1, predicted CIB-like hydrolase, structural genomi center for structural genomics; HET: MSE; 1.45A {Thermoplasma acidophilum dsm 1728} Back     alignment and structure
>1imj_A CIB, CCG1-interacting factor B; alpha/beta hydrolase, CCG1 interactor; 2.20A {Homo sapiens} SCOP: c.69.1.23 Back     alignment and structure
>3dkr_A Esterase D; alpha beta hydrolase, mechanism, catalytic triad, rotation; 1.60A {Lactobacillus rhamnosus} SCOP: c.69.1.0 PDB: 3dlt_A 3dyi_A 3dyv_A 3e1g_A Back     alignment and structure
>4dnp_A DAD2; alpha/beta hydrolase, hydrolase; 2.15A {Petunia hybrida} PDB: 4dnq_A Back     alignment and structure
>1wm1_A Proline iminopeptidase; complex with inhibitor, hydrolase; HET: PTB; 2.10A {Serratia marcescens} SCOP: c.69.1.7 PDB: 1qtr_A* 1x2b_A* 1x2e_A* Back     alignment and structure
>3trd_A Alpha/beta hydrolase; cellular processes; 1.50A {Coxiella burnetii} Back     alignment and structure
>3e0x_A Lipase-esterase related protein; APC60309, clostridium acetobutylicum ATCC 824, structural genomics, PSI-2; HET: MSE; 1.45A {Clostridium acetobutylicum} Back     alignment and structure
>3ksr_A Putative serine hydrolase; catalytic triad, structural genomics, JOIN for structural genomics, JCSG; 2.69A {Xanthomonas campestris PV} Back     alignment and structure
>2i3d_A AGR_C_3351P, hypothetical protein ATU1826; structural genomics, APC5865, hydrolase, PSI-2, protein STRU initiative; HET: MSE; 1.50A {Agrobacterium tumefaciens str} SCOP: c.69.1.36 Back     alignment and structure
>1azw_A Proline iminopeptidase; aminopeptidase, serine protease, xanthomonas campestris; 2.70A {Xanthomonas citri} SCOP: c.69.1.7 Back     alignment and structure
>1r3d_A Conserved hypothetical protein VC1974; structural genomics, hydrolase, NYSGXRC, NEW YORK SGX research center for structural genomics, PSI; 1.90A {Vibrio cholerae} SCOP: c.69.1.35 Back     alignment and structure
>2vat_A Acetyl-COA--deacetylcephalosporin C acetyltransferase; A/B- hydrolase fold, acyltransferase, acetyl coenzyme A, antibiotic biosynthesis; HET: COA; 2.2A {Acremonium chrysogenum} SCOP: c.69.1.40 PDB: 2vav_A* 2vax_A* Back     alignment and structure
>3qvm_A OLEI00960; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta hydrolase fold, hydrolase; 2.00A {Oleispira antarctica} Back     alignment and structure
>3b12_A Fluoroacetate dehalogenase; dehalogease, hydrolase; 1.20A {Burkholderia SP} PDB: 1y37_A Back     alignment and structure
>2b61_A Homoserine O-acetyltransferase; acyl-enzyme, aspartate pathway, coenzyme A, structure-functi studies, alpha-beta hydrolase fold; 1.65A {Haemophilus influenzae} SCOP: c.69.1.40 Back     alignment and structure
>3qyj_A ALR0039 protein; alpha/beta fold, hydrolase; 1.78A {Nostoc SP} Back     alignment and structure
>2fuk_A XC6422 protein; A/B hydrolase, structural genomics, X-RAY diffraction; 1.60A {Xanthomonas campestris} SCOP: c.69.1.36 Back     alignment and structure
>1pja_A Palmitoyl-protein thioesterase 2 precursor; hydrolase, glycoprotein, lysosome; HET: NAG; 2.70A {Homo sapiens} SCOP: c.69.1.13 Back     alignment and structure
>2o2g_A Dienelactone hydrolase; YP_324580.1, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.92A {Anabaena variabilis} Back     alignment and structure
>3c5v_A PME-1, protein phosphatase methylesterase 1; demethylase, PP2A, alternative splicing, hydrolase, phosphoprotein, serine esterase; 2.00A {Homo sapiens} PDB: 3c5w_P Back     alignment and structure
>1zi8_A Carboxymethylenebutenolidase; alpha and beta proteins, 3-D structure, serine esterase, HYD aromatic hydrocarbons, catabolism; 1.40A {Pseudomonas putida} PDB: 1zj5_A* 1zi9_A 1zi6_A 1zj4_A* 1din_A 1ziy_A* 1zic_A 1zix_A 1ggv_A* Back     alignment and structure
>3h04_A Uncharacterized protein; protein with unknown function, structural genomics, MCSG, PS protein structure initiative; 1.90A {Staphylococcus aureus subsp} Back     alignment and structure
>4i19_A Epoxide hydrolase; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics, MCSG; 2.15A {Streptomyces carzinostaticus subsp} Back     alignment and structure
>1ufo_A Hypothetical protein TT1662; alpha-beta fold, hydrolase, structural genomics, riken structural genomics/proteomics initiative, RSGI; 1.60A {Thermus thermophilus} SCOP: c.69.1.27 Back     alignment and structure
>3fla_A RIFR; alpha-beta hydrolase thioesterase, hydrolase; HET: MSE; 1.80A {Amycolatopsis mediterranei} PDB: 3flb_A* Back     alignment and structure
>3fcy_A Xylan esterase 1; alpha/beta hydrolase, carbohydrate esterase, CE7; 2.10A {Thermoanaerobacterium SP} Back     alignment and structure
>3f67_A Putative dienelactone hydrolase; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; 1.74A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3l80_A Putative uncharacterized protein SMU.1393C; alpha/beta hydrolase fold, carboxylesterase, Ser- hydrolase; 2.00A {Streptococcus mutans} Back     alignment and structure
>2hdw_A Hypothetical protein PA2218; alpha/beta hydrolase fold, structural genomics, PSI, structure initiative; 2.00A {Pseudomonas aeruginosa} Back     alignment and structure
>2rau_A Putative esterase; NP_343859.1, putative lipase, structural genomics, joint CEN structural genomics, JCSG; HET: PG4 UNL; 1.85A {Sulfolobus solfataricus P2} Back     alignment and structure
>2jbw_A Dhpon-hydrolase, 2,6-dihydroxy-pseudo-oxynicotine hydrolase; alpha/beta hydrolase, META-cleavage pathway; 2.1A {Arthrobacter nicotinovorans} SCOP: c.69.1.41 Back     alignment and structure
>2qjw_A Uncharacterized protein XCC1541; putative hydrolase of the alpha/beta superfamily, structural genomics; HET: MSE TLA P6G; 1.35A {Xanthomonas campestris PV} Back     alignment and structure
>2pbl_A Putative esterase/lipase/thioesterase; alpha/beta-hydrolases fold, structural genomics, joint cente structural genomics, JCSG; 1.79A {Silicibacter SP} SCOP: c.69.1.2 Back     alignment and structure
>1jfr_A Lipase; serine hydrolase; 1.90A {Streptomyces exfoliatus} SCOP: c.69.1.16 Back     alignment and structure
>2q0x_A Protein DUF1749, uncharacterized protein; alpha/beta hydrolase fold, structural genomics, structural G of pathogenic protozoa consortium; 2.20A {Trypanosoma brucei} Back     alignment and structure
>3fnb_A Acylaminoacyl peptidase SMU_737; alpha-beta-alpha sandwich, helix bundle, structural genomics protein structure initiative; HET: PGE; 2.12A {Streptococcus mutans} Back     alignment and structure
>3bjr_A Putative carboxylesterase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 2.09A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>3bxp_A Putative lipase/esterase; putative carboxylesterase, structural genomics, joint center structural genomics, JCSG; HET: EPE; 1.70A {Lactobacillus plantarum WCFS1} PDB: 3d3n_A* Back     alignment and structure
>3qmv_A Thioesterase, REDJ; alpha/beta hydrolase fold, hydrolase; 2.12A {Streptomyces coelicolor} PDB: 3qmw_A* Back     alignment and structure
>3hxk_A Sugar hydrolase; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 3.20A {Lactococcus lactis subsp} Back     alignment and structure
>4ao6_A Esterase; hydrolase, thermo label; 1.60A {Unidentified} PDB: 4ao7_A 4ao8_A Back     alignment and structure
>3g02_A Epoxide hydrolase; alpha/beta hydrolase fold, enantioselective, mutant, directed evolution; 1.50A {Aspergillus niger} SCOP: c.69.1.11 PDB: 1qo7_A 3g0i_A* Back     alignment and structure
>1qlw_A Esterase; anisotropic refinement, atomic resolution, alpha/beta hydrolase; 1.09A {Alcaligenes SP} SCOP: c.69.1.15 PDB: 2wkw_A* Back     alignment and structure
>1l7a_A Cephalosporin C deacetylase; structural genomics, alpha-beta-alpha sandwich, PSI, protein structure initiative; 1.50A {Bacillus subtilis} SCOP: c.69.1.25 PDB: 1odt_C 1ods_A 3fvt_A 3fvr_A 3fyu_A* 2xlb_A 2xlc_A 3fyt_A* 3fyu_B* Back     alignment and structure
>1fj2_A Protein (acyl protein thioesterase 1); alpha/beta hydrolase, serine hydrolase, SAD, anomalous diffr hydrolase; 1.50A {Homo sapiens} SCOP: c.69.1.14 Back     alignment and structure
>1isp_A Lipase; alpha/beta hydrolase fold, hydrolase; 1.30A {Bacillus subtilis} SCOP: c.69.1.18 PDB: 1i6w_A 1r4z_A* 1r50_A* 2qxu_A 2qxt_A 1t4m_A 1t2n_A 3d2a_A 3qzu_A 3d2b_A 3d2c_A 3qmm_A Back     alignment and structure
>3vis_A Esterase; alpha/beta-hydrolase fold, polyethylene terephthal hydrolase; HET: PE4; 1.76A {Thermobifida alba} Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>2h1i_A Carboxylesterase; structural genomics, PSI-2, protein struct initiative, midwest center for structural genomics, MCSG, H; HET: MSE; 2.80A {Bacillus cereus} SCOP: c.69.1.14 Back     alignment and structure
