Citrus Sinensis ID: 036028

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190---
MLKRTTNGGFLIAEATGVFDTVQGYPNTPGIWTKEQVEAWKPIVDAVHQKGGTFFCQLWHVGRVSTFGLQPNGKAPISSTNKGVTPGLDGQDWSSPRPLRTEEIPQIVNDFRLAARNAIEAGDSNSDFSNLNYMLIFSIKSDVEGRRSYKQRKRLRQDRVERLHQWQEPPPPPFLFSLPTEWDSSISLTGSFT
ccccccccccEEcccccccccccccccccccccHHHHHHHHHHHHHHHHcccEEEEEccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHccccHHHHccccccHHHHHcccccccccHHHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHcccccc
cHHHcccccEEEEEEEEccccccccccccEcccHHHHHHHHHHHHHHHHccccEEEEEEcccccccHHHcHHHcccEEccccccccccccccccccEEccHHHHHHHHHHHHHHHHHHHHccccEEEEEccccHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHccccEEEEEccccccccccccccccc
mlkrttnggflIAEATgvfdtvqgypntpgiwtkEQVEAWKPIVDAVHQKGGTFFCQLWhvgrvstfglqpngkapisstnkgvtpgldgqdwssprplrteeipQIVNDFRLAARNAieagdsnsdfsnlNYMLIFSIKSDVEGRRSYKQRKRLRQDRVERLhqwqepppppflfslptewdssisltgsft
mlkrttnggfliaeatgvfdtvqGYPNTPGIWTKEQVEAWKPIVDAVHQKGGTFFCQLWHVGRVSTFGLQPNGKapisstnkgvtpgldgqdwssprplRTEEIPQIVNDFRLAARNAIEAgdsnsdfsnlNYMLIFsiksdvegrrsYKQRKRLRQDRVerlhqwqepppppflfslptewdssisltgsft
MLKRTTNGGFLIAEATGVFDTVQGYPNTPGIWTKEQVEAWKPIVDAVHQKGGTFFCQLWHVGRVSTFGLQPNGKAPISSTNKGVTPGLDGQDWSSPRPLRTEEIPQIVNDFRLAARNAIEAGDSNSDFSNLNYMLIFSIKSDVEGRRSYKQRKRLRQDRVERLHQWQEpppppflfslpTEWDSSISLTGSFT
*******GGFLIAEATGVFDTVQGYPNTPGIWTKEQVEAWKPIVDAVHQKGGTFFCQLWHVGRVSTFGL************************************QIVNDFRLAARNAIEA****SDFSNLNYMLIFSIK*****************************************************
*LKRTTNGGFLIAEATGVFDTVQGYPNTPGIWTKEQVEAWKPIVDAVHQKGGTFFCQLWHVGRVSTFGLQPNGKAPISSTNKGVTPGLDGQDWSSPRPLRTEEIPQIVNDFRLAARNAIEAGDSNSDFSNLNYMLIFSIKSDVEGRRSYKQRKRLRQDRVERLHQWQEPPPPPFLFSLPTEWDSSISLTGS**
MLKRTTNGGFLIAEATGVFDTVQGYPNTPGIWTKEQVEAWKPIVDAVHQKGGTFFCQLWHVGRVSTFGLQPNGKAPISSTNKGVTPGLDGQDWSSPRPLRTEEIPQIVNDFRLAARNAIEAGDSNSDFSNLNYMLIFSIKSDVEGRRSYKQRKRLRQDRVERLHQWQEPPPPPFLFSLPTEWDSS********
ML**TTNGGFLIAEATGVFDTVQGYPNTPGIWTKEQVEAWKPIVDAVHQKGGTFFCQLWHVGRVSTFGLQPNGKAPISSTNKGVTPGLDGQDWSSPRPLRTEEIPQIVNDFRLAARNAIEAGDSNSDFSNLNYMLIFSIKSDVEGRRSYKQRKRLRQDRVERLHQWQEPPPPPFLFSLPTEW***********
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLKRTTNGGFLIAEATGVFDTVQGYPNTPGIWTKEQVEAWKPIVDAVHQKGGTFFCQLWHVGRVSTFGLQPNGKAPISSTNKGVTPGLDGQDWSSPRPLRTEEIPQIVNDFRLAARNAIEAGDSNSDFSNLNYMLIFSIKSDVEGRRSYKQRKRLRQDRVERLHQWQEPPPPPFLFSLPTEWDSSISLTGSFT
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query193 2.2.26 [Sep-21-2011]
Q69TH8 380 Putative 12-oxophytodieno yes no 0.756 0.384 0.609 3e-46
B9FSC8 367 Putative 12-oxophytodieno no no 0.766 0.403 0.607 4e-46
Q69TI0 374 Putative 12-oxophytodieno no no 0.756 0.390 0.609 6e-46
Q0E0C6 406 Putative 12-oxophytodieno no no 0.746 0.354 0.610 1e-45
Q8LAH7 372 12-oxophytodienoate reduc yes no 0.756 0.392 0.615 1e-45
Q69TI2 391 Putative 12-oxophytodieno no no 0.756 0.373 0.602 4e-45
Q8GYB8 374 12-oxophytodienoate reduc no no 0.725 0.374 0.620 8e-45
Q69TH4 376 Putative 12-oxophytodieno no no 0.756 0.388 0.589 3e-44
Q84QK0 380 12-oxophytodienoate reduc no no 0.756 0.384 0.582 7e-44
Q9XG54 376 12-oxophytodienoate reduc N/A no 0.766 0.393 0.575 4e-43
>sp|Q69TH8|OPR4_ORYSJ Putative 12-oxophytodienoate reductase 4 OS=Oryza sativa subsp. japonica GN=OPR4 PE=2 SV=1 Back     alignment and function desciption
 Score =  184 bits (467), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 89/146 (60%), Positives = 107/146 (73%)

Query: 3   KRTTNGGFLIAEATGVFDTVQGYPNTPGIWTKEQVEAWKPIVDAVHQKGGTFFCQLWHVG 62
           +R T+GG L+ EATGV DT QGYP+TPGIWT++QVEAWKPIVDAVH+KG  F CQLWHVG
Sbjct: 57  QRATSGGLLVTEATGVSDTAQGYPDTPGIWTQQQVEAWKPIVDAVHRKGALFICQLWHVG 116

Query: 63  RVSTFGLQPNGKAPISSTNKGVTPGLDGQDWSSPRPLRTEEIPQIVNDFRLAARNAIEAG 122
           RVST   QP+G+APISST++ +TP   G  +S PR LRTEEIPQI++DFR AARNAIEAG
Sbjct: 117 RVSTNEYQPDGQAPISSTDRQITPDDSGIVYSKPRRLRTEEIPQIIDDFRRAARNAIEAG 176

Query: 123 DSNSDFSNLNYMLIFSIKSDVEGRRS 148
               +    +  L+     D    RS
Sbjct: 177 FDGVEIHGAHGYLLEQFMKDSANDRS 202
Putative oxophytodienoate reductase that may be involved in the biosynthesis or metabolism of oxylipin signaling molecules.
Oryza sativa subsp. japonica (taxid: 39947)
EC: 1EC: .EC: 3EC: .EC: 1EC: .EC: -
>sp|B9FSC8|OPR11_ORYSJ Putative 12-oxophytodienoate reductase 11 OS=Oryza sativa subsp. japonica GN=OPR11 PE=2 SV=1 Back     alignment and function description
>sp|Q69TI0|OPR5_ORYSJ Putative 12-oxophytodienoate reductase 5 OS=Oryza sativa subsp. japonica GN=OPR5 PE=2 SV=1 Back     alignment and function description
>sp|Q0E0C6|OPR8_ORYSJ Putative 12-oxophytodienoate reductase 8 OS=Oryza sativa subsp. japonica GN=OPR8 PE=2 SV=1 Back     alignment and function description
>sp|Q8LAH7|OPR1_ARATH 12-oxophytodienoate reductase 1 OS=Arabidopsis thaliana GN=OPR1 PE=1 SV=2 Back     alignment and function description
>sp|Q69TI2|OPR6_ORYSJ Putative 12-oxophytodienoate reductase 6 OS=Oryza sativa subsp. japonica GN=OPR6 PE=2 SV=1 Back     alignment and function description
>sp|Q8GYB8|OPR2_ARATH 12-oxophytodienoate reductase 2 OS=Arabidopsis thaliana GN=OPR2 PE=2 SV=2 Back     alignment and function description
>sp|Q69TH4|OPR2_ORYSJ Putative 12-oxophytodienoate reductase 2 OS=Oryza sativa subsp. japonica GN=OPR2 PE=3 SV=1 Back     alignment and function description
>sp|Q84QK0|OPR1_ORYSJ 12-oxophytodienoate reductase 1 OS=Oryza sativa subsp. japonica GN=OPR1 PE=2 SV=1 Back     alignment and function description
>sp|Q9XG54|OPR1_SOLLC 12-oxophytodienoate reductase 1 OS=Solanum lycopersicum GN=OPR1 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query193
224120070 365 predicted protein [Populus trichocarpa] 0.756 0.4 0.684 6e-53
224102617 365 predicted protein [Populus trichocarpa] 0.756 0.4 0.678 4e-52
224108255169 predicted protein [Populus trichocarpa] 0.621 0.710 0.791 8e-52
449441806 368 PREDICTED: LOW QUALITY PROTEIN: 12-oxoph 0.896 0.470 0.565 7e-48
449524545 376 PREDICTED: 12-oxophytodienoate reductase 0.834 0.428 0.593 1e-47
224135727 370 predicted protein [Populus trichocarpa] 0.725 0.378 0.648 2e-47
296089414 543 unnamed protein product [Vitis vinifera] 0.746 0.265 0.64 5e-47
296089416 318 unnamed protein product [Vitis vinifera] 0.746 0.452 0.646 1e-46
147778557 379 hypothetical protein VITISV_033920 [Viti 0.834 0.424 0.587 1e-46
225460244 379 PREDICTED: 12-oxophytodienoate reductase 0.834 0.424 0.593 1e-46
>gi|224120070|ref|XP_002331129.1| predicted protein [Populus trichocarpa] gi|222872857|gb|EEF09988.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  212 bits (540), Expect = 6e-53,   Method: Compositional matrix adjust.
 Identities = 100/146 (68%), Positives = 115/146 (78%)

Query: 3   KRTTNGGFLIAEATGVFDTVQGYPNTPGIWTKEQVEAWKPIVDAVHQKGGTFFCQLWHVG 62
           +R TNGGFLI+EAT V DT QGYP TPGIWT+EQV+AWKPIVDAVH+KGG  FCQ+WHVG
Sbjct: 50  QRATNGGFLISEATVVSDTAQGYPETPGIWTEEQVKAWKPIVDAVHEKGGILFCQIWHVG 109

Query: 63  RVSTFGLQPNGKAPISSTNKGVTPGLDGQDWSSPRPLRTEEIPQIVNDFRLAARNAIEAG 122
           RVST+G QPNG+APIS T+KGVTPGLDG+DWS PR LR +E+P+IVNDFRLAARNAIEAG
Sbjct: 110 RVSTYGFQPNGEAPISCTDKGVTPGLDGEDWSPPRRLRADELPRIVNDFRLAARNAIEAG 169

Query: 123 DSNSDFSNLNYMLIFSIKSDVEGRRS 148
               +    N  LI     D    R+
Sbjct: 170 FDGVEIHGANGYLIDQFLKDQVNDRT 195

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224102617|ref|XP_002312749.1| predicted protein [Populus trichocarpa] gi|222852569|gb|EEE90116.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224108255|ref|XP_002333415.1| predicted protein [Populus trichocarpa] gi|222836506|gb|EEE74913.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|449441806|ref|XP_004138673.1| PREDICTED: LOW QUALITY PROTEIN: 12-oxophytodienoate reductase 1-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449524545|ref|XP_004169282.1| PREDICTED: 12-oxophytodienoate reductase 1-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|224135727|ref|XP_002327289.1| predicted protein [Populus trichocarpa] gi|222835659|gb|EEE74094.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|296089414|emb|CBI39233.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|296089416|emb|CBI39235.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|147778557|emb|CAN60665.1| hypothetical protein VITISV_033920 [Vitis vinifera] Back     alignment and taxonomy information
>gi|225460244|ref|XP_002281348.1| PREDICTED: 12-oxophytodienoate reductase 2 isoform 1 [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query193
TAIR|locus:2030086 397 OPR1 "12-oxophytodienoate redu 0.621 0.302 0.704 2.5e-42
TAIR|locus:2030096 374 OPR2 "12-oxophytodienoate redu 0.746 0.385 0.606 2.5e-42
UNIPROTKB|Q84QK0 380 OPR1 "12-oxophytodienoate redu 0.746 0.378 0.593 8.4e-42
TAIR|locus:2012285324 AT1G09400 [Arabidopsis thalian 0.756 0.450 0.557 1.3e-38
TAIR|locus:2030948269 AT1G17990 [Arabidopsis thalian 0.740 0.531 0.527 1.9e-35
TAIR|locus:1005716725269 AT1G18020 [Arabidopsis thalian 0.740 0.531 0.527 1.9e-35
UNIPROTKB|Q6Z965 394 OPR7 "12-oxophytodienoate redu 0.746 0.365 0.473 6.2e-30
TAIR|locus:2051516 391 OPR3 "oxophytodienoate-reducta 0.746 0.368 0.464 1e-29
UNIPROTKB|C5H429 387 DBR2 "Artemisinic aldehyde Del 0.746 0.372 0.453 1.6e-29
UNIPROTKB|Q4KCX1 366 nemA "N-ethylmaleimide reducta 0.725 0.382 0.434 2e-24
TAIR|locus:2030086 OPR1 "12-oxophytodienoate reductase 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 448 (162.8 bits), Expect = 2.5e-42, P = 2.5e-42
 Identities = 88/125 (70%), Positives = 98/125 (78%)

Query:     3 KRTTNGGFLIAEATGVFDTVQGYPNTPGIWTKEQVEAWKPIVDAVHQKGGTFFCQLWHVG 62
             +RTT GGFLI EATGV DT QGY +TPGIWTKE VEAWKPIVDAVH KGG FFCQ+WHVG
Sbjct:    52 QRTTPGGFLITEATGVSDTAQGYQDTPGIWTKEHVEAWKPIVDAVHAKGGIFFCQIWHVG 111

Query:    63 RVSTFGLQPNGKAPISSTNKGVTP-----GLDGQDWSSPRPLRTEEIPQIVNDFRLAARN 117
             RVS  G QPNGKAPIS ++K + P     G+D   ++ PR L  EEIP IVNDFRLAARN
Sbjct:   112 RVSNSGFQPNGKAPISCSDKPLMPQIRSNGIDEALFTPPRRLGIEEIPGIVNDFRLAARN 171

Query:   118 AIEAG 122
             A+EAG
Sbjct:   172 AMEAG 176
GO:0003824 "catalytic activity" evidence=IEA
GO:0005737 "cytoplasm" evidence=ISM
GO:0010150 "leaf senescence" evidence=TAS
GO:0010181 "FMN binding" evidence=IEA
GO:0016491 "oxidoreductase activity" evidence=IEA
GO:0055114 "oxidation-reduction process" evidence=IEA
GO:0009611 "response to wounding" evidence=IEP
GO:0009695 "jasmonic acid biosynthetic process" evidence=TAS
GO:0006629 "lipid metabolic process" evidence=TAS
GO:0009751 "response to salicylic acid stimulus" evidence=IEP
GO:0046686 "response to cadmium ion" evidence=IEP
GO:0016629 "12-oxophytodienoate reductase activity" evidence=ISS;IDA
GO:0005829 "cytosol" evidence=IDA
GO:0031407 "oxylipin metabolic process" evidence=IDA
TAIR|locus:2030096 OPR2 "12-oxophytodienoate reductase 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q84QK0 OPR1 "12-oxophytodienoate reductase 1" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
TAIR|locus:2012285 AT1G09400 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2030948 AT1G17990 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:1005716725 AT1G18020 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q6Z965 OPR7 "12-oxophytodienoate reductase 7" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
TAIR|locus:2051516 OPR3 "oxophytodienoate-reductase 3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|C5H429 DBR2 "Artemisinic aldehyde Delta(11(13)) reductase" [Artemisia annua (taxid:35608)] Back     alignment and assigned GO terms
UNIPROTKB|Q4KCX1 nemA "N-ethylmaleimide reductase" [Pseudomonas protegens Pf-5 (taxid:220664)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
eugene3.01500041
hypothetical protein (366 aa)
(Populus trichocarpa)
Predicted Functional Partners:
eugene3.32700002
annotation not avaliable (310 aa)
 •      0.417

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query193
cd02933 338 cd02933, OYE_like_FMN, Old yellow enzyme (OYE)-lik 2e-53
PLN02411 391 PLN02411, PLN02411, 12-oxophytodienoate reductase 8e-47
PRK10605 362 PRK10605, PRK10605, N-ethylmaleimide reductase; Pr 7e-38
COG1902 363 COG1902, NemA, NADH:flavin oxidoreductases, Old Ye 9e-33
cd02803 327 cd02803, OYE_like_FMN_family, Old yellow enzyme (O 7e-29
pfam00724 336 pfam00724, Oxidored_FMN, NADH:flavin oxidoreductas 4e-24
cd02932336 cd02932, OYE_YqiM_FMN, Old yellow enzyme (OYE) Yqj 3e-17
cd04747 361 cd04747, OYE_like_5_FMN, Old yellow enzyme (OYE)-r 5e-17
cd04734 343 cd04734, OYE_like_3_FMN, Old yellow enzyme (OYE)-r 6e-13
cd04735 353 cd04735, OYE_like_4_FMN, Old yellow enzyme (OYE)-r 7e-13
cd02930 353 cd02930, DCR_FMN, 2,4-dienoyl-CoA reductase (DCR) 3e-12
PRK13523 337 PRK13523, PRK13523, NADPH dehydrogenase NamA; Prov 4e-09
PRK08255 765 PRK08255, PRK08255, salicylyl-CoA 5-hydroxylase; R 4e-09
cd04733 338 cd04733, OYE_like_2_FMN, Old yellow enzyme (OYE)-r 5e-07
cd02929 370 cd02929, TMADH_HD_FMN, Trimethylamine dehydrogenas 2e-04
>gnl|CDD|239243 cd02933, OYE_like_FMN, Old yellow enzyme (OYE)-like FMN binding domain Back     alignment and domain information 
 Score =  173 bits (440), Expect = 2e-53
 Identities = 65/118 (55%), Positives = 74/118 (62%), Gaps = 4/118 (3%)

Query: 9   GFLIAEATGVFDTVQGYPNTPGIWTKEQVEAWKPIVDAVHQKGGTFFCQLWHVGRVSTFG 68
           G +I EAT +    QGYPNTPGI+T EQVE WK + DAVH KGG  F QLWHVGRVS   
Sbjct: 48  GLIITEATQISPQGQGYPNTPGIYTDEQVEGWKKVTDAVHAKGGKIFLQLWHVGRVSHPS 107

Query: 69  LQPNGKAPISST----NKGVTPGLDGQDWSSPRPLRTEEIPQIVNDFRLAARNAIEAG 122
           L P G  P++ +       V        + +PR L TEEIP IV DFR AARNAIEAG
Sbjct: 108 LLPGGAPPVAPSAIAAEGKVFTPAGKVPYPTPRALTTEEIPGIVADFRQAARNAIEAG 165