>1uxo_A YDEN protein; hydrolase, A/B hydrolase, esterase, PSI, protein structure initiative, MCSG, midwest center for structural genomics; 1.8A {Bacillus subtilis} SCOP: c.69.1.31 Back     alignment and structure
>1vlq_A Acetyl xylan esterase; TM0077, structural genomics, JCSG, PR structure initiative, PSI, joint center for structural GENO hydrolase; 2.10A {Thermotoga maritima} SCOP: c.69.1.25 PDB: 3m81_A 3m83_A* 3m82_A* Back     alignment and structure
>2qs9_A Retinoblastoma-binding protein 9; B5T overexpressed gene protein, BOG, RBBP9, RBBP10, HR2978, NESG, structural genomics, PSI-2; 1.72A {Homo sapiens} Back     alignment and structure
>1auo_A Carboxylesterase; hydrolase; 1.80A {Pseudomonas fluorescens} SCOP: c.69.1.14 PDB: 1aur_A* Back     alignment and structure
>3cn9_A Carboxylesterase; alpha/beta hydrolase fold super-family, hydrolase; HET: 2PE; 2.09A {Pseudomonas aeruginosa} PDB: 3cn7_A* Back     alignment and structure
>2r8b_A AGR_C_4453P, uncharacterized protein ATU2452; APC6088, agrobacterium tumefaciens STR. C58 structural genomics, PSI-2; 2.56A {Agrobacterium tumefaciens str} SCOP: c.69.1.14 Back     alignment and structure
>4fle_A Esterase; structural genomics, PSI-biology, northeast structural genom consortium, NESG, alpha-beta protein, rossmann fold, HY; 2.10A {Yersinia enterocolitica subsp} Back     alignment and structure
>3mve_A FRSA, UPF0255 protein VV1_0328; FRSA,fermentation/respiration switch protein, hydrolase ACTI lyase; 2.20A {Vibrio vulnificus} PDB: 3our_A Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>3og9_A Protein YAHD A copper inducible hydrolase; alpha/beta hydrolase, copper homeostasis, malic acid; 1.88A {Lactococcus lactis subsp} SCOP: c.69.1.0 Back     alignment and structure
>1vkh_A Putative serine hydrolase; structural genomics, joint center structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.85A {Saccharomyces cerevisiae} SCOP: c.69.1.32 Back     alignment and structure
>3bdv_A Uncharacterized protein DUF1234; DUF1234 family protein, alpha/beta-hydrolases fold, structur genomics; HET: MSE; 1.66A {Pectobacterium atrosepticum SCRI1043} Back     alignment and structure
>2c7b_A Carboxylesterase, ESTE1; carboxyesterase, thermophilic enzyme, hydrolase, HSL, alpha/beta hydrolase fold; 2.3A {Uncultured archaeon} Back     alignment and structure
>3k2i_A Acyl-coenzyme A thioesterase 4; alpha/beta hydrolase fold seven-stranded beta-sandwich, structural genomics, structural genomics consortium, SGC; 2.40A {Homo sapiens} Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>1jkm_A Brefeldin A esterase; serine hydrolase, degradation of brefeldin A, alpha/beta hydrolase family; 1.85A {Bacillus subtilis} SCOP: c.69.1.2 Back     alignment and structure
>3ils_A PKS, aflatoxin biosynthesis polyketide synthase; A/B hydrolase, thioesterase, norsolorinic acid, P polyketide, acyltransferase; 1.70A {Aspergillus parasiticus} Back     alignment and structure
>3b5e_A MLL8374 protein; NP_108484.1, carboxylesterase, structural genomics, joint CE structural genomics, JCSG, protein structure initiative; 1.75A {Mesorhizobium loti} SCOP: c.69.1.14 Back     alignment and structure
>4h0c_A Phospholipase/carboxylesterase; PSI-biology, midwest center for structural genomics, MCSG, hydrolase; HET: CIT; 1.62A {Dyadobacter fermentans} Back     alignment and structure
>2o7r_A CXE carboxylesterase; alpha/beta hydrolase; 1.40A {Actinidia eriantha} PDB: 2o7v_A Back     alignment and structure
>2k2q_B Surfactin synthetase thioesterase subunit; A/B-hydrolase, NRPS, non-ribosomal peptide synthetase, type II thioesterase, antibiotic biosynthesis; NMR {Bacillus subtilis} PDB: 2ron_A Back     alignment and structure
>2hm7_A Carboxylesterase; alpha/beta hydrolase fold, hydrolase; 2.00A {Alicyclobacillus acidocaldarius} PDB: 1evq_A* 1u4n_A 1qz3_A Back     alignment and structure
>3hlk_A Acyl-coenzyme A thioesterase 2, mitochondrial; alpha/beta hydrolase, alternative splicing, hydrolase, mitochondrion, polymorphism, serine esterase; 2.10A {Homo sapiens} Back     alignment and structure
>2fx5_A Lipase; alpha-beta hydrolase; HET: TLA; 1.80A {Pseudomonas mendocina} Back     alignment and structure
>3lcr_A Tautomycetin biosynthetic PKS; alpha-beta hydrolase, thioesterase, polyketide synthase, phosphopantetheine, transferase, hydrolase; 2.00A {Streptomyces SP} Back     alignment and structure
>2zsh_A Probable gibberellin receptor GID1L1; plant hormone receptor, gibberellin, gibberellin signaling pathway, hydrolase, nucleus, receptor, developmental protein; HET: GA3; 1.80A {Arabidopsis thaliana} PDB: 2zsi_A* Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>1lzl_A Heroin esterase; alpha/beta hydrolase; 1.30A {Rhodococcus SP} SCOP: c.69.1.2 PDB: 1lzk_A Back     alignment and structure
>3ain_A 303AA long hypothetical esterase; carboxylesterase, thermophilic, dimer, archaea, R267G, hydro; 1.65A {Sulfolobus tokodaii} PDB: 3aio_A 3ail_A 3aik_A 3aim_A Back     alignment and structure
>4e15_A Kynurenine formamidase; alpha/beta hydrolase fold, hydrolase-hydrolase inhibitor COM; HET: SEB; 1.50A {Drosophila melanogaster} PDB: 4e14_A* 4e11_A Back     alignment and structure
>3u0v_A Lysophospholipase-like protein 1; alpha, beta hydrolase fold, hydrolase; 1.72A {Homo sapiens} Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} Back     alignment and structure
>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... Back     alignment and structure
>1jji_A Carboxylesterase; alpha-beta hydrolase fold, hydrolase; HET: EPE; 2.20A {Archaeoglobus fulgidus} SCOP: c.69.1.2 Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>4hvt_A Ritya.17583.B, post-proline cleaving enzyme; ssgcid, structural genomics, S structural genomics center for infectious disease; 1.70A {Rickettsia typhi} Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>3ga7_A Acetyl esterase; phosphoserine, IDP00896, hydrolase, serine structural genomics, center for structural genomics of INFE diseases, csgid; HET: SEP MSE; 1.55A {Salmonella typhimurium} Back     alignment and structure
>3e4d_A Esterase D; S-formylglutathione hydrolase, hydrolase fold family, catalytic triad, kinetics, proposed reaction mechanism; HET: MSE; 2.01A {Agrobacterium tumefaciens} SCOP: c.69.1.0 Back     alignment and structure
>2qru_A Uncharacterized protein; alpha/beta-hydrolase, structural GENO PSI-2, protein structure initiative, midwest center for STR genomics, MCSG; 1.65A {Enterococcus faecalis} Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>3d0k_A Putative poly(3-hydroxybutyrate) depolymerase LPQ; alpha-beta-alpha sandwich, structural genomics, PSI-2; 1.83A {Bordetella parapertussis 12822} Back     alignment and structure
>1kez_A Erythronolide synthase; polyketide synthase, modular polyketide synthase, thioesterase, 6-DEB, TE, DEBS, alpha, beta-hydrolase; 2.80A {Saccharopolyspora erythraea} SCOP: c.69.1.22 PDB: 1mo2_A Back     alignment and structure
>3lp5_A Putative cell surface hydrolase; structural genom PSI2, MCSG, protein structure initiative, midwest center FO structural genomics; 2.00A {Lactobacillus plantarum} Back     alignment and structure
>3qh4_A Esterase LIPW; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, tuberculosis, O LIPW, heroin esterase; 1.75A {Mycobacterium marinum} Back     alignment and structure
>3fcx_A FGH, esterase D, S-formylglutathione hydrolase; retinoblastoma, genetic marker, cytoplasm, cytoplasmic vesicle, polymorphism, serine esterase; 1.50A {Homo sapiens} SCOP: c.69.1.0 Back     alignment and structure
>4fhz_A Phospholipase/carboxylesterase; alpha/beta hydrolase superfamily, central beta-STR sheet, flanked alpha helices, hydrolase; 2.01A {Rhodobacter sphaeroides} PDB: 4ftw_A* Back     alignment and structure
>3fak_A Esterase/lipase, ESTE5; HSL, hydrolase; 1.90A {Uncultured bacterium} PDB: 3g9t_A 3g9u_A 3g9z_A 3h17_A* 3h18_A* 3h19_A 3h1a_A 3h1b_A 3l1h_A 3l1i_A 3l1j_A 3v9a_A Back     alignment and structure
>2xe4_A Oligopeptidase B; hydrolase-inhibitor complex, hydrolase, protease inhibitor trypanosomes, CLAN SC; HET: FC0 RGL; 1.65A {Leishmania major} Back     alignment and structure
>2uz0_A Esterase, tributyrin esterase; alpha/beta hydrolase, hydrolase, A virulence facto LUNG infection; HET: MSE; 1.7A {Streptococcus pneumoniae} Back     alignment and structure
>3i6y_A Esterase APC40077; lipase, structural genomics, PSI-2, PR structure initiative, midwest center for structural genomic hydrolase; HET: MSE; 1.75A {Oleispira antarctica} PDB: 3s8y_A Back     alignment and structure