OYE was the first flavin-dependent enzyme identified, however its true physiological role remains elusive to this day. Each monomer of OYE contains FMN as a non-covalently bound cofactor, uses NADPH as a reducing agent with oxygens, quinones, and alpha,beta-unsaturated aldehydes and ketones, and can act as electron acceptors in the catalytic reaction. Members of OYE family include 12-oxophytodienoate reductase, pentaerythritol tetranitrate reductase, morphinone reductase, and related enzymes. Length = 338
>gnl|CDD|178033 PLN02411, PLN02411, 12-oxophytodienoate reductase Back     alignment and domain information
>gnl|CDD|182584 PRK10605, PRK10605, N-ethylmaleimide reductase; Provisional Back     alignment and domain information
>gnl|CDD|224814 COG1902, NemA, NADH:flavin oxidoreductases, Old Yellow Enzyme family [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|239201 cd02803, OYE_like_FMN_family, Old yellow enzyme (OYE)-like FMN binding domain Back     alignment and domain information
>gnl|CDD|216083 pfam00724, Oxidored_FMN, NADH:flavin oxidoreductase / NADH oxidase family Back     alignment and domain information
>gnl|CDD|239242 cd02932, OYE_YqiM_FMN, Old yellow enzyme (OYE) YqjM-like FMN binding domain Back     alignment and domain information
>gnl|CDD|240095 cd04747, OYE_like_5_FMN, Old yellow enzyme (OYE)-related FMN binding domain, group 5 Back     alignment and domain information
>gnl|CDD|240085 cd04734, OYE_like_3_FMN, Old yellow enzyme (OYE)-related FMN binding domain, group 3 Back     alignment and domain information
>gnl|CDD|240086 cd04735, OYE_like_4_FMN, Old yellow enzyme (OYE)-related FMN binding domain, group 4 Back     alignment and domain information
>gnl|CDD|239240 cd02930, DCR_FMN, 2,4-dienoyl-CoA reductase (DCR) FMN-binding domain Back     alignment and domain information
>gnl|CDD|184110 PRK13523, PRK13523, NADPH dehydrogenase NamA; Provisional Back     alignment and domain information
>gnl|CDD|236203 PRK08255, PRK08255, salicylyl-CoA 5-hydroxylase; Reviewed Back     alignment and domain information
>gnl|CDD|240084 cd04733, OYE_like_2_FMN, Old yellow enzyme (OYE)-related FMN binding domain, group 2 Back     alignment and domain information
>gnl|CDD|239239 cd02929, TMADH_HD_FMN, Trimethylamine dehydrogenase (TMADH) and histamine dehydrogenase (HD) FMN-binding domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 193
COG1902 363 NemA NADH:flavin oxidoreductases, Old Yellow Enzym 100.0
PF00724 341 Oxidored_FMN: NADH:flavin oxidoreductase / NADH ox 100.0
PLN02411 391 12-oxophytodienoate reductase 100.0
PRK10605 362 N-ethylmaleimide reductase; Provisional 100.0
cd04735 353 OYE_like_4_FMN Old yellow enzyme (OYE)-related FMN 100.0
cd02929 370 TMADH_HD_FMN Trimethylamine dehydrogenase (TMADH) 100.0
cd04733338 OYE_like_2_FMN Old yellow enzyme (OYE)-related FMN 100.0
cd04734 343 OYE_like_3_FMN Old yellow enzyme (OYE)-related FMN 100.0
cd04747 361 OYE_like_5_FMN Old yellow enzyme (OYE)-related FMN 100.0
cd02933338 OYE_like_FMN Old yellow enzyme (OYE)-like FMN bind 100.0
PRK13523 337 NADPH dehydrogenase NamA; Provisional 100.0
cd02930 353 DCR_FMN 2,4-dienoyl-CoA reductase (DCR) FMN-bindin 100.0
cd02932336 OYE_YqiM_FMN Old yellow enzyme (OYE) YqjM-like FMN 100.0
cd02803327 OYE_like_FMN_family Old yellow enzyme (OYE)-like F 100.0
cd02931 382 ER_like_FMN Enoate reductase (ER)-like FMN-binding 100.0
PRK08255 765 salicylyl-CoA 5-hydroxylase; Reviewed 100.0
KOG0134 400 consensus NADH:flavin oxidoreductase/12-oxophytodi 100.0
cd04740 296 DHOD_1B_like Dihydroorotate dehydrogenase (DHOD) c 98.97
cd02801231 DUS_like_FMN Dihydrouridine synthase-like (DUS-lik 98.97
PRK11815 333 tRNA-dihydrouridine synthase A; Provisional 98.59
TIGR00737 319 nifR3_yhdG putative TIM-barrel protein, nifR3 fami 98.58
PRK10550 312 tRNA-dihydrouridine synthase C; Provisional 98.53
PRK07259 301 dihydroorotate dehydrogenase 1B; Reviewed 98.5
TIGR01037 300 pyrD_sub1_fam dihydroorotate dehydrogenase (subfam 98.47
cd02810 289 DHOD_DHPD_FMN Dihydroorotate dehydrogenase (DHOD) 98.2
cd03316 357 MR_like Mandelate racemase (MR)-like subfamily of 97.67
TIGR00742 318 yjbN tRNA dihydrouridine synthase A. Members of th 97.63
cd04722200 TIM_phosphate_binding TIM barrel proteins share a 97.53
cd04739 325 DHOD_like Dihydroorotate dehydrogenase (DHOD) like 97.33
PRK10415 321 tRNA-dihydrouridine synthase B; Provisional 96.76
PRK05286 344 dihydroorotate dehydrogenase 2; Reviewed 96.37
cd04741 294 DHOD_1A_like Dihydroorotate dehydrogenase (DHOD) c 95.77
cd02940 299 DHPD_FMN Dihydropyrimidine dehydrogenase (DHPD) FM 95.35
cd04738 327 DHOD_2_like Dihydroorotate dehydrogenase (DHOD) cl 95.09
COG0042 323 tRNA-dihydrouridine synthase [Translation, ribosom 94.66
PLN02495 385 oxidoreductase, acting on the CH-CH group of donor 94.59
PRK07565 334 dihydroorotate dehydrogenase 2; Reviewed 94.05
PRK08318 420 dihydropyrimidine dehydrogenase subunit B; Validat 93.97
cd02911233 arch_FMN Archeal FMN-binding domain. This family o 92.85
cd00945201 Aldolase_Class_I Class I aldolases. The class I al 91.93
cd03329 368 MR_like_4 Mandelate racemase (MR)-like subfamily o 90.89
PF01207 309 Dus: Dihydrouridine synthase (Dus); InterPro: IPR0 89.3
PRK09196 347 fructose-1,6-bisphosphate aldolase; Reviewed 89.28
PF01180 295 DHO_dh: Dihydroorotate dehydrogenase; InterPro: IP 88.93
TIGR01036 335 pyrD_sub2 dihydroorotate dehydrogenase, subfamily 88.23
PRK02506 310 dihydroorotate dehydrogenase 1A; Reviewed 87.56
TIGR02708367 L_lactate_ox L-lactate oxidase. Members of this pr 85.4
cd00003234 PNPsynthase Pyridoxine 5'-phosphate (PNP) synthase 84.19
PF03437 254 BtpA: BtpA family; InterPro: IPR005137 Photosystem 84.11
PF07745 332 Glyco_hydro_53: Glycosyl hydrolase family 53; Inte 82.77
TIGR01370315 cysRS possible cysteinyl-tRNA synthetase, Methanoc 82.75
PF13200 316 DUF4015: Putative glycosyl hydrolase domain 82.68
PRK13399 347 fructose-1,6-bisphosphate aldolase; Provisional 82.07
TIGR00559237 pdxJ pyridoxine 5'-phosphate synthase. PdxJ is req 80.57
COG1908132 FrhD Coenzyme F420-reducing hydrogenase, delta sub 80.49
>COG1902 NemA NADH:flavin oxidoreductases, Old Yellow Enzyme family [Energy production and conversion] Back     alignment and domain information 
Probab=100.00  E-value=5.4e-58  Score=401.39  Aligned_cols=183  Identities=29%  Similarity=0.503  Sum_probs=164.6

Q ss_pred             CccccCC-ccEEEeCCceeCCCCCCCCCCccCCCHHhHHhHHHHHHHHHhcCCeEEEcccCCccccCCCCCCCCCCcccc
Q 036028            1 MLKRTTN-GGFLIAEATGVFDTVQGYPNTPGIWTKEQVEAWKPIVDAVHQKGGTFFCQLWHVGRVSTFGLQPNGKAPISS   79 (193)
Q Consensus         1 y~~rA~G-~GlIi~~~~~V~~~~~~~~~~~~i~~~~~i~~~~~l~~~vh~~G~~i~~QL~h~G~~~~~~~~~~~~~~~~p   79 (193)
                      |++||+| +||||+|.+.|++.++.+++++++|+|+++++|++++++||++|+++++||+|+||++..... ....+++|
T Consensus        45 y~~RA~gG~Glii~~~~~v~~~g~~~~~~~~l~~d~~i~~~~~vt~avH~~G~~i~iQL~H~Gr~~~~~~~-~~~~~vap  123 (363)
T COG1902          45 YAERAKGGAGLIITEATAVDPGGRGYPGQPGLWSDAQIPGLKRLTEAVHAHGAKIFIQLWHAGRKARASHP-WLPSAVAP  123 (363)
T ss_pred             HHHHhcCCCCEEEEeeEeeCcccccCCCCCccCChhHhHHHHHHHHHHHhcCCeEEEEeccCccccccccc-CCCcccCC
Confidence            7899998 799999999999999999999999999999999999999999999999999999999765431 12568899


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHhCCCeEEE-ecchhhHHhhcCCCCCCCC-----Chhhhh
Q 036028           80 TNKGVTPGLDGQDWSSPRPLRTEEIPQIVNDFRLAARNAIEAGDSNSDF-SNLNYMLIFSIKSDVEGRR-----SYKQRK  153 (193)
Q Consensus        80 S~~~~~~~~~g~~~~~~~~mt~~eI~~ii~~f~~AA~~a~~AGfDgVEI-~ahGyLl~qFlSp~~N~Rt-----s~eNR~  153 (193)
                      |+++...   + ....|++||++||+++|++|++||+||++|||||||| +||||||+|||||.+|+||     |+|||+
T Consensus       124 S~~~~~~---~-~~~~pr~mt~~eI~~ii~~f~~AA~rA~~AGFDgVEIH~AhGYLi~qFlsp~tN~RtD~YGGSlENR~  199 (363)
T COG1902         124 SAIPAPG---G-RRATPRELTEEEIEEVIEDFARAARRAKEAGFDGVEIHGAHGYLLSQFLSPLTNKRTDEYGGSLENRA  199 (363)
T ss_pred             Ccccccc---C-CCCCCccCCHHHHHHHHHHHHHHHHHHHHcCCCEEEEeeccchHHHHhcCCccCCCCCccCCcHHHHH
Confidence            9877652   1 1357999999999999999999999999999999999 9999999999999999999     999999


Q ss_pred             hHHHHHHHHHHHhcCCCCCcEEEEc-CcCC-CC-Ccccc
Q 036028          154 RLRQDRVERLHQWQEPPPPPFLFSL-PTEW-DS-SISLT  189 (193)
Q Consensus       154 Rf~~Eii~aIR~~vg~~~~~~~~ri-~~e~-~~-~~~~~  189 (193)
                      ||++||+++||+++|+ +++|++|| ++|| .+ +.+++
T Consensus       200 Rf~~EVv~aVr~~vg~-~~~vg~Rls~~d~~~~~g~~~~  237 (363)
T COG1902         200 RFLLEVVDAVREAVGA-DFPVGVRLSPDDFFDGGGLTIE  237 (363)
T ss_pred             HHHHHHHHHHHHHhCC-CceEEEEECccccCCCCCCCHH
Confidence            9999999999999998 59999999 8888 44 44443

>PF00724 Oxidored_FMN: NADH:flavin oxidoreductase / NADH oxidase family; InterPro: IPR001155 The TIM-barrel fold is a closed barrel structure composed of an eight-fold repeat of beta-alpha units, where the eight parallel beta strands on the inside are covered by the eight alpha helices on the outside [] Back     alignment and domain information
>PLN02411 12-oxophytodienoate reductase Back     alignment and domain information
>PRK10605 N-ethylmaleimide reductase; Provisional Back     alignment and domain information
>cd04735 OYE_like_4_FMN Old yellow enzyme (OYE)-related FMN binding domain, group 4 Back     alignment and domain information
>cd02929 TMADH_HD_FMN Trimethylamine dehydrogenase (TMADH) and histamine dehydrogenase (HD) FMN-binding domain Back     alignment and domain information
>cd04733 OYE_like_2_FMN Old yellow enzyme (OYE)-related FMN binding domain, group 2 Back     alignment and domain information
>cd04734 OYE_like_3_FMN Old yellow enzyme (OYE)-related FMN binding domain, group 3 Back     alignment and domain information
>cd04747 OYE_like_5_FMN Old yellow enzyme (OYE)-related FMN binding domain, group 5 Back     alignment and domain information
>cd02933 OYE_like_FMN Old yellow enzyme (OYE)-like FMN binding domain Back     alignment and domain information
>PRK13523 NADPH dehydrogenase NamA; Provisional Back     alignment and domain information
>cd02930 DCR_FMN 2,4-dienoyl-CoA reductase (DCR) FMN-binding domain Back     alignment and domain information
>cd02932 OYE_YqiM_FMN Old yellow enzyme (OYE) YqjM-like FMN binding domain Back     alignment and domain information
>cd02803 OYE_like_FMN_family Old yellow enzyme (OYE)-like FMN binding domain Back     alignment and domain information
>cd02931 ER_like_FMN Enoate reductase (ER)-like FMN-binding domain Back     alignment and domain information
>PRK08255 salicylyl-CoA 5-hydroxylase; Reviewed Back     alignment and domain information
>KOG0134 consensus NADH:flavin oxidoreductase/12-oxophytodienoate reductase [Energy production and conversion; General function prediction only] Back     alignment and domain information
>cd04740 DHOD_1B_like Dihydroorotate dehydrogenase (DHOD) class 1B FMN-binding domain Back     alignment and domain information
>cd02801 DUS_like_FMN Dihydrouridine synthase-like (DUS-like) FMN-binding domain Back     alignment and domain information
>PRK11815 tRNA-dihydrouridine synthase A; Provisional Back     alignment and domain information
>TIGR00737 nifR3_yhdG putative TIM-barrel protein, nifR3 family Back     alignment and domain information
>PRK10550 tRNA-dihydrouridine synthase C; Provisional Back     alignment and domain information
>PRK07259 dihydroorotate dehydrogenase 1B; Reviewed Back     alignment and domain information
>TIGR01037 pyrD_sub1_fam dihydroorotate dehydrogenase (subfamily 1) family protein Back     alignment and domain information
>cd02810 DHOD_DHPD_FMN Dihydroorotate dehydrogenase (DHOD) and Dihydropyrimidine dehydrogenase (DHPD) FMN-binding domain Back     alignment and domain information
>cd03316 MR_like Mandelate racemase (MR)-like subfamily of the enolase superfamily Back     alignment and domain information
>TIGR00742 yjbN tRNA dihydrouridine synthase A Back     alignment and domain information
>cd04722 TIM_phosphate_binding TIM barrel proteins share a structurally conserved phosphate binding motif and in general share an eight beta/alpha closed barrel structure Back     alignment and domain information
>cd04739 DHOD_like Dihydroorotate dehydrogenase (DHOD) like proteins Back     alignment and domain information
>PRK10415 tRNA-dihydrouridine synthase B; Provisional Back     alignment and domain information
>PRK05286 dihydroorotate dehydrogenase 2; Reviewed Back     alignment and domain information
>cd04741 DHOD_1A_like Dihydroorotate dehydrogenase (DHOD) class 1A FMN-binding domain Back     alignment and domain information
>cd02940 DHPD_FMN Dihydropyrimidine dehydrogenase (DHPD) FMN-binding domain Back     alignment and domain information
>cd04738 DHOD_2_like Dihydroorotate dehydrogenase (DHOD) class 2 Back     alignment and domain information
>COG0042 tRNA-dihydrouridine synthase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PLN02495 oxidoreductase, acting on the CH-CH group of donors Back     alignment and domain information
>PRK07565 dihydroorotate dehydrogenase 2; Reviewed Back     alignment and domain information
>PRK08318 dihydropyrimidine dehydrogenase subunit B; Validated Back     alignment and domain information
>cd02911 arch_FMN Archeal FMN-binding domain Back     alignment and domain information
>cd00945 Aldolase_Class_I Class I aldolases Back     alignment and domain information
>cd03329 MR_like_4 Mandelate racemase (MR)-like subfamily of the enolase superfamily, subgroup 4 Back     alignment and domain information
>PF01207 Dus: Dihydrouridine synthase (Dus); InterPro: IPR001269 Members of this family catalyse the reduction of the 5,6-double bond of a uridine residue on tRNA Back     alignment and domain information
>PRK09196 fructose-1,6-bisphosphate aldolase; Reviewed Back     alignment and domain information
>PF01180 DHO_dh: Dihydroorotate dehydrogenase; InterPro: IPR012135 Dihydroorotate dehydrogenase (DHOD), also known as dihydroorotate oxidase, catalyses the fourth step in de novo pyrimidine biosynthesis, the stereospecific oxidation of (S)-dihydroorotate to orotate, which is the only redox reaction in this pathway Back     alignment and domain information
>TIGR01036 pyrD_sub2 dihydroorotate dehydrogenase, subfamily 2 Back     alignment and domain information
>PRK02506 dihydroorotate dehydrogenase 1A; Reviewed Back     alignment and domain information
>TIGR02708 L_lactate_ox L-lactate oxidase Back     alignment and domain information
>cd00003 PNPsynthase Pyridoxine 5'-phosphate (PNP) synthase domain; pyridoxal 5'-phosphate is the active form of vitamin B6 that acts as an essential, ubiquitous coenzyme in amino acid metabolism Back     alignment and domain information
>PF03437 BtpA: BtpA family; InterPro: IPR005137 Photosystem I (PSI) is a large protein complex embedded within the photosynthetic thylakoid membrane Back     alignment and domain information
>PF07745 Glyco_hydro_53: Glycosyl hydrolase family 53; InterPro: IPR011683 O-Glycosyl hydrolases 3 Back     alignment and domain information
>TIGR01370 cysRS possible cysteinyl-tRNA synthetase, Methanococcus type Back     alignment and domain information
>PF13200 DUF4015: Putative glycosyl hydrolase domain Back     alignment and domain information
>PRK13399 fructose-1,6-bisphosphate aldolase; Provisional Back     alignment and domain information
>TIGR00559 pdxJ pyridoxine 5'-phosphate synthase Back     alignment and domain information
>COG1908 FrhD Coenzyme F420-reducing hydrogenase, delta subunit [Energy production and conversion] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query193
1vji_A 372 Gene Product Of At1g76680 From Arabidopsis Thaliana 5e-47
1icp_A 376 Crystal Structure Of 12-Oxophytodienoate Reductase 5e-44
1q45_A 391 12-0xo-Phytodienoate Reductase Isoform 3 Length = 3 3e-32
3hgo_A 402 Crystal Structure Of The F74yH244Y OPR3 DOUBLE MUTA 8e-31
2hs6_A 402 Crystal Structure Of The E291k Mutant Of 12- Oxophy 2e-30
2hs8_A 402 Crystal Structure Of The Y364f Mutant Of 12- Oxophy 3e-30
4a3u_A 358 X-Structure Of The Old Yellow Enzyme Homologue From 2e-24
3p82_A 365 H184n Mutant Of Pentaerythritol Tetranitrate Reduct 1e-22
2r14_A 377 Structure Of Morphinone Reductase In Complex With T 2e-22
3gx9_A 377 Structure Of Morphinone Reductase N189a Mutant In C 2e-22
3p74_A 373 H181n Mutant Of Pentaerythritol Tetranitrate Reduct 4e-22
2abb_A 364 Structure Of Petn Reductase Y186f In Complex With C 4e-22
3p67_A 373 T26s Mutant Of Pentaerythritol Tetranitrate Reducta 5e-22
3p7y_A 365 Pentaerythritol Tetranitrate Reductase Co-Crystal S 5e-22
3p62_A 373 Wild-Type Pentaerythritol Tetranitrate Reductase Co 5e-22
3p8i_A 365 Y351f Mutant Of Pentaerythritol Tetranitrate Reduct 5e-22
3p8j_A 365 Y351s Mutant Of Pentaerythritol Tetranitrate Reduct 5e-22
1h50_A 364 Stucture Of Pentaerythritol Tetranitrate Reductase 5e-22
3p84_A 365 Y351a Mutant Of Pentaerythritol Tetranitrate Reduct 5e-22
1gwj_A 377 Morphinone Reductase Length = 377 2e-21
1vys_X 364 Stucture Of Pentaerythritol Tetranitrate Reductase 3e-21
1vyp_X 364 Stucture Of Pentaerythritol Tetranitrate Reductase 4e-21
3gka_A 361 Crystal Structure Of N-Ethylmaleimidine Reductase F 8e-21
4ab4_A 362 Structure Of Xenobiotic Reductase B From Pseudomona 4e-20
2gou_A 365 Structure Of Wild Type, Oxidized Sye1, An Oye Homol 7e-20
3aty_A 379 Crystal Structure Of Tcoye Length = 379 1e-11
3tjl_A 407 Crystal Structure Of A Novel Oye From The Xylose-Fe 6e-09
4df2_A 407 P. Stipitis Oye2.6 Complexed With P-Chlorophenol Le 6e-09
1bwk_A 399 Old Yellow Enzyme (Oye1) Mutant H191n Length = 399 1e-08
1oya_A 400 Old Yellow Enzyme At 2 Angstroms Resolution: Overal 2e-08
3kru_A 343 Crystal Structure Of The Thermostable Old Yellow En 2e-08
3krz_A 337 Crystal Structure Of The Thermostable Nadh4-Bound O 2e-08
1bwl_A 399 Old Yellow Enzyme (Oye1) Double Mutant H191n:n194h 5e-08
1k02_A 399 Crystal Structure Of Old Yellow Enzyme Mutant Gln11 8e-08
4gwe_A 400 W116l-Oye1 Complexed With (R)-Carvone Length = 400 3e-07
3txz_A 400 Oye1-W116q Complexed With R-Carvone Length = 400 5e-07
4gbu_A 400 Oye1-W116a In Complex With Aromatic Product Of S-Ca 5e-07
4ge8_A 400 Oye1-W116i Complexed With (S)-Carvone Length = 400 5e-07
3rnd_A 399 W116i-Oye1 Complexed With 2-(Hydroxymethyl)-Cyclope 5e-07
3n14_A 363 Xena - W358a Length = 363 7e-06
3l5l_A 363 Xenobiotic Reductase A - Oxidized Length = 363 7e-06
3n16_A 363 Xena - Y183f Length = 363 7e-06
3l67_A 363 Xenobiotic Reductase A - C25s Variant Length = 363 7e-06
3l65_A 363 Xenobiotic Reductase A - C25a Mutant Length = 363 8e-06
2h8z_A 359 Xenobiotic Reductase A In Complex With 8-Hydroxycou 9e-06
2h8x_A 358 Xenobiotic Reductase A-Oxidized Length = 358 9e-06
3gr7_A 340 Structure Of Oye From Geobacillus Kaustophilus, Hex 4e-05
3hf3_A 349 Old Yellow Enzyme From Thermus Scotoductus Sa-01 Le 9e-05
1z41_A 338 Crystal Structure Of Oxidized Yqjm From Bacillus Su 1e-04
1ps9_A 671 The Crystal Structure And Reaction Mechanism Of E. 2e-04
>pdb|1VJI|A Chain A, Gene Product Of At1g76680 From Arabidopsis Thaliana Length = 372 Back     alignment and structure 
Iteration: 1