>3fle_A SE_1780 protein; structural genomics, APC61035.1, PSI-2, protein structure in midwest center for structural genomics, MCSG; 2.01A {Staphylococcus epidermidis} Back     alignment and structure
>3d7r_A Esterase; alpha/beta fold, hydrolase; 2.01A {Staphylococcus aureus subsp} Back     alignment and structure
>3k6k_A Esterase/lipase; alpha/beta hydrolase fold; 2.20A {Uncultured bacterium} PDB: 3dnm_A Back     alignment and structure
>3doh_A Esterase; alpha-beta hydrolase, beta sheet; 2.60A {Thermotoga maritima} PDB: 3doi_A Back     alignment and structure
>3ebl_A Gibberellin receptor GID1; alpha/beta hydrolase, lipase, gibberellin signaling pathway, hydrolase, nucleus, hydrolase receptor; HET: GA4; 1.90A {Oryza sativa subsp} PDB: 3ed1_A* Back     alignment and structure
>1ycd_A Hypothetical 27.3 kDa protein in AAP1-SMF2 intergenic region; esterase, lipase, serine hydrolase, structural genomics; HET: LI5; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>1lns_A X-prolyl dipeptidyl aminopetidase; alpha beta hydrolase fold; 2.20A {Lactococcus lactis} SCOP: a.40.2.1 b.18.1.13 c.69.1.21 Back     alignment and structure
>3ls2_A S-formylglutathione hydrolase; psychrophilic organism; 2.20A {Pseudoalteromonas haloplanktis} SCOP: c.69.1.0 Back     alignment and structure
>3h2g_A Esterase; xanthomonas oryzae PV. oryzae, cell WALL degrading enzyme, RICE, virulence, innate immune responses, pathogenesis; 1.86A {Xanthomonas oryzae PV} PDB: 3h2j_A 3h2k_A* 3h2h_A 3h2i_A Back     alignment and structure
>3ds8_A LIN2722 protein; unkonwn function, structural genomics, PSI, MCSG, P structure initiative; 1.80A {Listeria innocua} Back     alignment and structure
>3g8y_A SUSD/RAGB-associated esterase-like protein; structural genom joint center for structural genomics, JCSG; HET: MSE; 1.90A {Bacteroides vulgatus atcc 8482} Back     alignment and structure
>1ei9_A Palmitoyl protein thioesterase 1; alpha/beta hydrolase, glycoprotein, hydrolase; HET: NDG NAG; 2.25A {Bos taurus} SCOP: c.69.1.13 PDB: 1eh5_A* 1exw_A* 3gro_A Back     alignment and structure
>4b6g_A Putative esterase; hydrolase, formaldehyde detoxification, alpha/beta serine HY; 1.40A {Neisseria meningitidis MC58} Back     alignment and structure
>3tej_A Enterobactin synthase component F; nonribosomal peptide, thioesterase, carrier domain, ATP- BIN enterobactin biosynthesis, ION transport, iron; HET: UF0; 1.90A {Escherichia coli} PDB: 2roq_A Back     alignment and structure
>3d59_A Platelet-activating factor acetylhydrolase; secreted protein, alpha/beta-hydrolase-fold, LDL-bound, lipoprotein associated phospholipase A2, LP-PLA2; 1.50A {Homo sapiens} PDB: 3d5e_A 3f97_A* 3f98_A 3f9c_A* 3f96_A* Back     alignment and structure
>1jjf_A Xylanase Z, endo-1,4-beta-xylanase Z, 1,4-beta-D-xylan; feruloyl esterase, ferulic acid esterase, FAE_XYNZ, XYNZ, structural genomics; 1.75A {Clostridium thermocellum} SCOP: c.69.1.2 PDB: 1jt2_A* Back     alignment and structure
>1mpx_A Alpha-amino acid ester hydrolase; alpha/beta hydrolase, jellyroll, selenomethionine; 1.90A {Xanthomonas citri} SCOP: b.18.1.13 c.69.1.21 Back     alignment and structure
>4f21_A Carboxylesterase/phospholipase family protein; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.50A {Francisella tularensis subsp} Back     alignment and structure
>1tca_A Lipase; hydrolase(carboxylic esterase); HET: NAG; 1.55A {Candida antarctica} SCOP: c.69.1.17 PDB: 1lbs_A* 1lbt_A* 1tcb_A* 1tcc_A* Back     alignment and structure
>3i2k_A Cocaine esterase; alpha/beta hydrolase, hydrolase; HET: DBC GOL; 1.51A {Rhodococcus SP} PDB: 3i2j_A* 3puh_A 3i2h_A* 3i2i_A* 3i2g_A* 3ida_A* 3i2f_A* 3pui_A 1ju3_A 1ju4_A 1l7q_A 1l7r_A Back     alignment and structure
>3nuz_A Putative acetyl xylan esterase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-biology; 2.30A {Bacteroides fragilis} Back     alignment and structure
>4ezi_A Uncharacterized protein; alpha-beta hydrolases fold, structural genomics, joint cente structural genomics, JCSG; HET: MSE; 1.15A {Legionella pneumophila subsp} Back     alignment and structure
>2hfk_A Pikromycin, type I polyketide synthase pikaiv; alpha/beta hydrolase, thioesterase; HET: E4H; 1.79A {Streptomyces venezuelae} PDB: 2h7x_A* 2h7y_A* 2hfj_A* 1mna_A 1mn6_A 1mnq_A Back     alignment and structure
>1jmk_C SRFTE, surfactin synthetase; thioesterase, non-ribosomal peptide synthesis, alpha-beta hydrolase, cyclic peptide; 1.71A {Bacillus subtilis} SCOP: c.69.1.22 Back     alignment and structure
>1gpl_A RP2 lipase; serine esterase, hydrolase, lipid degradation, pancreas, glycoprotein, chimeric; 2.01A {Cavia porcellus} SCOP: b.12.1.2 c.69.1.19 PDB: 1lpb_B* 1lpa_B* 1n8s_A Back     alignment and structure
>2cb9_A Fengycin synthetase; thioesterase, non-ribosomal peptide synthesis, alpha/beta- hydrolases, catalytic triade, hydrolase; 1.8A {Bacillus subtilis} PDB: 2cbg_A* Back     alignment and structure
>3tjm_A Fatty acid synthase; thioesterase domain, fatty acid synthesis, hydrolase-hydrola inhibitor complex; HET: 7FA; 1.48A {Homo sapiens} PDB: 1xkt_A Back     alignment and structure
>3iii_A COCE/NOND family hydrolase; structural genomics, center for structural genomi infectious diseases, csgid; HET: MSE PLM; 1.95A {Staphylococcus aureus subsp} PDB: 3ib3_A* Back     alignment and structure
>2b9v_A Alpha-amino acid ester hydrolase; catalytic triad, alpha/beta-hydrolase; 2.00A {Acetobacter pasteurianus} SCOP: b.18.1.13 c.69.1.21 PDB: 2b4k_A 1nx9_A* 1ryy_A Back     alignment and structure
>1r88_A MPT51/MPB51 antigen; ALFA/beta hydrolase fold, FBPC1, immune system; 1.71A {Mycobacterium tuberculosis} SCOP: c.69.1.3 Back     alignment and structure
>3icv_A Lipase B, CALB; circular permutation, cleavage on PAIR of basic residues, glycoprotein, hydrolase, lipid degradation, zymogen, disulf; HET: NAG BTB; 1.49A {Candida antarctica} PDB: 3icw_A* Back     alignment and structure
>1ys1_X Lipase; CIS peptide Leu 234, Ca2+ ION, inhibitor hexylphosphonic acid (R) 2-methyl-3-phenylpropyl ester, hydrolase; HET: 2HR; 1.10A {Burkholderia cepacia} PDB: 1ys2_X* 4lip_D 1hqd_A 2lip_A 1oil_A* 3lip_A 2nw6_A 5lip_A* 1cvl_A 2es4_A 1tah_B 1qge_D 1qge_E Back     alignment and structure
>1bu8_A Protein (pancreatic lipase related protein 2); hydrolase, lipid degradation; HET: NAG; 1.80A {Rattus norvegicus} SCOP: b.12.1.2 c.69.1.19 PDB: 2oxe_A* 2pvs_A 1eth_A* Back     alignment and structure
>1sfr_A Antigen 85-A; alpha/beta hydrolase, structural genomics, PSI, protein structure initiative, TB structural genomics consortium, TBSGC; 2.70A {Mycobacterium tuberculosis} SCOP: c.69.1.3 Back     alignment and structure
>1w52_X Pancreatic lipase related protein 2; detergent, cleaved flap; HET: DDQ; 2.99A {Equus caballus} Back     alignment and structure
>1hpl_A Lipase; hydrolase(carboxylic esterase); 2.30A {Equus caballus} SCOP: b.12.1.2 c.69.1.19 Back     alignment and structure
>1ex9_A Lactonizing lipase; alpha-beta hydrolase fold, phosphonate inhibitor; HET: OCP; 2.54A {Pseudomonas aeruginosa} SCOP: c.69.1.18 Back     alignment and structure
>2x5x_A PHB depolymerase PHAZ7; biopolymers, oxyanion HOLE, hydrolase, biodegradation, catal; HET: PG4; 1.20A {Paucimonas lemoignei} PDB: 2vtv_A* 2x76_A Back     alignment and structure
>1dqz_A 85C, protein (antigen 85-C); fibronectin, structural genomics, PSI, protein structure initiative, TB structural genomics consortium; 1.50A {Mycobacterium tuberculosis} SCOP: c.69.1.3 PDB: 3hrh_A 1dqy_A 1va5_A* 1f0n_A* 1f0p_A* Back     alignment and structure
>1rp1_A Pancreatic lipase related protein 1; hydrolase, lipid degradation; HET: NAG; 2.10A {Canis lupus familiaris} SCOP: b.12.1.2 c.69.1.19 PDB: 2ppl_A Back     alignment and structure
>3n2z_B Lysosomal Pro-X carboxypeptidase; alpha/beta hydrolase, PRCP, serine carboxypeptidase, hydrola; HET: NAG; 2.79A {Homo sapiens} Back     alignment and structure
>1gkl_A Endo-1,4-beta-xylanase Y; hydrolase, esterase family 1, inactive mutant; HET: FER; 1.4A {Clostridium thermocellum} SCOP: c.69.1.2 PDB: 1wb4_A* 1wb5_A* 1wb6_A* 1gkk_A* Back     alignment and structure
>2zyr_A Lipase, putative; fatty acid, hydrolase; HET: 1PE; 1.77A {Archaeoglobus fulgidus} PDB: 2zys_A* 2zyi_A* 2zyh_A* Back     alignment and structure
>2dst_A Hypothetical protein TTHA1544; conserved hypothetical protein, structural genomics, NPPSFA; 2.00A {Thermus thermophilus} SCOP: c.69.1.39 Back     alignment and structure
>3guu_A Lipase A; protein structure, hydrolase; HET: 1PE; 2.10A {Candida antarctica} PDB: 2veo_A* Back     alignment and structure
>2qm0_A BES; alpha-beta structure, structural genomics, PSI-2, protein ST initiative, midwest center for structural genomics, MCSG; HET: SVY; 1.84A {Bacillus cereus atcc 14579} Back     alignment and structure
>2hih_A Lipase 46 kDa form; A1 phospholipase, phospholipid binding, hydrolase; 2.86A {Staphylococcus hyicus} Back     alignment and structure
>3c8d_A Enterochelin esterase; alpha-beta-alpha sandwich, IROD, iron aquisition, structural genomics, PSI-2, protein structure initiative; HET: CIT; 1.80A {Shigella flexneri 2a str} SCOP: b.1.18.20 c.69.1.2 PDB: 2b20_A 3c87_A* 3c8h_A 3mga_A* Back     alignment and structure
>2dsn_A Thermostable lipase; T1 lipase, hydrolase; 1.50A {Geobacillus zalihae} PDB: 3umj_A 2z5g_A 1ji3_A 3auk_A 2w22_A* 1ku0_A Back     alignment and structure
>2px6_A Thioesterase domain; thioesaterse domain, orlistat, fatty acid synthase, drug complex, tetrahydrolipstatin, transferase; HET: DH9; 2.30A {Homo sapiens} Back     alignment and structure
>2gzs_A IROE protein; enterobactin, salmochelin, DFP, hydrolase, catalytic DYAD; HET: DFP; 1.40A {Escherichia coli} SCOP: c.69.1.38 PDB: 2gzr_A* Back     alignment and structure
>3gff_A IROE-like serine hydrolase; NP_718593.1, structural genomics center for structural genomics, JCSG, protein structure INI PSI-2; 2.12A {Shewanella oneidensis} Back     alignment and structure
>4fol_A FGH, S-formylglutathione hydrolase; D-type esterase, oxidation sensor motif, esterase activity activation, esterase activity inhibition; 2.07A {Saccharomyces cerevisiae} PDB: 1pv1_A 3c6b_A* 4flm_A* Back     alignment and structure
>2ogt_A Thermostable carboxylesterase EST50; alpha/beta hydrolase, hydrolase; 1.58A {Geobacillus stearothermophilus} PDB: 2ogs_A Back     alignment and structure
>1qe3_A PNB esterase, para-nitrobenzyl esterase; alpha-beta hydrolase directed evolution; 1.50A {Bacillus subtilis} SCOP: c.69.1.1 PDB: 1c7j_A 1c7i_A Back     alignment and structure
>2d81_A PHB depolymerase; alpha/beta hydrolase fold, circular permutation, hydrolase; HET: NAG RB3; 1.66A {Penicillium funiculosum} SCOP: c.69.1.37 PDB: 2d80_A* Back     alignment and structure
>1p0i_A Cholinesterase; serine hydrolase, butyrate, hydrolase; HET: NAG FUC MES; 2.00A {Homo sapiens} SCOP: c.69.1.1 PDB: 1p0m_A* 1p0p_A* 1p0q_A* 1xlu_A* 1xlv_A* 1xlw_A* 2wsl_A* 2pm8_A* 3djy_A* 3dkk_A* 2wij_A* 2wif_A* 2wik_A* 2y1k_A* 2j4c_A* 2xmb_A* 2xmc_A* 2xmd_A* 2xmg_A* 2wig_A* ... Back     alignment and structure
>1ea5_A ACHE, acetylcholinesterase; hydrolase, serine hydrolase, neurotransmitter cleavage, catalytic triad, alpha/beta hydrolase; HET: NAG; 1.80A {Torpedo californica} SCOP: c.69.1.1 PDB: 1ax9_A* 1amn_A* 1cfj_A* 1fss_A* 1gpk_A* 1gpn_A* 1oce_A* 1qid_A 1qie_A 1qif_A 1qig_A 1qih_A 1qii_A 1qij_A 1qik_A 1qim_A 1qti_A* 1vot_A* 1vxo_A* 1vxr_A* ... Back     alignment and structure
>2ha2_A ACHE, acetylcholinesterase; hydrolase fold, serine esterase, homod glycosylated protein, hydrolase; HET: NAG FUC SCK SCU P6G; 2.05A {Mus musculus} SCOP: c.69.1.1 PDB: 1j07_A* 1mah_A* 1j06_A* 1n5r_A* 2gyv_A* 2gyw_A* 2h9y_A* 2ha0_A* 2gyu_A* 2ha3_A* 2wls_A* 4a23_A* 2c0q_A* 2jey_A* 2jgm_A* 2whr_A* 2c0p_A* 1ku6_A* 1q84_A* 1q83_A* ... Back     alignment and structure
>4g4g_A 4-O-methyl-glucuronoyl methylesterase; alpha/beta hydrolase, 3-layer alpha/beta/alpha sandwich, ROS fold, glucuronoyl esterase; 1.55A {Myceliophthora thermophila} PDB: 4g4i_A 4g4j_A* Back     alignment and structure
>3pic_A CIP2; alpha/beta hydrolase fold, glucuronoyl esterase, carbohydrat esterase family 15 (CE-15), N-linked glycosylation, secrete hydrolase; HET: NAG; 1.90A {Hypocrea jecorina} Back     alignment and structure
>1ivy_A Human protective protein; carboxypeptidase, serine carboxypeptidase, protective protei glycoprotein, zymogen; HET: NAG NDG; 2.20A {Homo sapiens} SCOP: c.69.1.5 Back     alignment and structure
>2h7c_A Liver carboxylesterase 1; enzyme, cholesteryl esterase, hydrolase; HET: NAG NDG SIA COA; 2.00A {Homo sapiens} SCOP: c.69.1.1 PDB: 2dqy_A* 2dr0_A* 2dqz_A* 1mx1_A* 1mx5_A* 1mx9_A* 4ab1_A* 1ya4_A* 1yah_A* 1yaj_A* 1ya8_A* 2hrr_A* 2hrq_A* 3k9b_A* 1k4y_A* Back     alignment and structure
>1whs_A Serine carboxypeptidase II; HET: NAG FUC; 2.00A {Triticum aestivum} SCOP: c.69.1.5 PDB: 1bcs_A* 1bcr_A* 1wht_A* 3sc2_A* Back     alignment and structure
>2fj0_A JuvenIle hormone esterase; manduca sexta, alpha-beta hydrolase; HET: TFC; 2.70A {Trichoplusia NI} Back     alignment and structure
>1ukc_A ESTA, esterase; fungi, A/B hydrolase fold, acetylcholinesterase, H; HET: NAG MAN; 2.10A {Aspergillus niger} SCOP: c.69.1.17 Back     alignment and structure
>1thg_A Lipase; hydrolase(carboxylic esterase); HET: NAG NDG; 1.80A {Galactomyces geotrichum} SCOP: c.69.1.17 Back     alignment and structure
>1llf_A Lipase 3; candida cylindracea cholesterol esterase, sterol ester acylh hydrolase; HET: NAG F23; 1.40A {Candida cylindracea} SCOP: c.69.1.17 PDB: 1cle_A* 1lpm_A* 1lpn_A* 1lpo_A* 1lpp_A* 1lps_A* 1crl_A* 1trh_A* 3rar_A* 1gz7_A* Back     alignment and structure
>2vsq_A Surfactin synthetase subunit 3; ligase, peptidyl carrier protein, ligase phosphoprotein, TER module, phosphopantetheine; 2.60A {Bacillus subtilis} Back     alignment and structure
>3bix_A Neuroligin-1, neuroligin I; esterase domain, alpha-beta hydrolase, cell adhesion, cell J glycoprotein, membrane, postsynaptic cell membrane; HET: NAG; 1.80A {Rattus norvegicus} PDB: 3biw_A* 3b3q_A* 3be8_A* 2wqz_A* 2xb6_A* 2vh8_A 3bl8_A* Back     alignment and structure
>1dx4_A ACHE, acetylcholinesterase; hydrolase, serine esterase, synapse, membrane, nerve, muscle neurotransmitter degradation, glycoprotein; HET: NAG MAN BMA 760; 2.70A {Drosophila melanogaster} SCOP: c.69.1.1 PDB: 1qo9_A* 1qon_A* Back     alignment and structure
>4ebb_A Dipeptidyl peptidase 2; hydrolase; HET: MSE NAG; 2.00A {Homo sapiens} PDB: 3jyh_A* 3n0t_A* Back     alignment and structure
>1tib_A Lipase; hydrolase(carboxylic esterase); 1.84A {Thermomyces lanuginosus} SCOP: c.69.1.17 PDB: 1dt3_A 1dt5_A 1du4_A 1ein_A* 1dte_A 4dyh_A* 4ea6_A 1gt6_A* Back     alignment and structure
>2bce_A Cholesterol esterase; hydrolase, serine esterase, lipase; 1.60A {Bos taurus} SCOP: c.69.1.1 PDB: 1akn_A* 1aql_A* 1f6w_A 1jmy_A Back     alignment and structure
>4az3_A Lysosomal protective protein 32 kDa chain; hydrolase, drug discovery, carboxypeptidase, cardiovascular; HET: NAG S35; 2.04A {Homo sapiens} PDB: 4az0_A* Back     alignment and structure
>1cpy_A Serine carboxypeptidase; hydrolase (carboxypeptidase); HET: NAG; 2.60A {Saccharomyces cerevisiae} SCOP: c.69.1.5 PDB: 1wpx_A* 1ysc_A* Back     alignment and structure
>1ac5_A KEX1(delta)P; carboxypeptidase, hydrolase, glycoprotein, transmembrane; HET: NAG; 2.40A {Saccharomyces cerevisiae} SCOP: c.69.1.5 Back     alignment and structure
>1tia_A Lipase; hydrolase(carboxylic esterase); 2.10A {Penicillium camemberti} SCOP: c.69.1.17 Back     alignment and structure
>2vz8_A Fatty acid synthase; transferase, phosphopantetheine, multienzyme, megasynthase, fatty acid synthesis; 3.2A {Sus scrofa} PDB: 2vz9_A* Back     alignment and structure
>1gxs_A P-(S)-hydroxymandelonitrIle lyase chain A; inhibitor complex, cyanogenesis mechanism; HET: NAG FUL DKA; 2.3A {Sorghum bicolor} SCOP: c.69.1.5 Back     alignment and structure
>1tgl_A Triacyl-glycerol acylhydrolase; carboxylic esterase; 1.90A {Rhizomucor miehei} SCOP: c.69.1.17 PDB: 4tgl_A 5tgl_A* 3tgl_A Back     alignment and structure
>1lgy_A Lipase, triacylglycerol lipase; hydrolase (carboxylic ester); 2.20A {Rhizopus niveus} SCOP: c.69.1.17 PDB: 1tic_A Back     alignment and structure
>3hc7_A Gene 12 protein, GP12; alpha/beta sandwich, cell adhesion; 2.00A {Mycobacterium phage D29} Back     alignment and structure
>3qpa_A Cutinase; alpha-beta hydrolase fold, esterase, hydrolase, mono- phosphorylated serine residue, secreted; HET: MIR; 0.85A {Nectria haematococca} PDB: 3qpc_A* 1cex_A 1oxm_A* 1cui_A 1cus_A 2cut_A 1cuj_A 1cuy_A 1xzl_A* 1xzk_A* 1xzm_A* 1cuh_A 1cuu_A 3esc_A* 1cua_A* 3esa_A* 3esb_A* 3ef3_A* 3esd_A* 1cux_A ... Back     alignment and structure
>3dcn_A Cutinase, cutin hydrolase; catalytic triad, secreted, serine esterase; 1.90A {Glomerella cingulata} SCOP: c.69.1.0 PDB: 3dd5_A 3dea_A* Back     alignment and structure
>1g66_A Acetyl xylan esterase II; serine hydrolase, acetyl xylopyranose, hydrolase; 0.90A {Penicillium purpurogenum} SCOP: c.69.1.30 PDB: 1bs9_A 2axe_A* Back     alignment and structure
>3qpd_A Cutinase 1; alpha-beta hydrolase fold, esterase, hydrolase, mono- phosphorylated serine residue, secreted, phosphorylated Ser residue; HET: SEP; 1.57A {Aspergillus oryzae} PDB: 3gbs_A Back     alignment and structure