 Score =  183 bits (464), Expect = 5e-47,   Method: Compositional matrix adjust.
 Identities = 93/151 (61%), Positives = 105/151 (69%), Gaps = 5/151 (3%)
Query: 3   KRTTNGGFLIAEATGVFDTVQGYPNTPGIWTKEQVEAWKPIVDAVHQKGGTFFCQLWHVG 62
           +RTT GGFLI EATGV DT QGY +TPGIWTKE VEAWKPIVDAVH KGG FFCQ+WHVG
Sbjct: 52  QRTTPGGFLITEATGVSDTAQGYQDTPGIWTKEHVEAWKPIVDAVHAKGGIFFCQIWHVG 111
Query: 63  RVSTFGLQPNGKAPISSTNKGVTP-----GLDGQDWSSPRPLRTEEIPQIVNDFRLAARN 117
           RVS  G QPNGKAPIS ++K + P     G+D   ++ PR L  EEIP IVNDFRLAARN
Sbjct: 112 RVSNSGFQPNGKAPISCSDKPLMPQIRSNGIDEALFTPPRRLGIEEIPGIVNDFRLAARN 171
Query: 118 AIEAGDSNSDFSNLNYMLIFSIKSDVEGRRS 148
           A+EAG    +    N  LI     D    R+
Sbjct: 172 AMEAGFDGVEIHGANGYLIDQFMKDTVNDRT 202
>pdb|1ICP|A Chain A, Crystal Structure Of 12-Oxophytodienoate Reductase 1 From Tomato Complexed With Peg400 Length = 376 Back     alignment and structure
>pdb|1Q45|A Chain A, 12-0xo-Phytodienoate Reductase Isoform 3 Length = 391 Back     alignment and structure
>pdb|3HGO|A Chain A, Crystal Structure Of The F74yH244Y OPR3 DOUBLE MUTANT FROM Tomato Length = 402 Back     alignment and structure
>pdb|2HS6|A Chain A, Crystal Structure Of The E291k Mutant Of 12- Oxophytodienoate Reductase 3 (Opr3) From Tomato Length = 402 Back     alignment and structure
>pdb|2HS8|A Chain A, Crystal Structure Of The Y364f Mutant Of 12- Oxophytodienoate Reductase 3 From Tomato Length = 402 Back     alignment and structure
>pdb|4A3U|A Chain A, X-Structure Of The Old Yellow Enzyme Homologue From Zymomonas Mobilis (Ncr) Length = 358 Back     alignment and structure
>pdb|3P82|A Chain A, H184n Mutant Of Pentaerythritol Tetranitrate Reductase Containing Bound Acetate Ion Length = 365 Back     alignment and structure
>pdb|2R14|A Chain A, Structure Of Morphinone Reductase In Complex With Tetrahydronad Length = 377 Back     alignment and structure
>pdb|3GX9|A Chain A, Structure Of Morphinone Reductase N189a Mutant In Complex With Tetrahydronad Length = 377 Back     alignment and structure
>pdb|3P74|A Chain A, H181n Mutant Of Pentaerythritol Tetranitrate Reductase Containing A C- Terminal His8-Tag Length = 373 Back     alignment and structure
>pdb|2ABB|A Chain A, Structure Of Petn Reductase Y186f In Complex With Cyanide Length = 364 Back     alignment and structure
>pdb|3P67|A Chain A, T26s Mutant Of Pentaerythritol Tetranitrate Reductase Containing A Bound Acetate Molecule Length = 373 Back     alignment and structure
>pdb|3P7Y|A Chain A, Pentaerythritol Tetranitrate Reductase Co-Crystal Structure With Bound (E)-1-(2'-Hydroxyphenyl)-2-Nitroethene Length = 365 Back     alignment and structure
>pdb|3P62|A Chain A, Wild-Type Pentaerythritol Tetranitrate Reductase Containing A C- Terminal 8-Histidine Tag Length = 373 Back     alignment and structure
>pdb|3P8I|A Chain A, Y351f Mutant Of Pentaerythritol Tetranitrate Reductase Containing A Bound Acetate Molecule Length = 365 Back     alignment and structure
>pdb|3P8J|A Chain A, Y351s Mutant Of Pentaerythritol Tetranitrate Reductase Containing A Bound Acetate Molecule Length = 365 Back     alignment and structure
>pdb|1H50|A Chain A, Stucture Of Pentaerythritol Tetranitrate Reductase And Complexes Length = 364 Back     alignment and structure
>pdb|3P84|A Chain A, Y351a Mutant Of Pentaerythritol Tetranitrate Reductase Containing A Bound Acetate Molecule Length = 365 Back     alignment and structure
>pdb|1GWJ|A Chain A, Morphinone Reductase Length = 377 Back     alignment and structure
>pdb|1VYS|X Chain X, Stucture Of Pentaerythritol Tetranitrate Reductase W102y Mutant And Complexed With Picric Acid Length = 364 Back     alignment and structure
>pdb|1VYP|X Chain X, Stucture Of Pentaerythritol Tetranitrate Reductase W102f Mutant And Complexed With Picric Acid Length = 364 Back     alignment and structure
>pdb|3GKA|A Chain A, Crystal Structure Of N-Ethylmaleimidine Reductase From Burkholderia Pseudomallei Length = 361 Back     alignment and structure
>pdb|4AB4|A Chain A, Structure Of Xenobiotic Reductase B From Pseudomonas Putida In Complex With Tnt Length = 362 Back     alignment and structure
>pdb|2GOU|A Chain A, Structure Of Wild Type, Oxidized Sye1, An Oye Homologue From S. Oneidensis Length = 365 Back     alignment and structure
>pdb|3ATY|A Chain A, Crystal Structure Of Tcoye Length = 379 Back     alignment and structure
>pdb|3TJL|A Chain A, Crystal Structure Of A Novel Oye From The Xylose-Fermenting Fungus P. Stipitis Length = 407 Back     alignment and structure
>pdb|4DF2|A Chain A, P. Stipitis Oye2.6 Complexed With P-Chlorophenol Length = 407 Back     alignment and structure
>pdb|1BWK|A Chain A, Old Yellow Enzyme (Oye1) Mutant H191n Length = 399 Back     alignment and structure
>pdb|1OYA|A Chain A, Old Yellow Enzyme At 2 Angstroms Resolution: Overall Structure, Ligand Binding And Comparison With Related Flavoproteins Length = 400 Back     alignment and structure
>pdb|3KRU|A Chain A, Crystal Structure Of The Thermostable Old Yellow Enzyme From Thermoanaerobacter Pseudethanolicus E39 Length = 343 Back     alignment and structure
>pdb|3KRZ|A Chain A, Crystal Structure Of The Thermostable Nadh4-Bound Old Yellow Enzyme From Thermoanaerobacter Pseudethanolicus E39 Length = 337 Back     alignment and structure
>pdb|1BWL|A Chain A, Old Yellow Enzyme (Oye1) Double Mutant H191n:n194h Length = 399 Back     alignment and structure
>pdb|1K02|A Chain A, Crystal Structure Of Old Yellow Enzyme Mutant Gln114asn Length = 399 Back     alignment and structure
>pdb|4GWE|A Chain A, W116l-Oye1 Complexed With (R)-Carvone Length = 400 Back     alignment and structure
>pdb|3TXZ|A Chain A, Oye1-W116q Complexed With R-Carvone Length = 400 Back     alignment and structure
>pdb|4GBU|A Chain A, Oye1-W116a In Complex With Aromatic Product Of S-Carvone Dismutation Length = 400 Back     alignment and structure
>pdb|4GE8|A Chain A, Oye1-W116i Complexed With (S)-Carvone Length = 400 Back     alignment and structure
>pdb|3RND|A Chain A, W116i-Oye1 Complexed With 2-(Hydroxymethyl)-Cyclopent-2-Enone Length = 399 Back     alignment and structure
>pdb|3N14|A Chain A, Xena - W358a Length = 363 Back     alignment and structure
>pdb|3L5L|A Chain A, Xenobiotic Reductase A - Oxidized Length = 363 Back     alignment and structure
>pdb|3N16|A Chain A, Xena - Y183f Length = 363 Back     alignment and structure
>pdb|3L67|A Chain A, Xenobiotic Reductase A - C25s Variant Length = 363 Back     alignment and structure
>pdb|3L65|A Chain A, Xenobiotic Reductase A - C25a Mutant Length = 363 Back     alignment and structure
>pdb|2H8Z|A Chain A, Xenobiotic Reductase A In Complex With 8-Hydroxycoumarin Length = 359 Back     alignment and structure
>pdb|2H8X|A Chain A, Xenobiotic Reductase A-Oxidized Length = 358 Back     alignment and structure
>pdb|3GR7|A Chain A, Structure Of Oye From Geobacillus Kaustophilus, Hexagonal Crystal Form Length = 340 Back     alignment and structure
>pdb|3HF3|A Chain A, Old Yellow Enzyme From Thermus Scotoductus Sa-01 Length = 349 Back     alignment and structure
>pdb|1Z41|A Chain A, Crystal Structure Of Oxidized Yqjm From Bacillus Subtilis Length = 338 Back     alignment and structure
>pdb|1PS9|A Chain A, The Crystal Structure And Reaction Mechanism Of E. Coli 2,4- Dienoyl Coa Reductase Length = 671 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query193
1icp_A 376 OPR1, 12-oxophytodienoate reductase 1; beta-alpha- 2e-66
2hsa_B 402 12-oxophytodienoate reductase 3; alpha beta 8 barr 5e-64
1vyr_A 364 Pentaerythritol tetranitrate reductase; oxidoreduc 3e-62
2r14_A 377 Morphinone reductase; H-tunnelling, flavoprotein, 1e-61
3rnd_A 399 NADPH dehydrogenase 1; TIM barrel, oxidoreductase; 3e-60
3gka_A 361 N-ethylmaleimide reductase; decode biostructures, 1e-59
2gou_A 365 Oxidoreductase, FMN-binding; OLD yeallow enzyme, f 5e-59
3tjl_A 407 NADPH dehydrogenase; OLD yellow enzyme, flavin mon 9e-58
3aty_A 379 Tcoye, prostaglandin F2A synthase; alpha/beta barr 2e-55
3l5a_A 419 NADH/flavin oxidoreductase/NADH oxidase; OLD yello 1e-37
3kru_A 343 NADH:flavin oxidoreductase/NADH oxidase; homotetra 2e-20
3hgj_A 349 Chromate reductase; TIM barrel, oxidoreductase; HE 3e-20
1z41_A 338 YQJM, probable NADH-dependent flavin oxidoreductas 8e-20
3gr7_A 340 NADPH dehydrogenase; flavin, FMN, beta-alpha-barre 1e-19
1ps9_A 671 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel 1e-19
1o94_A 729 Tmadh, trimethylamine dehydrogenase; electron tran 3e-19
3l5l_A 363 Xenobiotic reductase A; TIM barrel, oxidoreductase 5e-19
3k30_A 690 Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP bi 8e-19
>1icp_A OPR1, 12-oxophytodienoate reductase 1; beta-alpha-barrel, protein-FMN-PEG complex, oxidoreductase; HET: FMN 2PE; 1.90A {Solanum lycopersicum} SCOP: c.1.4.1 PDB: 1icq_A* 1ics_A* 3hgr_A* 1vji_A* 2q3r_A* Length = 376 Back     alignment and structure
 Score =  207 bits (528), Expect = 2e-66
 Identities = 79/124 (63%), Positives = 94/124 (75%), Gaps = 5/124 (4%)

Query: 4   RTTNGGFLIAEATGVFDTVQGYPNTPGIWTKEQVEAWKPIVDAVHQKGGTFFCQLWHVGR 63
           R+TNGG LI EAT + +T  GY + PGIWTKEQVEAWKPIVDAVH KGG FFCQ+WHVGR
Sbjct: 57  RSTNGGLLIGEATVISETGIGYKDVPGIWTKEQVEAWKPIVDAVHAKGGIFFCQIWHVGR 116

Query: 64  VSTFGLQPNGKAPISST-----NKGVTPGLDGQDWSSPRPLRTEEIPQIVNDFRLAARNA 118
           VS    QPNG+ PIS T      + ++ G+D   ++ PR L T+EIPQIVN+FR+AARNA
Sbjct: 117 VSNKDFQPNGEDPISCTDRGLTPQIMSNGIDIAHFTRPRRLTTDEIPQIVNEFRVAARNA 176