>1whs_B Serine carboxypeptidase II; HET: NAG FUC; 2.00A {Triticum aestivum} SCOP: c.69.1.5 PDB: 1wht_B* 1bcs_B* 1bcr_B* 3sc2_B* Back     alignment and structure
>1qoz_A AXE, acetyl xylan esterase; hydrolase, xylan degradation; HET: NAG; 1.90A {Trichoderma reesei} SCOP: c.69.1.30 Back     alignment and structure
>3aja_A Putative uncharacterized protein; alpha-beta hydrolase, serine esterase, cutinase, lipase, HYD; 2.90A {Mycobacterium smegmatis} Back     alignment and structure
>1uwc_A Feruloyl esterase A; hydrolase, serine esterase, xylan degradation; HET: NAG FER; 1.08A {Aspergillus niger} SCOP: c.69.1.17 PDB: 1uza_A* 2hl6_A* 2ix9_A* 1usw_A* 2bjh_A* Back     alignment and structure
>2czq_A Cutinase-like protein; alpha/beta hydrolase fold, hydrolase; HET: CIT; 1.05A {Cryptococcus SP} Back     alignment and structure
>3g7n_A Lipase; hydrolase fold, hydrolase; HET: 1PE; 1.30A {Penicillium expansum} Back     alignment and structure
>3uue_A LIP1, secretory lipase (family 3); LID-domain, hydrolase; HET: NAG BMA MAN; 1.45A {Malassezia globosa} PDB: 3uuf_A* Back     alignment and structure
>3ngm_A Extracellular lipase; secret lipase, hydrolase; 2.80A {Gibberella zeae} Back     alignment and structure
>3o0d_A YALI0A20350P, triacylglycerol lipase; alpha/beta-hydrolase, lipids binding, glycosylation, extracellular, hydrolase; HET: NAG; 1.70A {Yarrowia lipolytica} SCOP: c.69.1.0 Back     alignment and structure
>4az3_B Lysosomal protective protein 20 kDa chain; hydrolase, drug discovery, carboxypeptidase, cardiovascular; HET: NAG S35; 2.04A {Homo sapiens} PDB: 4az0_B* Back     alignment and structure
>1gxs_B P-(S)-hydroxymandelonitrIle lyase chain B; inhibitor complex, cyanogenesis mechanism; HET: NAG FUL DKA; 2.3A {Sorghum bicolor} SCOP: c.69.1.5 Back     alignment and structure
>2ory_A Lipase; alpha/beta hydrolase, hydrolase; 2.20A {Photobacterium SP} Back     alignment and structure
>1ac5_A KEX1(delta)P; carboxypeptidase, hydrolase, glycoprotein, transmembrane; HET: NAG; 2.40A {Saccharomyces cerevisiae} SCOP: c.69.1.5 Back     alignment and structure
>1cpy_A Serine carboxypeptidase; hydrolase (carboxypeptidase); HET: NAG; 2.60A {Saccharomyces cerevisiae} SCOP: c.69.1.5 PDB: 1wpx_A* 1ysc_A* Back     alignment and structure
>2yij_A Phospholipase A1-iigamma; hydrolase; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>1ivy_A Human protective protein; carboxypeptidase, serine carboxypeptidase, protective protei glycoprotein, zymogen; HET: NAG NDG; 2.20A {Homo sapiens} SCOP: c.69.1.5 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 308
d1thta_302 c.69.1.13 (A:) Myristoyl-ACP-specific thioesterase 6e-17
d2jbwa1360 c.69.1.41 (A:8-367) 2,6-dihydropseudooxynicotine h 1e-09
d1vlqa_322 c.69.1.25 (A:) Acetyl xylan esterase TM0077 {Therm 1e-09
d1l7aa_318 c.69.1.25 (A:) Cephalosporin C deacetylase {Bacill 2e-09
d3c70a1256 c.69.1.20 (A:2-257) Hydroxynitrile lyase {Rubber t 5e-08
d1k8qa_377 c.69.1.6 (A:) Gastric lipase {Dog (Canis familiari 1e-07
d1xkla_258 c.69.1.20 (A:) Salicylic acid-binding protein 2 (S 2e-07
d1vkha_263 c.69.1.32 (A:) Putative serine hydrolase Ydr428c { 6e-07
d2rhwa1283 c.69.1.10 (A:4-286) 2-hydroxy-6-oxo-6-phenylhexa-2 3e-06
d1cvla_319 c.69.1.18 (A:) Lipase {Chromobacterium viscosum [T 4e-06
d1brta_277 c.69.1.12 (A:) Bromoperoxidase A2 {Streptomyces au 5e-06
d1a8sa_273 c.69.1.12 (A:) Chloroperoxidase F {Pseudomonas flu 9e-06
d1tqha_242 c.69.1.29 (A:) Carboxylesterase Est {Bacillus stea 2e-05
d1imja_208 c.69.1.23 (A:) Ccg1/TafII250-interacting factor B 3e-05
d1qlwa_318 c.69.1.15 (A:) A novel bacterial esterase {Alcalig 5e-05
d1q0ra_297 c.69.1.28 (A:) Aclacinomycin methylesterase RdmC { 8e-05
d1lnsa3405 c.69.1.21 (A:146-550) X-Prolyl dipeptidyl aminopep 1e-04
d1m33a_256 c.69.1.26 (A:) Biotin biosynthesis protein BioH {E 1e-04
d1azwa_313 c.69.1.7 (A:) Proline iminopeptidase {Xanthomonas 2e-04
d1ufoa_238 c.69.1.27 (A:) Hypothetical protein TT1662 {Thermu 3e-04
d1wm1a_313 c.69.1.7 (A:) Proline aminopeptidase {Serratia mar 0.001
d1jkma_358 c.69.1.2 (A:) Carboxylesterase {Bacillus subtilis, 0.001
d1a88a_275 c.69.1.12 (A:) Chloroperoxidase L {Streptomyces li 0.002
d1hkha_279 c.69.1.12 (A:) Gamma-lactamase {Aureobacterium sp. 0.002
d1tcaa_317 c.69.1.17 (A:) Triacylglycerol lipase {Yeast (Cand 0.002
d1ex9a_285 c.69.1.18 (A:) Lipase {Pseudomonas aeruginosa [Tax 0.002
d1ju3a2347 c.69.1.21 (A:5-351) Bacterial cocaine esterase N-t 0.003
d1pjaa_268 c.69.1.13 (A:) Palmitoyl protein thioesterase 2 {H 0.003
>d1thta_ c.69.1.13 (A:) Myristoyl-ACP-specific thioesterase {Vibrio harveyi [TaxId: 669]} Length = 302 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: alpha/beta-Hydrolases
superfamily: alpha/beta-Hydrolases
family: Thioesterases
domain: Myristoyl-ACP-specific thioesterase
species: Vibrio harveyi [TaxId: 669]
 Score = 77.3 bits (189), Expect = 6e-17
 Identities = 28/266 (10%), Positives = 60/266 (22%), Gaps = 28/266 (10%)

Query: 34  EYITNSRGLRLFTQWWTPLPPA-KTLGVLCVVHGFTGESSWIVQLTAVLFAKSGFATCAI 92
             +  + G  L      P          + +  GF         L A   + +GF     
Sbjct: 7   HVLRVNNGQELHVWETPPKENVPFKNNTILIASGFARRMDHFAGL-AEYLSTNGFHVFRY 65

Query: 93  DHQGHGFSDGLVAHIPDLNPVVEDAISFFDSFRARHAPDLPAFLYSESLGGAIALYITLR 152
           D   H            +        + +   + +   ++   L + SL   +A  +   
Sbjct: 66  DSLHHVGLSSGSIDEFTMTTGKNSLCTVYHWLQTKGTQNI--GLIAASLSARVAYEVI-- 121

Query: 153 QKGAWDGLILNGAMCGISQKFKPPWPLEHLLFTVAWLVPTWRVVPTRGSLPMVSFKEEWK 212
                  LI    +  +    +     ++L   +  L          G            
Sbjct: 122 SDLELSFLITAVGVVNLRDTLEKALGFDYLSLPIDELPNDLDF---EGHKLGSEVFVRDC 178

Query: 213 RKLALSSPRRPVARPRAATALELLRVSRDLQGRFEEVEVPMLICHGGDDVVCDPACVEEL 272
            +    +    + +                        VP++     +D       V ++
Sbjct: 179 FEHHWDTLDSTLDKV-------------------ANTSVPLIAFTANNDDWVKQEEVYDM 219

Query: 273 YKRAASKDKTLSIYPGMWHQLIGEPE 298
                +    L    G  H L     
Sbjct: 220 LAHIRTGHCKLYSLLGSSHDLGENLV 245


>d2jbwa1 c.69.1.41 (A:8-367) 2,6-dihydropseudooxynicotine hydrolase {Arthrobacter nicotinovorans [TaxId: 29320]} Length = 360 Back     information, alignment and structure
>d1vlqa_ c.69.1.25 (A:) Acetyl xylan esterase TM0077 {Thermotoga maritima [TaxId: 2336]} Length = 322 Back     information, alignment and structure
>d1l7aa_ c.69.1.25 (A:) Cephalosporin C deacetylase {Bacillus subtilis [TaxId: 1423]} Length = 318 Back     information, alignment and structure
>d3c70a1 c.69.1.20 (A:2-257) Hydroxynitrile lyase {Rubber tree (Hevea brasiliensis) [TaxId: 3981]} Length = 256 Back     information, alignment and structure
>d1k8qa_ c.69.1.6 (A:) Gastric lipase {Dog (Canis familiaris) [TaxId: 9615]} Length = 377 Back     information, alignment and structure
>d1xkla_ c.69.1.20 (A:) Salicylic acid-binding protein 2 (SABP2) {Common tobacco (Nicotiana tabacum) [TaxId: 4097]} Length = 258 Back     information, alignment and structure
>d1vkha_ c.69.1.32 (A:) Putative serine hydrolase Ydr428c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 263 Back     information, alignment and structure
>d2rhwa1 c.69.1.10 (A:4-286) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) {Burkholderia xenovorans [TaxId: 36873]} Length = 283 Back     information, alignment and structure
>d1cvla_ c.69.1.18 (A:) Lipase {Chromobacterium viscosum [TaxId: 42739]} Length = 319 Back     information, alignment and structure
>d1brta_ c.69.1.12 (A:) Bromoperoxidase A2 {Streptomyces aureofaciens [TaxId: 1894]} Length = 277 Back     information, alignment and structure
>d1a8sa_ c.69.1.12 (A:) Chloroperoxidase F {Pseudomonas fluorescens [TaxId: 294]} Length = 273 Back     information, alignment and structure
>d1tqha_ c.69.1.29 (A:) Carboxylesterase Est {Bacillus stearothermophilus [TaxId: 1422]} Length = 242 Back     information, alignment and structure
>d1imja_ c.69.1.23 (A:) Ccg1/TafII250-interacting factor B (Cib) {Human (Homo sapiens) [TaxId: 9606]} Length = 208 Back     information, alignment and structure
>d1qlwa_ c.69.1.15 (A:) A novel bacterial esterase {Alcaligenes sp. [TaxId: 512]} Length = 318 Back     information, alignment and structure
>d1q0ra_ c.69.1.28 (A:) Aclacinomycin methylesterase RdmC {Streptomyces purpurascens [TaxId: 1924]} Length = 297 Back     information, alignment and structure
>d1lnsa3 c.69.1.21 (A:146-550) X-Prolyl dipeptidyl aminopeptidase PepX, middle domain {Lactococcus lactis [TaxId: 1358]} Length = 405 Back     information, alignment and structure