Query: 119 IEAG 122
           IEAG
Sbjct: 177 IEAG 180
>2hsa_B 12-oxophytodienoate reductase 3; alpha beta 8 barrel, flavoprotein, jasmonate biosynthesis, oxidoreductase; HET: FMN; 1.50A {Solanum lycopersicum} PDB: 2hs6_A* 3hgs_A* 2hs8_A* 3hgo_A* 1q45_A* 2g5w_A* 2q3o_A* Length = 402 Back     alignment and structure
>1vyr_A Pentaerythritol tetranitrate reductase; oxidoreductase, flavoenzyme, explosive degradation, steroid binding; HET: FMN TNF; 0.9A {Enterobacter cloacae} SCOP: c.1.4.1 PDB: 1gvq_A* 1gvr_A* 1gvs_A* 1h50_A* 1h51_A* 1h60_A* 1h61_A* 1h62_A* 1h63_A* 1gvo_A* 2aba_A* 3f03_K* 3kft_A* 3p7y_A* 3p80_A* 3p81_A* 3p62_A* 3p8i_A* 2abb_A* 3p67_A* ... Length = 364 Back     alignment and structure
>2r14_A Morphinone reductase; H-tunnelling, flavoprotein, NADH, hydride transfer, oxidoreductase; HET: FMN TXD; 1.40A {Pseudomonas putida} PDB: 3gx9_A* 1gwj_A* Length = 377 Back     alignment and structure
>3rnd_A NADPH dehydrogenase 1; TIM barrel, oxidoreductase; HET: FMN 3RN; 1.40A {Saccharomyces pastorianus} PDB: 1oya_A* 1oyb_A* 1oyc_A* 3tx9_A* 1k02_A* 1k03_A* 1bwk_A* 1bwl_A* Length = 399 Back     alignment and structure
>3gka_A N-ethylmaleimide reductase; decode biostructures, ssgcid, niaid, targetdb bupsa00093A, structural genomics; HET: FMN; 2.30A {Burkholderia pseudomallei} Length = 361 Back     alignment and structure
>2gou_A Oxidoreductase, FMN-binding; OLD yeallow enzyme, flavoenzyme; HET: BOG FMN PE4; 1.40A {Shewanella oneidensis} PDB: 2gq8_A* 2gq9_A* 2gqa_A* Length = 365 Back     alignment and structure
>3tjl_A NADPH dehydrogenase; OLD yellow enzyme, flavin mononucleotide, TIM barrel, NADPH oxidoreductase, enone reductase; HET: FMN; 1.50A {Scheffersomyces stipitis cbs 6054} PDB: 3upw_A* 4df2_A* Length = 407 Back     alignment and structure
>3aty_A Tcoye, prostaglandin F2A synthase; alpha/beta barrel, oxidoreductase, flavin mononucleotide; HET: FMN; 1.70A {Trypanosoma cruzi} PDB: 3atz_A* Length = 379 Back     alignment and structure
>3l5a_A NADH/flavin oxidoreductase/NADH oxidase; OLD yellow enzyme family, OYE-like FMN-binding domain, TIM B oxidoreductase; HET: PGE; 1.65A {Staphylococcus aureus} Length = 419 Back     alignment and structure
>3kru_A NADH:flavin oxidoreductase/NADH oxidase; homotetramer, dimer of dimers, TIM barrel, thermophilic, OLD enzyme; HET: FMN; 1.60A {Thermoanaerobacter pseudethanolicus AT} PDB: 3krz_A* Length = 343 Back     alignment and structure
>3hgj_A Chromate reductase; TIM barrel, oxidoreductase; HET: FMN; 2.00A {Thermus scotoductus} PDB: 3hf3_A* Length = 349 Back     alignment and structure
>1z41_A YQJM, probable NADH-dependent flavin oxidoreductase YQJ; FMN, beta-alpha-barrel; HET: FMN; 1.30A {Bacillus subtilis} SCOP: c.1.4.1 PDB: 1z42_A* 1z44_A* 1z48_A* Length = 338 Back     alignment and structure
>3gr7_A NADPH dehydrogenase; flavin, FMN, beta-alpha-barrel, oxidoreductase, flavoprotein; HET: FMN; 2.30A {Geobacillus kaustophilus} PDB: 3gr8_A* Length = 340 Back     alignment and structure
>1ps9_A 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel, flavodoxin, flavin, electron transfer, hydride transfer, oxidoreductase; HET: FAD FMN NAP MDE; 2.20A {Escherichia coli} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 Length = 671 Back     alignment and structure
>1o94_A Tmadh, trimethylamine dehydrogenase; electron transport, protein complex; HET: FMN ADP AMP; 2.0A {Methylophilus methylotrophus} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 PDB: 1djn_A* 1o95_A* 2tmd_A* 1djq_A* Length = 729 Back     alignment and structure
>3l5l_A Xenobiotic reductase A; TIM barrel, oxidoreductase; HET: BU3 FMN; 1.03A {Pseudomonas putida} PDB: 3l5m_A* 3n19_B* 3n16_A* 3l68_A* 3l67_A* 3l65_A* 3l66_A* 3n14_A* 2h8z_A* 2h90_A* 2h8x_A* Length = 363 Back     alignment and structure
>3k30_A Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP binding site, oxidoreductase; HET: FMN ADP; 2.70A {Pimelobacter simplex} Length = 690 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query193
4gbu_A 400 NADPH dehydrogenase 1; alpha/beta barrel, enenone 100.0
4a3u_A 358 NCR, NADH\:flavin oxidoreductase/NADH oxidase; HET 100.0
3kru_A 343 NADH:flavin oxidoreductase/NADH oxidase; homotetra 100.0
3hgj_A 349 Chromate reductase; TIM barrel, oxidoreductase; HE 100.0
3l5l_A 363 Xenobiotic reductase A; TIM barrel, oxidoreductase 100.0
3l5a_A 419 NADH/flavin oxidoreductase/NADH oxidase; OLD yello 100.0
3gr7_A 340 NADPH dehydrogenase; flavin, FMN, beta-alpha-barre 100.0
3gka_A 361 N-ethylmaleimide reductase; decode biostructures, 100.0
4ab4_A 362 Xenobiotic reductase B; oxidoreductase, OLD yellow 100.0
3tjl_A 407 NADPH dehydrogenase; OLD yellow enzyme, flavin mon 100.0
2hsa_B 402 12-oxophytodienoate reductase 3; alpha beta 8 barr 100.0
1icp_A 376 OPR1, 12-oxophytodienoate reductase 1; beta-alpha- 100.0
3aty_A 379 Tcoye, prostaglandin F2A synthase; alpha/beta barr 100.0
2r14_A 377 Morphinone reductase; H-tunnelling, flavoprotein, 100.0
3k30_A 690 Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP bi 100.0
1vyr_A 364 Pentaerythritol tetranitrate reductase; oxidoreduc 100.0
1z41_A 338 YQJM, probable NADH-dependent flavin oxidoreductas 100.0
2gou_A 365 Oxidoreductase, FMN-binding; OLD yeallow enzyme, f 100.0
1o94_A 729 Tmadh, trimethylamine dehydrogenase; electron tran 100.0
1ps9_A 671 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel 100.0
1vhn_A 318 Putative flavin oxidoreducatase; structural genomi 99.32
3b0p_A 350 TRNA-dihydrouridine synthase; TIM barrel, oxidored 99.29
1f76_A 336 Dihydroorotate dehydrogenase; monomer, alpha-beta- 99.07
1ep3_A 311 Dihydroorotate dehydrogenase B (PYRD subunit); het 98.55
2gl5_A 410 Putative dehydratase protein; structural genomics, 98.44
2o56_A 407 Putative mandelate racemase; dehydratase, structur 98.43
2ox4_A 403 Putative mandelate racemase; enolase, dehydratase, 98.33
2poz_A 392 Putative dehydratase; octamer, structural genomics 98.28
1jub_A 311 Dihydroorotate dehydrogenase A; homodimer, alpha-b 98.0
2e6f_A 314 Dihydroorotate dehydrogenase; chagas disease, pyri 97.79
3p3b_A 392 Mandelate racemase/muconate lactonizing protein; e 97.7
1rvk_A 382 Isomerase/lactonizing enzyme; enolase superfamily, 97.51
2qq6_A 410 Mandelate racemase/muconate lactonizing enzyme- li 97.46
1tv5_A 443 Dhodehase, dihydroorotate dehydrogenase homolog, m 97.43
2og9_A 393 Mandelate racemase/muconate lactonizing enzyme; NY 97.22
2rdx_A 379 Mandelate racemase/muconate lactonizing enzyme, P; 97.11
2nql_A 388 AGR_PAT_674P, isomerase/lactonizing enzyme; enolas 96.91
1gte_A 1025 Dihydropyrimidine dehydrogenase; electron transfer 96.81
2pp0_A 398 L-talarate/galactarate dehydratase; enolase superf 96.8
2pgw_A 384 Muconate cycloisomerase; enolase superfamily, octa 96.78
3stp_A 412 Galactonate dehydratase, putative; PSI biology, st 96.74
1mdl_A 359 Mandelate racemase; isomerase, mandelate pathway, 96.62
2qgy_A 391 Enolase from the environmental genome shotgun sequ 96.58
2ovl_A 371 Putative racemase; structural genomics, PSI-2, pro 96.51
2qdd_A 378 Mandelate racemase/muconate lactonizing enzyme; en 96.42
2gdq_A 382 YITF; mandelate racemase/muconate lactonizing enzy 96.37
3bjs_A 428 Mandelate racemase/muconate lactonizing enzyme; en 96.33
2oz8_A 389 MLL7089 protein; structural genomics, unknown func 96.31
2ps2_A 371 Putative mandelate racemase/muconate lactonizing e 96.29
2qde_A 397 Mandelate racemase/muconate lactonizing enzyme FA 96.14
2p8b_A 369 Mandelate racemase/muconate lactonizing enzyme fam 96.04
2hzg_A 401 Mandelate racemase/muconate lactonizing enzyme/EN 95.91
1tzz_A 392 Hypothetical protein L1841; structural genomics, m 95.69
2hxt_A 441 L-fuconate dehydratase; enolase superfamily, D-ery 95.67
1nu5_A 370 Chloromuconate cycloisomerase; enzyme, dehalogenat 95.37
4ef8_A 354 Dihydroorotate dehydrogenase; phenyl isothiocyanat 95.13
1sjd_A 368 N-acylamino acid racemase; lyase, isomerase; HET: 94.96
2zad_A 345 Muconate cycloisomerase; muconate lactonizing enzy 94.87
3oix_A 345 Putative dihydroorotate dehydrogenase; dihydrooro 94.86
1tkk_A 366 Similar to chloromuconate cycloisomerase; epimeras 94.7
1jcn_A 514 Inosine monophosphate dehydrogenase I; IMPD, IMPDH 93.09
4hnl_A 421 Mandelate racemase/muconate lactonizing enzyme; de 92.99
1fob_A 334 Beta-1,4-galactanase; B/A barrel, glycosyl hydrola 92.84
3rcy_A 433 Mandelate racemase/muconate lactonizing enzyme-LI 92.68
3sjn_A 374 Mandelate racemase/muconate lactonizing protein; e 92.24
2nli_A 368 Lactate oxidase; flavoenzyme, FMN, D-lactate, oxid 91.04
1vrd_A 494 Inosine-5'-monophosphate dehydrogenase; TM1347, st 89.79
1kbi_A 511 Cytochrome B2, L-LCR; flavocytochrome B2, electron 89.37
3go2_A 409 Putative L-alanine-DL-glutamate epimerase; structu 88.4
3r2g_A 361 Inosine 5'-monophosphate dehydrogenase; structural 87.97
3tji_A 422 Mandelate racemase/muconate lactonizing enzyme, N 87.78
3ozy_A 389 Putative mandelate racemase; beta-alpha barrel, en 87.16
3sbf_A 401 Mandelate racemase / muconate lactonizing enzyme; 86.6
1eep_A 404 Inosine 5'-monophosphate dehydrogenase; alpha-beta 86.41
4e4f_A 426 Mannonate dehydratase; magnesium binding, enzyme f 85.97
1p0k_A 349 Isopentenyl-diphosphate delta-isomerase; terpene b 85.47
2zc8_A 369 N-acylamino acid racemase; octamer, TIM beta/alpha 82.93
1r0m_A 375 N-acylamino acid racemase; isomerase; 1.30A {Deino 82.45
1hjs_A 332 Beta-1,4-galactanase; 4-galactanases, family 53 gl 81.95
1ur4_A 399 Galactanase; hydrolase, beta-1, glycoside hydrolas 81.28
3ddm_A 392 Putative mandelate racemase/muconate lactonizing e 81.05
3rr1_A 405 GALD, putative D-galactonate dehydratase; enolase, 80.39
>4gbu_A NADPH dehydrogenase 1; alpha/beta barrel, enenone reductase, alkene reductase, NADP oxidoreductase, carvone, enenatioselectivity; HET: 0WV 1PE FMN; 1.18A {Saccharomyces pastorianus} PDB: 4ge8_A* 1oya_A* 1oyb_A* 1oyc_A* 3tx9_A* 3rnd_A* 1k02_A* 1k03_A* 1bwk_A* 1bwl_A* Back     alignment and structure
Probab=100.00  E-value=3.8e-57  Score=400.46  Aligned_cols=182  Identities=24%  Similarity=0.349  Sum_probs=157.6

Q ss_pred             CccccCC-ccEEEeCCceeCCCCCCCCCCccCCCHHhHHhHHHHHHHHHhcCCeEEEcccCCccccCCCCC-CCCCCccc
Q 036028            1 MLKRTTN-GGFLIAEATGVFDTVQGYPNTPGIWTKEQVEAWKPIVDAVHQKGGTFFCQLWHVGRVSTFGLQ-PNGKAPIS   78 (193)
Q Consensus         1 y~~rA~G-~GlIi~~~~~V~~~~~~~~~~~~i~~~~~i~~~~~l~~~vh~~G~~i~~QL~h~G~~~~~~~~-~~~~~~~~   78 (193)
                      |++||+| +||||+|+++|++.++.++++++||+|+++++||+++++||++|+++++||+|+||++.+... ..+.++.+
T Consensus        58 y~~rA~GG~GLIite~~~V~~~g~~~~~~~gi~~d~~i~~~k~l~davH~~G~~i~~QL~H~Gr~~~~~~~~~~~~~~~~  137 (400)
T 4gbu_A           58 YTQRAQRPGTMIITEGAFISPQAGGYDNAPGVWSEEQMVEWTKIFNAIHEKKSFVWVQLAVLGWAAFPDNLARDGLRYDS  137 (400)
T ss_dssp             HHHHTCSTTCEEECSCEESSGGGCCCTTSCBSSSHHHHHHHHHHHHHHHHTTCEEEEEEECCGGGSCHHHHHHTTCCCEE
T ss_pred             HHHHHcCCeEEEEEcCeEECccccCCCCCCccCCHHHHHHHHHHHHHHHhcCCceEEeeeecCcccCccccccCCCcccC
Confidence            6889997 799999999999999999999999999999999999999999999999999999999865421 13445566


Q ss_pred             cCCCCCCCCC----CCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHhCCCeEEE-ecchhhHHhhcCCCCCCCC-----C
Q 036028           79 STNKGVTPGL----DGQDWSSPRPLRTEEIPQIVNDFRLAARNAIEAGDSNSDF-SNLNYMLIFSIKSDVEGRR-----S  148 (193)
Q Consensus        79 pS~~~~~~~~----~g~~~~~~~~mt~~eI~~ii~~f~~AA~~a~~AGfDgVEI-~ahGyLl~qFlSp~~N~Rt-----s  148 (193)
                      +|........    .......|++||.+||+++|++|++||+||++|||||||| +||||||+|||||.+|+||     |
T Consensus       138 ~s~~~~~~~~~~~~~~~~~~~pr~mt~~eI~~ii~~F~~AA~rA~~AGFDgVEIH~AhGYLl~QFLSp~tN~RtDeYGGS  217 (400)
T 4gbu_A          138 ASDNVFMDAEQEAKAKKANNPQHSLTKDEIKQYIKEYVQAAKNSIAAGADGVEIHSANGYLLNQFLDPHSNTRTDEYGGS  217 (400)
T ss_dssp             SCSSCCSCHHHHHHHHHTTCCCEECCHHHHHHHHHHHHHHHHHHHHTTCSEEEEECCTTSHHHHHHCTTTCCCCSTTSSS
T ss_pred             ccccccCCCCcccccccCCCCCccCCHHHHHHHHHHHHHHHHHHHhcCcCeeeecccccchHHheecCcCCCCccccCCc
Confidence            6654332100    0001356899999999999999999999999999999999 9999999999999999999     9