>d1m33a_ c.69.1.26 (A:) Biotin biosynthesis protein BioH {Escherichia coli [TaxId: 562]} Length = 256 Back     information, alignment and structure
>d1azwa_ c.69.1.7 (A:) Proline iminopeptidase {Xanthomonas campestris, pv. citri [TaxId: 339]} Length = 313 Back     information, alignment and structure
>d1ufoa_ c.69.1.27 (A:) Hypothetical protein TT1662 {Thermus thermophilus [TaxId: 274]} Length = 238 Back     information, alignment and structure
>d1wm1a_ c.69.1.7 (A:) Proline aminopeptidase {Serratia marcescens [TaxId: 615]} Length = 313 Back     information, alignment and structure
>d1jkma_ c.69.1.2 (A:) Carboxylesterase {Bacillus subtilis, brefeldin A esterase [TaxId: 1423]} Length = 358 Back     information, alignment and structure
>d1a88a_ c.69.1.12 (A:) Chloroperoxidase L {Streptomyces lividans [TaxId: 1916]} Length = 275 Back     information, alignment and structure
>d1hkha_ c.69.1.12 (A:) Gamma-lactamase {Aureobacterium sp. [TaxId: 51671]} Length = 279 Back     information, alignment and structure
>d1tcaa_ c.69.1.17 (A:) Triacylglycerol lipase {Yeast (Candida antarctica), form b [TaxId: 34362]} Length = 317 Back     information, alignment and structure
>d1ex9a_ c.69.1.18 (A:) Lipase {Pseudomonas aeruginosa [TaxId: 287]} Length = 285 Back     information, alignment and structure
>d1ju3a2 c.69.1.21 (A:5-351) Bacterial cocaine esterase N-terminal domain {Rhodococcus sp. mb1 [TaxId: 51612]} Length = 347 Back     information, alignment and structure
>d1pjaa_ c.69.1.13 (A:) Palmitoyl protein thioesterase 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 268 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query308
d1q0ra_297 Aclacinomycin methylesterase RdmC {Streptomyces pu 100.0
d1bn7a_291 Haloalkane dehalogenase {Rhodococcus sp. [TaxId: 1 100.0
d1a88a_275 Chloroperoxidase L {Streptomyces lividans [TaxId: 100.0
d1imja_208 Ccg1/TafII250-interacting factor B (Cib) {Human (H 100.0
d1uk8a_271 Meta-cleavage product hydrolase CumD {Pseudomonas 100.0
d1zd3a2322 Mammalian epoxide hydrolase, C-terminal domain {Hu 100.0
d1b6ga_310 Haloalkane dehalogenase {Xanthobacter autotrophicu 100.0
d1mtza_290 Tricorn interacting factor F1 {Archaeon Thermoplas 100.0
d1a8qa_274 Bromoperoxidase A1 {Streptomyces aureofaciens [Tax 100.0
d1j1ia_268 Meta cleavage compound hydrolase CarC {Janthinobac 100.0
d1c4xa_281 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolas 100.0
d1a8sa_273 Chloroperoxidase F {Pseudomonas fluorescens [TaxId 100.0
d1brta_277 Bromoperoxidase A2 {Streptomyces aureofaciens [Tax 100.0
d1thta_302 Myristoyl-ACP-specific thioesterase {Vibrio harvey 100.0
d2rhwa1283 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolas 100.0
d1va4a_271 Arylesterase {Pseudomonas fluorescens [TaxId: 294] 100.0
d1xkla_258 Salicylic acid-binding protein 2 (SABP2) {Common t 100.0
d1hkha_279 Gamma-lactamase {Aureobacterium sp. [TaxId: 51671] 100.0
d1ehya_293 Bacterial epoxide hydrolase {Agrobacterium radioba 100.0
d1azwa_313 Proline iminopeptidase {Xanthomonas campestris, pv 100.0
d1m33a_256 Biotin biosynthesis protein BioH {Escherichia coli 100.0
d3c70a1256 Hydroxynitrile lyase {Rubber tree (Hevea brasilien 100.0
d1k8qa_377 Gastric lipase {Dog (Canis familiaris) [TaxId: 961 100.0
d1wm1a_313 Proline aminopeptidase {Serratia marcescens [TaxId 99.97
d1mj5a_298 Haloalkane dehalogenase {Sphingomonas paucimobilis 99.97
d1tqha_242 Carboxylesterase Est {Bacillus stearothermophilus 99.97
d2jbwa1360 2,6-dihydropseudooxynicotine hydrolase {Arthrobact 99.97
d1r3da_264 Hypothetical protein VC1974 {Vibrio cholerae [TaxI 99.97
d2fuka1218 XC6422 protein {Xanthomonas campestris [TaxId: 339 99.97
d1pjaa_268 Palmitoyl protein thioesterase 2 {Human (Homo sapi 99.96
d1qo7a_394 Bacterial epoxide hydrolase {Aspergillus niger [Ta 99.96
d1l7aa_318 Cephalosporin C deacetylase {Bacillus subtilis [Ta 99.95
d2hu7a2260 Acylamino-acid-releasing enzyme, C-terminal donain 99.95
d1uxoa_186 Hypothetical protein YdeN {Bacillus subtilis [TaxI 99.93
d1vlqa_322 Acetyl xylan esterase TM0077 {Thermotoga maritima 99.92
d1ufoa_238 Hypothetical protein TT1662 {Thermus thermophilus 99.92
d2bgra2258 Dipeptidyl peptidase IV/CD26, C-terminal domain {P 99.91
d1dina_233 Dienelactone hydrolase {Pseudomonas sp., B13 [TaxI 99.91
d2i3da1218 Hypothetical protein Atu1826 {Agrobacterium tumefa 99.9
d1ispa_179 Lipase A {Bacillus subtilis [TaxId: 1423]} 99.9
d2h7xa1283 Picromycin polyketide synthase {Streptomyces venez 99.89
d1xfda2258 Dipeptidyl aminopeptidase-like protein 6, DPP6, C- 99.89
d1jfra_260 Lipase {Streptomyces exfoliatus [TaxId: 1905]} 99.88
d2vata1376 Acetyl-CoA:deacetylcephalosporin C acetyltransfera 99.88
d1jmkc_230 Surfactin synthetase, SrfA {Bacillus subtilis [Tax 99.87
d1xkta_286 Fatty acid synthase {Human (Homo sapiens) [TaxId: 99.87
d1fj2a_229 Acyl protein thioesterase 1 {Human (Homo sapiens) 99.87
d2b61a1357 Homoserine O-acetyltransferase {Haemophilus influe 99.86
d2h1ia1202 Carboxylesterase {Bacillus cereus [TaxId: 1396]} 99.85
d3b5ea1209 Uncharacterized protein Mll8374 {Mesorhizobium lot 99.85
d2pl5a1362 Homoserine O-acetyltransferase {Leptospira interro 99.85
d1vkha_263 Putative serine hydrolase Ydr428c {Baker's yeast ( 99.85
d2r8ba1203 Uncharacterized protein Atu2452 {Agrobacterium tum 99.83
d2pbla1261 Uncharacterized protein TM1040_2492 {Silicibacter 99.83
d2dsta1122 Hypothetical protein TTHA1544 {Thermus thermophilu 99.81
d1qlwa_318 A novel bacterial esterase {Alcaligenes sp. [TaxId 99.8
d1mo2a_255 Erythromycin polyketide synthase {Saccharopolyspor 99.8
d1ju3a2347 Bacterial cocaine esterase N-terminal domain {Rhod 99.79
d1jkma_358 Carboxylesterase {Bacillus subtilis, brefeldin A e 99.78
d1cvla_319 Lipase {Chromobacterium viscosum [TaxId: 42739]} 99.78
d1tcaa_317 Triacylglycerol lipase {Yeast (Candida antarctica) 99.77
d1mpxa2381 Alpha-amino acid ester hydrolase {Xanthomonas citr 99.77
d1auoa_218 Carboxylesterase {Pseudomonas fluorescens [TaxId: 99.74
d1lnsa3405 X-Prolyl dipeptidyl aminopeptidase PepX, middle do 99.72
d1qfma2280 Prolyl oligopeptidase, C-terminal domain {Pig (Sus 99.72
d1lzla_317 Heroin esterase {Rhodococcus sp. [TaxId: 1831]} 99.72
d1ex9a_285 Lipase {Pseudomonas aeruginosa [TaxId: 287]} 99.7
d2b9va2385 Alpha-amino acid ester hydrolase {Acetobacter past 99.68
d1jjia_311 Carboxylesterase {Archaeon Archaeoglobus fulgidus 99.67
d1u4na_308 Carboxylesterase {Alicyclobacillus acidocaldarius 99.61
d1jjfa_255 Feruloyl esterase domain of the cellulosomal xylan 99.59
d1sfra_288 Antigen 85a {Mycobacterium tuberculosis [TaxId: 17 99.57
d3c8da2246 Enterochelin esterase, catalytic domain {Shigella 99.55
d1r88a_267 Antigen pt51/mpb51 {Mycobacterium tuberculosis [Ta 99.48
d1dqza_280 Antigen 85c {Mycobacterium tuberculosis [TaxId: 17 99.35
d1ei9a_279 Palmitoyl protein thioesterase 1 {Cow (Bos taurus) 99.35
d1rp1a2337 Pancreatic lipase, N-terminal domain {Dog (Canis f 99.34
d2gzsa1265 Enterobactin and salmochelin hydrolase IroE {Esche 99.33
d1bu8a2338 Pancreatic lipase, N-terminal domain {Rat (Rattus 99.3
d1wb4a1273 Feruloyl esterase domain of the cellulosomal xylan 99.29
d1pv1a_299 Hypothetical esterase YJL068C {Baker's yeast (Sacc 99.26
d1ivya_ 452 Human 'protective protein', HPP {Human (Homo sapie 99.08
d2d81a1 318 Polyhydroxybutyrate depolymerase {Penicillium funi 99.03
g1wht.1409 Serine carboxypeptidase II {Wheat (Triticum vulgar 99.01
d1wpxa1 421 Serine carboxypeptidase II {Baker's yeast (Sacchar 99.0
d1ku0a_388 Lipase L1 {Bacillus stearothermophilus [TaxId: 142 98.91
d1qe3a_ 483 Thermophilic para-nitrobenzyl esterase (PNB estera 98.55
g1gxs.1425 Hydroxynitrile lyase {Sorghum (Sorghum bicolor) [T 98.52
d1ac5a_ 483 Serine carboxypeptidase II {Baker's yeast (Sacchar 98.49
d1ea5a_ 532 Acetylcholinesterase {Pacific electric ray (Torped 98.49
d1p0ia_ 526 Butyryl cholinesterase {Human (Homo sapiens) [TaxI 98.42
d2ha2a1 542 Acetylcholinesterase {Mouse (Mus musculus) [TaxId: 98.41
d1llfa_ 534 Type-B carboxylesterase/lipase {Candida cylindrace 98.3
d2h7ca1 532 Mammalian carboxylesterase (liver carboxylesterase 98.29
d1thga_ 544 Type-B carboxylesterase/lipase {Fungus (Geotrichum 98.26
d1ukca_ 517 Esterase EstA {Aspergillus niger [TaxId: 5061]} 98.17
d1dx4a_ 571 Acetylcholinesterase {Fruit fly (Drosophila melano 97.94
d2bcea_ 579 Bile-salt activated lipase (cholesterol esterase) 97.86
d1cexa_197 Cutinase {Fungus (Fusarium solani), subsp. pisi [T 97.77
d1qoza_207 Acetylxylan esterase {Trichoderma reesei [TaxId: 5 97.04
d1lgya_265 Triacylglycerol lipase {Rhizopus niveus [TaxId: 48 96.98
d1uwca_261 Feruloyl esterase A {Aspergillus niger [TaxId: 506 96.91
d1tiba_269 Triacylglycerol lipase {Thermomyces lanuginosus, f 96.9
d1tiaa_271 Triacylglycerol lipase {Penicillium camembertii [T 96.9
d3tgla_265 Triacylglycerol lipase {Rhizomucor miehei [TaxId: 96.82
d1g66a_207 Acetylxylan esterase {Penicillium purpurogenum [Ta 96.79
>d1q0ra_ c.69.1.28 (A:) Aclacinomycin methylesterase RdmC {Streptomyces purpurascens [TaxId: 1924]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: alpha/beta-Hydrolases
superfamily: alpha/beta-Hydrolases
family: Aclacinomycin methylesterase RdmC
domain: Aclacinomycin methylesterase RdmC
species: Streptomyces purpurascens [TaxId: 1924]
Probab=100.00  E-value=4.2e-37  Score=240.48  Aligned_cols=256  Identities=18%  Similarity=0.129  Sum_probs=170.4

Q ss_pred             eEEcCCCcEEEEEEecCCCCCCCcceEEEEccCCCccchHHHHHHHHHHHcCCeEEEecCCCCcCCCCcc--ccCCCcch
Q 035721           35 YITNSRGLRLFTQWWTPLPPAKTLGVLCVVHGFTGESSWIVQLTAVLFAKSGFATCAIDHQGHGFSDGLV--AHIPDLNP  112 (308)
Q Consensus        35 ~~~~~~g~~l~~~~~~~~~~~~~~~~vv~~hG~~~~~~~~~~~~~~~l~~~g~~v~~~d~~G~G~s~~~~--~~~~~~~~  112 (308)
                      .+...+|.+|+|..+|+++    +|+|||+||++++...|...+.+.|.++||+|+++|+||||.|+...  ...+++++
T Consensus         3 ~~~~~g~~~i~y~~~G~~~----~p~vvl~HG~~~~~~~~~~~~~~~l~~~g~~vi~~D~~G~G~S~~~~~~~~~~~~~~   78 (297)
T d1q0ra_           3 RIVPSGDVELWSDDFGDPA----DPALLLVMGGNLSALGWPDEFARRLADGGLHVIRYDHRDTGRSTTRDFAAHPYGFGE   78 (297)
T ss_dssp             EEEEETTEEEEEEEESCTT----SCEEEEECCTTCCGGGSCHHHHHHHHTTTCEEEEECCTTSTTSCCCCTTTSCCCHHH
T ss_pred             eEEEECCEEEEEEEecCCC----CCEEEEECCCCcChhHHHHHHHHHHHhCCCEEEEEeCCCCcccccccccccccccch
Confidence            4557788999999998643    68899999999887744466888898899999999999999997643  23358999


Q ss_pred             HHHHHHHHHHHHHHhcCCCCCEEEEEechhhHHHHHHHHhcCCCccEEEEeCCcCCCCcCC--------------CCCch
Q 035721          113 VVEDAISFFDSFRARHAPDLPAFLYSESLGGAIALYITLRQKGAWDGLILNGAMCGISQKF--------------KPPWP  178 (308)
Q Consensus       113 ~~~d~~~~l~~~~~~~~~~~~~~l~G~S~Gg~~a~~~a~~~p~~v~~~vl~~~~~~~~~~~--------------~~~~~  178 (308)
                      +++|+..++++++.+     +++++||||||.+++.+|.++|++|+++|++++........              .....
T Consensus        79 ~~~d~~~ll~~l~~~-----~~~lvGhS~Gg~~a~~~a~~~P~~v~~lvli~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  153 (297)
T d1q0ra_          79 LAADAVAVLDGWGVD-----RAHVVGLSMGATITQVIALDHHDRLSSLTMLLGGGLDIDFDANIERVMRGEPTLDGLPGP  153 (297)
T ss_dssp             HHHHHHHHHHHTTCS-----SEEEEEETHHHHHHHHHHHHCGGGEEEEEEESCCCTTCCHHHHHHHHHHTCCCSSCSCCC
T ss_pred             hhhhhcccccccccc-----ceeeccccccchhhhhhhcccccceeeeEEEccccccccchhhhHHHhhhhhhhhhhhhh
Confidence            999999999998776     99999999999999999999999999999998754322100              00000


Q ss_pred             hhhhHHHhhhhCCCcccccCCCCCCCcccccHHHHHHHhhCCCCCCCcchH-HHHHHHHHH-----------------HH
Q 035721          179 LEHLLFTVAWLVPTWRVVPTRGSLPMVSFKEEWKRKLALSSPRRPVARPRA-ATALELLRV-----------------SR  240 (308)
Q Consensus       179 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~-----------------~~  240 (308)
                      ...............       ............................. .........                 ..
T Consensus       154 ~~~~~~~~~~~~~~~-------~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  226 (297)
T d1q0ra_         154 QQPFLDALALMNQPA-------EGRAAEVAKRVSKWRILSGTGVPFDDAEYARWEERAIDHAGGVLAEPYAHYSLTLPPP  226 (297)
T ss_dssp             CHHHHHHHHHHHSCC-------CSHHHHHHHHHHHHHHHHCSSSCCCHHHHHHHHHHHHHHTTTCCSCCCGGGGCCCCCG
T ss_pred             hHHHHHHHHHhcccc-------chhhHHHHHHHHHHhhhccccccchHHHHHHHHHHhhhhccccchhhhhhhhhhhccc
Confidence            000000000000000       00000000000000000000000000000 000000000                 01


Q ss_pred             HhhhhcCCCCcceEEEeeCCCcccChHHHHHHHHHhcCCCCcEEEecCCccccc-CCchhhHHHhhhcC
Q 035721          241 DLQGRFEEVEVPMLICHGGDDVVCDPACVEELYKRAASKDKTLSIYPGMWHQLI-GEPEENVELVFGEM  308 (308)
Q Consensus       241 ~~~~~~~~i~~P~l~i~g~~D~~~~~~~~~~~~~~~~~~~~~~~~~~~~gH~~~-~~~~~~~~~i~~~i  308 (308)
                      +....++++++|+++|+|++|.+++++.++.+.+.+  +++++++++++||+++ ++|+++++.|.++|
T Consensus       227 ~~~~~l~~i~~Pvlvi~G~~D~~~~~~~~~~~~~~~--p~~~~~~i~~~gH~~~~e~p~~~~~~i~~~l  293 (297)
T d1q0ra_         227 SRAAELREVTVPTLVIQAEHDPIAPAPHGKHLAGLI--PTARLAEIPGMGHALPSSVHGPLAEVILAHT  293 (297)
T ss_dssp             GGGGGGGGCCSCEEEEEETTCSSSCTTHHHHHHHTS--TTEEEEEETTCCSSCCGGGHHHHHHHHHHHH
T ss_pred             cchhhhhccCCceEEEEeCCCCCCCHHHHHHHHHhC--CCCEEEEECCCCCcchhhCHHHHHHHHHHHH
Confidence            233457789999999999999999999999999888  7899999999999999 99999999998763



>d1bn7a_ c.69.1.8 (A:) Haloalkane dehalogenase {Rhodococcus sp. [TaxId: 1831]} Back     information, alignment and structure
>d1a88a_ c.69.1.12 (A:) Chloroperoxidase L {Streptomyces lividans [TaxId: 1916]} Back     information, alignment and structure
>d1imja_ c.69.1.23 (A:) Ccg1/TafII250-interacting factor B (Cib) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uk8a_ c.69.1.10 (A:) Meta-cleavage product hydrolase CumD {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1zd3a2 c.69.1.11 (A:225-547) Mammalian epoxide hydrolase, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b6ga_ c.69.1.8 (A:) Haloalkane dehalogenase {Xanthobacter autotrophicus [TaxId: 280]} Back     information, alignment and structure
>d1mtza_ c.69.1.7 (A:) Tricorn interacting factor F1 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1a8qa_ c.69.1.12 (A:) Bromoperoxidase A1 {Streptomyces aureofaciens [TaxId: 1894]} Back     information, alignment and structure
>d1j1ia_ c.69.1.10 (A:) Meta cleavage compound hydrolase CarC {Janthinobacterium sp. J3 [TaxId: 213804]} Back     information, alignment and structure
>d1c4xa_ c.69.1.10 (A:) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) {Rhodococcus sp., strain rha1 [TaxId: 1831]} Back     information, alignment and structure
>d1a8sa_ c.69.1.12 (A:) Chloroperoxidase F {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1brta_ c.69.1.12 (A:) Bromoperoxidase A2 {Streptomyces aureofaciens [TaxId: 1894]} Back     information, alignment and structure
>d1thta_ c.69.1.13 (A:) Myristoyl-ACP-specific thioesterase {Vibrio harveyi [TaxId: 669]} Back     information, alignment and structure
>d2rhwa1 c.69.1.10 (A:4-286) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) {Burkholderia xenovorans [TaxId: 36873]} Back     information, alignment and structure
>d1va4a_ c.69.1.12 (A:) Arylesterase {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1xkla_ c.69.1.20 (A:) Salicylic acid-binding protein 2 (SABP2) {Common tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1hkha_ c.69.1.12 (A:) Gamma-lactamase {Aureobacterium sp. [TaxId: 51671]} Back     information, alignment and structure
>d1ehya_ c.69.1.11 (A:) Bacterial epoxide hydrolase {Agrobacterium radiobacter [TaxId: 358]} Back     information, alignment and structure
>d1azwa_ c.69.1.7 (A:) Proline iminopeptidase {Xanthomonas campestris, pv. citri [TaxId: 339]} Back     information, alignment and structure
>d1m33a_ c.69.1.26 (A:) Biotin biosynthesis protein BioH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3c70a1 c.69.1.20 (A:2-257) Hydroxynitrile lyase {Rubber tree (Hevea brasiliensis) [TaxId: 3981]} Back     information, alignment and structure
>d1k8qa_ c.69.1.6 (A:) Gastric lipase {Dog (Canis familiaris) [TaxId: 9615]} Back     information, alignment and structure
>d1wm1a_ c.69.1.7 (A:) Proline aminopeptidase {Serratia marcescens [TaxId: 615]} Back     information, alignment and structure
>d1mj5a_ c.69.1.8 (A:) Haloalkane dehalogenase {Sphingomonas paucimobilis, UT26, LinB [TaxId: 13689]} Back     information, alignment and structure
>d1tqha_ c.69.1.29 (A:) Carboxylesterase Est {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2jbwa1 c.69.1.41 (A:8-367) 2,6-dihydropseudooxynicotine hydrolase {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d1r3da_ c.69.1.35 (A:) Hypothetical protein VC1974 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d2fuka1 c.69.1.36 (A:3-220) XC6422 protein {Xanthomonas campestris [TaxId: 339]} Back     information, alignment and structure
>d1pjaa_ c.69.1.13 (A:) Palmitoyl protein thioesterase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qo7a_ c.69.1.11 (A:) Bacterial epoxide hydrolase {Aspergillus niger [TaxId: 5061]} Back     information, alignment and structure
>d1l7aa_ c.69.1.25 (A:) Cephalosporin C deacetylase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2hu7a2 c.69.1.33 (A:322-581) Acylamino-acid-releasing enzyme, C-terminal donain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1uxoa_ c.69.1.31 (A:) Hypothetical protein YdeN {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1vlqa_ c.69.1.25 (A:) Acetyl xylan esterase TM0077 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ufoa_ c.69.1.27 (A:) Hypothetical protein TT1662 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2bgra2 c.69.1.24 (A:509-766) Dipeptidyl peptidase IV/CD26, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1dina_ c.69.1.9 (A:) Dienelactone hydrolase {Pseudomonas sp., B13 [TaxId: 306]} Back     information, alignment and structure
>d2i3da1 c.69.1.36 (A:2-219) Hypothetical protein Atu1826 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1ispa_ c.69.1.18 (A:) Lipase A {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2h7xa1 c.69.1.22 (A:9-291) Picromycin polyketide synthase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1xfda2 c.69.1.24 (A:592-849) Dipeptidyl aminopeptidase-like protein 6, DPP6, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jfra_ c.69.1.16 (A:) Lipase {Streptomyces exfoliatus [TaxId: 1905]} Back     information, alignment and structure
>d2vata1 c.69.1.40 (A:7-382) Acetyl-CoA:deacetylcephalosporin C acetyltransferase CefG {Acremonium chrysogenum [TaxId: 5044]} Back     information, alignment and structure
>d1jmkc_ c.69.1.22 (C:) Surfactin synthetase, SrfA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1xkta_ c.69.1.22 (A:) Fatty acid synthase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fj2a_ c.69.1.14 (A:) Acyl protein thioesterase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b61a1 c.69.1.40 (A:2-358) Homoserine O-acetyltransferase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2h1ia1 c.69.1.14 (A:1-202) Carboxylesterase {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d3b5ea1 c.69.1.14 (A:7-215) Uncharacterized protein Mll8374 {Mesorhizobium loti [TaxId: 381]} Back     information, alignment and structure
>d2pl5a1 c.69.1.40 (A:5-366) Homoserine O-acetyltransferase {Leptospira interrogans [TaxId: 173]} Back     information, alignment and structure
>d1vkha_ c.69.1.32 (A:) Putative serine hydrolase Ydr428c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2r8ba1 c.69.1.14 (A:44-246) Uncharacterized protein Atu2452 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2pbla1 c.69.1.2 (A:1-261) Uncharacterized protein TM1040_2492 {Silicibacter sp. tm1040 [TaxId: 292414]} Back     information, alignment and structure
>d2dsta1 c.69.1.39 (A:2-123) Hypothetical protein TTHA1544 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1qlwa_ c.69.1.15 (A:) A novel bacterial esterase {Alcaligenes sp. [TaxId: 512]} Back     information, alignment and structure
>d1mo2a_ c.69.1.22 (A:) Erythromycin polyketide synthase {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1ju3a2 c.69.1.21 (A:5-351) Bacterial cocaine esterase N-terminal domain {Rhodococcus sp. mb1 [TaxId: 51612]} Back     information, alignment and structure
>d1jkma_ c.69.1.2 (A:) Carboxylesterase {Bacillus subtilis, brefeldin A esterase [TaxId: 1423]} Back     information, alignment and structure
>d1cvla_ c.69.1.18 (A:) Lipase {Chromobacterium viscosum [TaxId: 42739]} Back     information, alignment and structure
>d1tcaa_ c.69.1.17 (A:) Triacylglycerol lipase {Yeast (Candida antarctica), form b [TaxId: 34362]} Back     information, alignment and structure
>d1mpxa2 c.69.1.21 (A:24-404) Alpha-amino acid ester hydrolase {Xanthomonas citri [TaxId: 346]} Back     information, alignment and structure
>d1auoa_ c.69.1.14 (A:) Carboxylesterase {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1lnsa3 c.69.1.21 (A:146-550) X-Prolyl dipeptidyl aminopeptidase PepX, middle domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d1qfma2 c.69.1.4 (A:431-710) Prolyl oligopeptidase, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1lzla_ c.69.1.2 (A:) Heroin esterase {Rhodococcus sp. [TaxId: 1831]} Back     information, alignment and structure
>d1ex9a_ c.69.1.18 (A:) Lipase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2b9va2 c.69.1.21 (A:50-434) Alpha-amino acid ester hydrolase {Acetobacter pasteurianus [TaxId: 438]} Back     information, alignment and structure
>d1jjia_ c.69.1.2 (A:) Carboxylesterase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1u4na_ c.69.1.2 (A:) Carboxylesterase {Alicyclobacillus acidocaldarius [TaxId: 405212]} Back     information, alignment and structure
>d1jjfa_ c.69.1.2 (A:) Feruloyl esterase domain of the cellulosomal xylanase z {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1sfra_ c.69.1.3 (A:) Antigen 85a {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d3c8da2 c.69.1.2 (A:151-396) Enterochelin esterase, catalytic domain {Shigella flexneri 2a str. 2457T [TaxId: 198215]} Back     information, alignment and structure
>d1r88a_ c.69.1.3 (A:) Antigen pt51/mpb51 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1dqza_ c.69.1.3 (A:) Antigen 85c {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ei9a_ c.69.1.13 (A:) Palmitoyl protein thioesterase 1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1rp1a2 c.69.1.19 (A:1-336) Pancreatic lipase, N-terminal domain {Dog (Canis familiaris) [TaxId: 9615]} Back     information, alignment and structure
>d2gzsa1 c.69.1.38 (A:41-305) Enterobactin and salmochelin hydrolase IroE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1bu8a2 c.69.1.19 (A:1-336) Pancreatic lipase, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1wb4a1 c.69.1.2 (A:803-1075) Feruloyl esterase domain of the cellulosomal xylanase y {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1pv1a_ c.69.1.34 (A:) Hypothetical esterase YJL068C {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ivya_ c.69.1.5 (A:) Human 'protective protein', HPP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2d81a1 c.69.1.37 (A:21-338) Polyhydroxybutyrate depolymerase {Penicillium funiculosum [TaxId: 28572]} Back     information, alignment and structure
>d1wpxa1 c.69.1.5 (A:1-421) Serine carboxypeptidase II {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ku0a_ c.69.1.18 (A:) Lipase L1 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1qe3a_ c.69.1.1 (A:) Thermophilic para-nitrobenzyl esterase (PNB esterase) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1ac5a_ c.69.1.5 (A:) Serine carboxypeptidase II {Baker's yeast (Saccharomyces cerevisiae), kex1(delta)p [TaxId: 4932]} Back     information, alignment and structure
>d1ea5a_ c.69.1.1 (A:) Acetylcholinesterase {Pacific electric ray (Torpedo californica) [TaxId: 7787]} Back     information, alignment and structure
>d1p0ia_ c.69.1.1 (A:) Butyryl cholinesterase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ha2a1 c.69.1.1 (A:1-542) Acetylcholinesterase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1llfa_ c.69.1.17 (A:) Type-B carboxylesterase/lipase {Candida cylindracea, cholesterol esterase [TaxId: 44322]} Back     information, alignment and structure
>d2h7ca1 c.69.1.1 (A:1021-1553) Mammalian carboxylesterase (liver carboxylesterase I) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1thga_ c.69.1.17 (A:) Type-B carboxylesterase/lipase {Fungus (Geotrichum candidum), ATCC 34614 [TaxId: 27317]} Back     information, alignment and structure
>d1ukca_ c.69.1.17 (A:) Esterase EstA {Aspergillus niger [TaxId: 5061]} Back     information, alignment and structure
>d1dx4a_ c.69.1.1 (A:) Acetylcholinesterase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2bcea_ c.69.1.1 (A:) Bile-salt activated lipase (cholesterol esterase) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1cexa_ c.69.1.30 (A:) Cutinase {Fungus (Fusarium solani), subsp. pisi [TaxId: 169388]} Back     information, alignment and structure
>d1qoza_ c.69.1.30 (A:) Acetylxylan esterase {Trichoderma reesei [TaxId: 51453]} Back     information, alignment and structure
>d1lgya_ c.69.1.17 (A:) Triacylglycerol lipase {Rhizopus niveus [TaxId: 4844]} Back     information, alignment and structure
>d1uwca_ c.69.1.17 (A:) Feruloyl esterase A {Aspergillus niger [TaxId: 5061]} Back     information, alignment and structure
>d1tiba_ c.69.1.17 (A:) Triacylglycerol lipase {Thermomyces lanuginosus, formerly Humicola lanuginosa [TaxId: 5541]} Back     information, alignment and structure
>d1tiaa_ c.69.1.17 (A:) Triacylglycerol lipase {Penicillium camembertii [TaxId: 5075]} Back     information, alignment and structure
>d3tgla_ c.69.1.17 (A:) Triacylglycerol lipase {Rhizomucor miehei [TaxId: 4839]} Back     information, alignment and structure
>d1g66a_ c.69.1.30 (A:) Acetylxylan esterase {Penicillium purpurogenum [TaxId: 28575]} Back     information, alignment and structure