Q ss_pred             hhhhhhHHHHHHHHHHHhcCCCCCcEEEEc-CcCCCC
Q 036028          149 YKQRKRLRQDRVERLHQWQEPPPPPFLFSL-PTEWDS  184 (193)
Q Consensus       149 ~eNR~Rf~~Eii~aIR~~vg~~~~~~~~ri-~~e~~~  184 (193)
                      +|||+||++|||++||++||+ + +|.+|| +.|+.+
T Consensus       218 ~ENR~Rf~lEVi~aVr~~vg~-d-~vgvRlS~~~~~~  252 (400)
T 4gbu_A          218 IENRARFTLEVVDALVEAIGH-E-KVGLRLSPYGVFN  252 (400)
T ss_dssp             HHHHTHHHHHHHHHHHHHHCG-G-GEEEEECTTCCTT
T ss_pred             HHHHHHHHHHHHHHHHHHcCC-C-cEEEEeccccccC
Confidence            999999999999999999997 4 799999 777744
>4a3u_A NCR, NADH\:flavin oxidoreductase/NADH oxidase; HET: FMN; 1.70A {Zymomonas mobilis} Back     alignment and structure
>3kru_A NADH:flavin oxidoreductase/NADH oxidase; homotetramer, dimer of dimers, TIM barrel, thermophilic, OLD enzyme; HET: FMN; 1.60A {Thermoanaerobacter pseudethanolicus AT} SCOP: c.1.4.0 PDB: 3krz_A* Back     alignment and structure
>3hgj_A Chromate reductase; TIM barrel, oxidoreductase; HET: FMN; 2.00A {Thermus scotoductus} SCOP: c.1.4.0 PDB: 3hf3_A* Back     alignment and structure
>3l5l_A Xenobiotic reductase A; TIM barrel, oxidoreductase; HET: BU3 FMN; 1.03A {Pseudomonas putida} SCOP: c.1.4.0 PDB: 3l5m_A* 3n19_B* 3n16_A* 3l68_A* 3l67_A* 3l65_A* 3l66_A* 3n14_A* 2h8z_A* 2h90_A* 2h8x_A* Back     alignment and structure
>3l5a_A NADH/flavin oxidoreductase/NADH oxidase; OLD yellow enzyme family, OYE-like FMN-binding domain, TIM B oxidoreductase; HET: PGE; 1.65A {Staphylococcus aureus} Back     alignment and structure
>3gr7_A NADPH dehydrogenase; flavin, FMN, beta-alpha-barrel, oxidoreductase, flavoprotein; HET: FMN; 2.30A {Geobacillus kaustophilus} PDB: 3gr8_A* Back     alignment and structure
>3gka_A N-ethylmaleimide reductase; decode biostructures, ssgcid, niaid, targetdb bupsa00093A, structural genomics; HET: FMN; 2.30A {Burkholderia pseudomallei} SCOP: c.1.4.0 Back     alignment and structure
>4ab4_A Xenobiotic reductase B; oxidoreductase, OLD yellow enzyme; HET: FMN TNL EDO; 1.50A {Pseudomonas putida KT2440} Back     alignment and structure
>3tjl_A NADPH dehydrogenase; OLD yellow enzyme, flavin mononucleotide, TIM barrel, NADPH oxidoreductase, enone reductase; HET: FMN; 1.50A {Scheffersomyces stipitis cbs 6054} PDB: 3upw_A* 4df2_A* Back     alignment and structure
>2hsa_B 12-oxophytodienoate reductase 3; alpha beta 8 barrel, flavoprotein, jasmonate biosynthesis, oxidoreductase; HET: FMN; 1.50A {Solanum lycopersicum} PDB: 2hs6_A* 3hgs_A* 2hs8_A* 3hgo_A* 1q45_A* 2g5w_A* 2q3o_A* Back     alignment and structure
>1icp_A OPR1, 12-oxophytodienoate reductase 1; beta-alpha-barrel, protein-FMN-PEG complex, oxidoreductase; HET: FMN 2PE; 1.90A {Solanum lycopersicum} SCOP: c.1.4.1 PDB: 1icq_A* 1ics_A* 3hgr_A* 1vji_A* 2q3r_A* Back     alignment and structure
>3aty_A Tcoye, prostaglandin F2A synthase; alpha/beta barrel, oxidoreductase, flavin mononucleotide; HET: FMN; 1.70A {Trypanosoma cruzi} PDB: 3atz_A* Back     alignment and structure
>2r14_A Morphinone reductase; H-tunnelling, flavoprotein, NADH, hydride transfer, oxidoreductase; HET: FMN TXD; 1.40A {Pseudomonas putida} PDB: 3gx9_A* 1gwj_A* Back     alignment and structure
>3k30_A Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP binding site, oxidoreductase; HET: FMN ADP; 2.70A {Pimelobacter simplex} Back     alignment and structure
>1vyr_A Pentaerythritol tetranitrate reductase; oxidoreductase, flavoenzyme, explosive degradation, steroid binding; HET: FMN TNF; 0.9A {Enterobacter cloacae} SCOP: c.1.4.1 PDB: 1gvq_A* 1gvr_A* 1gvs_A* 1h50_A* 1h51_A* 1h60_A* 1h61_A* 1h62_A* 1h63_A* 1gvo_A* 2aba_A* 3f03_K* 3kft_A* 3p7y_A* 3p80_A* 3p81_A* 3p62_A* 3p8i_A* 2abb_A* 3p67_A* ... Back     alignment and structure
>1z41_A YQJM, probable NADH-dependent flavin oxidoreductase YQJ; FMN, beta-alpha-barrel; HET: FMN; 1.30A {Bacillus subtilis} SCOP: c.1.4.1 PDB: 1z42_A* 1z44_A* 1z48_A* Back     alignment and structure
>2gou_A Oxidoreductase, FMN-binding; OLD yeallow enzyme, flavoenzyme; HET: BOG FMN PE4; 1.40A {Shewanella oneidensis} PDB: 2gq8_A* 2gq9_A* 2gqa_A* Back     alignment and structure
>1o94_A Tmadh, trimethylamine dehydrogenase; electron transport, protein complex; HET: FMN ADP AMP; 2.0A {Methylophilus methylotrophus} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 PDB: 1djn_A* 1o95_A* 2tmd_A* 1djq_A* Back     alignment and structure
>1ps9_A 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel, flavodoxin, flavin, electron transfer, hydride transfer, oxidoreductase; HET: FAD FMN NAP MDE; 2.20A {Escherichia coli} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 Back     alignment and structure
>1vhn_A Putative flavin oxidoreducatase; structural genomics, unknown function; HET: FMN; 1.59A {Thermotoga maritima} SCOP: c.1.4.1 Back     alignment and structure
>3b0p_A TRNA-dihydrouridine synthase; TIM barrel, oxidoreductase; HET: FMN; 1.70A {Thermus thermophilus} PDB: 3b0u_X* 3b0v_C* Back     alignment and structure
>1f76_A Dihydroorotate dehydrogenase; monomer, alpha-beta-barrel, FMN binding domain, orotate complex, oxidoreductase; HET: MSE FMN ORO; 2.50A {Bacteria} SCOP: c.1.4.1 Back     alignment and structure
>1ep3_A Dihydroorotate dehydrogenase B (PYRD subunit); heterotetramer, alpha-beta barrel, beta sandwich, FAD domain alpha/beta NADP domain; HET: FMN FAD; 2.10A {Lactococcus lactis} SCOP: c.1.4.1 PDB: 1ep2_A* 1ep1_A* Back     alignment and structure
>2gl5_A Putative dehydratase protein; structural genomics, protein structure initiati nysgxrc; 1.60A {Salmonella typhimurium} SCOP: c.1.11.2 d.54.1.1 PDB: 4e6m_A* Back     alignment and structure
>2o56_A Putative mandelate racemase; dehydratase, structural genomics, protein structure initiati 2; 2.00A {Salmonella typhimurium} Back     alignment and structure
>2ox4_A Putative mandelate racemase; enolase, dehydratase, structural genomics, protein structure initiative, PSI, nysgrc; 1.80A {Zymomonas mobilis} Back     alignment and structure
>2poz_A Putative dehydratase; octamer, structural genomics, P protein structure initiative, NEW YORK SGX research center structural genomics, nysgxrc; 2.04A {Mesorhizobium loti} Back     alignment and structure
>1jub_A Dihydroorotate dehydrogenase A; homodimer, alpha-beta barrel, flavoprotein, mutant enzyme, oxidoreductase; HET: FMN; 1.40A {Lactococcus lactis} SCOP: c.1.4.1 PDB: 1ovd_A* 1jue_A* 1dor_A* 2bsl_A* 2bx7_A* 2dor_A* 1jqv_A* 1jrb_A* 1jrc_A* 1jqx_A* Back     alignment and structure
>2e6f_A Dihydroorotate dehydrogenase; chagas disease, pyrimidine biosynthesis, fumarate reductase, energy metabolism, redox homeostasis, flavoprotein; HET: FMN OXC; 1.26A {Trypanosoma cruzi} PDB: 2e6a_A* 2e6d_A* 2e68_A* 2djl_A* 2djx_A* 3c3n_A* 2b4g_A* 3c61_A* 3mhu_A* 3mjy_A* Back     alignment and structure
>3p3b_A Mandelate racemase/muconate lactonizing protein; enolase superfamily fold, galacturonate dehydratase, D-tartr galacturonate, lyase; HET: TAR; 1.65A {Geobacillus SP} PDB: 3ops_A* 3n4f_A* 3qpe_A* Back     alignment and structure
>1rvk_A Isomerase/lactonizing enzyme; enolase superfamily, MR.GI-17937161, NYSGXRC, target T1522, structural genomics, PSI; 1.70A {Agrobacterium tumefaciens} SCOP: c.1.11.2 d.54.1.1 Back     alignment and structure
>2qq6_A Mandelate racemase/muconate lactonizing enzyme- like protein; enolase, Mg ION, PSI-2, NYSGXRC, structural genomics; 2.90A {Rubrobacter xylanophilus dsm 9941} Back     alignment and structure
>1tv5_A Dhodehase, dihydroorotate dehydrogenase homolog, mitochondri, dihydroorotate; alpha-beta barrel, TIM barrel, oxidoreductase; HET: A26 FMN ORO N8E; 2.40A {Plasmodium falciparum} SCOP: c.1.4.1 Back     alignment and structure
>2og9_A Mandelate racemase/muconate lactonizing enzyme; NYSGXRC, protein structure initiative (PSI) II, PSI-2, 9382A mandelate racemase; 1.90A {Polaromonas SP} PDB: 3cb3_A* Back     alignment and structure
>2rdx_A Mandelate racemase/muconate lactonizing enzyme, P; enolase, structural genomics, PSI, protein structu initiative, nysgrc; 2.00A {Roseovarius nubinhibens} Back     alignment and structure
>2nql_A AGR_PAT_674P, isomerase/lactonizing enzyme; enolase, structural genomics, protein structure initiative, nysgxrc; 1.80A {Agrobacterium tumefaciens str} PDB: 4dn1_A Back     alignment and structure
>1gte_A Dihydropyrimidine dehydrogenase; electron transfer, flavin, iron-sulfur clusters, pyrimidine catabolism, 5-fluorouracil degradation, oxidoreductase; HET: FMN FAD; 1.65A {Sus scrofa} SCOP: a.1.2.2 c.1.4.1 c.3.1.1 c.4.1.1 d.58.1.5 PDB: 1gt8_A* 1gth_A* 1h7w_A* 1h7x_A* Back     alignment and structure
>2pp0_A L-talarate/galactarate dehydratase; enolase superfamily, LYA; 2.20A {Salmonella typhimurium} PDB: 2pp1_A* 2pp3_A* Back     alignment and structure
>2pgw_A Muconate cycloisomerase; enolase superfamily, octamer, small metabolism, PSI-II, NYSGXRC, structural genomics, PR structure initiative; 1.95A {Sinorhizobium meliloti} Back     alignment and structure
>3stp_A Galactonate dehydratase, putative; PSI biology, structural genomics, NEW YORK structural genomi research consortium; 1.88A {Labrenzia aggregata iam 12614} PDB: 3sqs_A 3ssz_A Back     alignment and structure
>1mdl_A Mandelate racemase; isomerase, mandelate pathway, magnesium; HET: RMN SMN; 1.85A {Pseudomonas aeruginosa} SCOP: c.1.11.2 d.54.1.1 PDB: 1mdr_A* 3uxk_A* 3uxl_A* 1dtn_A* 1mra_A* 2mnr_A 1mns_A Back     alignment and structure
>2qgy_A Enolase from the environmental genome shotgun sequencing of the sargasso SEA; structural genomics, unknown function, PSI-2; 1.80A {Environmental sample} Back     alignment and structure
>2ovl_A Putative racemase; structural genomics, PSI-2, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.13A {Streptomyces coelicolor A3} PDB: 3ck5_A Back     alignment and structure
>2qdd_A Mandelate racemase/muconate lactonizing enzyme; enolase, structural genomics, PSI, protein structu initiative, nysgrc; 2.30A {Roseovarius nubinhibens} PDB: 3fvd_B Back     alignment and structure
>2gdq_A YITF; mandelate racemase/muconate lactonizing enzyme, TIM-barrel, octamer, structural genomics, PSI; 1.80A {Bacillus subtilis subsp} SCOP: c.1.11.2 d.54.1.1 PDB: 2gge_A Back     alignment and structure
>3bjs_A Mandelate racemase/muconate lactonizing enzyme; enolase, structural genomics, PSI-2, protein struc initiative; 2.70A {Polaromonas SP} Back     alignment and structure
>2oz8_A MLL7089 protein; structural genomics, unknown function, PSI-2, protein struct initiative; 2.48A {Mesorhizobium loti} Back     alignment and structure
>2ps2_A Putative mandelate racemase/muconate lactonizing enzyme; structural genomics, NYSGXRC, target 9440A, enolase superfamily, PSI-2; 1.80A {Aspergillus oryzae RIB40} Back     alignment and structure
>2qde_A Mandelate racemase/muconate lactonizing enzyme FA protein; PSI-II, NYSGXRC, enolase, structural genomics, protei structure initiative, PSI-2; 1.93A {Azoarcus SP} Back     alignment and structure
>2p8b_A Mandelate racemase/muconate lactonizing enzyme family protein; enolase superfamily, prediction of function; HET: NSK; 1.70A {Bacillus cereus atcc 14579} PDB: 2p88_A* 2p8c_A* Back     alignment and structure
>2hzg_A Mandelate racemase/muconate lactonizing enzyme/EN superfamily; structural genomics, predicted mandelate racemase, PSI; 2.02A {Rhodobacter sphaeroides} Back     alignment and structure
>1tzz_A Hypothetical protein L1841; structural genomics, mandelate racemase like fold, nysgxrc target T1523, PSI, protein structure initiative; 1.86A {Bradyrhizobium japonicum} SCOP: c.1.11.2 d.54.1.1 PDB: 2dw7_A* 2dw6_A* Back     alignment and structure
>2hxt_A L-fuconate dehydratase; enolase superfamily, D-erythromohydr unknown function; HET: EHM; 1.70A {Xanthomonas campestris PV} PDB: 1yey_A 2hxu_A* 2hne_A Back     alignment and structure
>1nu5_A Chloromuconate cycloisomerase; enzyme, dehalogenation; 1.95A {Pseudomonas SP} SCOP: c.1.11.2 d.54.1.1 Back     alignment and structure
>4ef8_A Dihydroorotate dehydrogenase; phenyl isothiocyanate, PYRD, oxidoreductase, oxidoreductase-oxidor inhibitor complex; HET: FMN; 1.56A {Leishmania major} PDB: 3gye_A* 3gz3_A* 4ef9_A* 3tro_A* 3tjx_A* Back     alignment and structure
>1sjd_A N-acylamino acid racemase; lyase, isomerase; HET: NPG; 1.87A {Amycolatopsis SP} SCOP: c.1.11.2 d.54.1.1 PDB: 1sja_A* 1sjb_A* 1sjc_A* Back     alignment and structure
>2zad_A Muconate cycloisomerase; muconate lactonizing enzyme (MLE), TM0006, struct genomics, NPPSFA; HET: 1PE; 1.60A {Thermotoga maritima} PDB: 3deq_A 3der_A* 3des_A* 3dfy_A Back     alignment and structure
>3oix_A Putative dihydroorotate dehydrogenase; dihydrooro oxidase; TIM barrel, oxidoreductase; HET: MLY FMN; 2.40A {Streptococcus mutans} Back     alignment and structure
>1tkk_A Similar to chloromuconate cycloisomerase; epimerase, enolase super family,; 2.10A {Bacillus subtilis} SCOP: c.1.11.2 d.54.1.1 PDB: 1jpm_A Back     alignment and structure
>1jcn_A Inosine monophosphate dehydrogenase I; IMPD, IMPDH, guanine nucleotide synthesis, oxidoreductase; HET: CPR; 2.50A {Homo sapiens} SCOP: c.1.5.1 d.37.1.1 PDB: 1jr1_A* 1nf7_A* 1b3o_A* 1nfb_A* Back     alignment and structure
>4hnl_A Mandelate racemase/muconate lactonizing enzyme; dehydratase, magnesium binding, enzyme function initiative,; 1.48A {Enterococcus gallinarum EG2} PDB: 3s47_A Back     alignment and structure
>1fob_A Beta-1,4-galactanase; B/A barrel, glycosyl hydrolase, family 53, CLAN GH-A; 1.80A {Aspergillus aculeatus} SCOP: c.1.8.3 PDB: 1fhl_A Back     alignment and structure
>3rcy_A Mandelate racemase/muconate lactonizing enzyme-LI protein; structural genomics, protein structure initiative; HET: RIB; 1.99A {Roseovarius SP} PDB: 3t4w_A Back     alignment and structure
>3sjn_A Mandelate racemase/muconate lactonizing protein; enolase, magnesium binding site, lyase; 1.90A {Shewanella pealeana} Back     alignment and structure
>2nli_A Lactate oxidase; flavoenzyme, FMN, D-lactate, oxidoreducta; HET: FMN; 1.59A {Aerococcus viridans} PDB: 2zfa_A* 2du2_A* 2e77_A* 2j6x_A* Back     alignment and structure
>1vrd_A Inosine-5'-monophosphate dehydrogenase; TM1347, structural G joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.18A {Thermotoga maritima} SCOP: c.1.5.1 Back     alignment and structure
>1kbi_A Cytochrome B2, L-LCR; flavocytochrome B2, electron transfer, oxidoreductase; HET: HEM FMN; 2.30A {Saccharomyces cerevisiae} SCOP: c.1.4.1 d.120.1.1 PDB: 1fcb_A* 1lco_A* 1ldc_A* 1sze_A* 2oz0_A* 1szf_A* 1szg_A* 1ltd_A* 1kbj_A* 1qcw_A* 3ks0_A* Back     alignment and structure
>3go2_A Putative L-alanine-DL-glutamate epimerase; structural genomics, isomerase, PSI-2; 1.70A {Burkholderia xenovorans} PDB: 2oo6_A 3sn0_A 3sn1_A* 3sn4_A* Back     alignment and structure
>3r2g_A Inosine 5'-monophosphate dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.94A {Legionella pneumophila subsp} Back     alignment and structure
>3tji_A Mandelate racemase/muconate lactonizing enzyme, N domain protein; enolase, dehydratase, enzyme function initiative, EFI, lyase; 1.80A {Enterobacter SP} Back     alignment and structure
>3ozy_A Putative mandelate racemase; beta-alpha barrel, enolase superfamily member, M-xylarate, U function; HET: DXL; 1.30A {Bordetella bronchiseptica} PDB: 3ozm_A* 3h12_A 3op2_A* Back     alignment and structure
>3sbf_A Mandelate racemase / muconate lactonizing enzyme; enolase fold, acid sugar dehydratase, D-araninonate, isomera; HET: EPE D8T; 1.50A {Vibrionales bacterium swat-3} PDB: 3r25_A 3dfh_A 4gis_A 4gir_A 4ggh_A 3gy1_A Back     alignment and structure
>1eep_A Inosine 5'-monophosphate dehydrogenase; alpha-beta barrel, TIM barrel, IMPDH, IMP dehydrogenase, LOO purine biosynthesis, oxidoreductase; 2.40A {Borrelia burgdorferi} SCOP: c.1.5.1 Back     alignment and structure
>4e4f_A Mannonate dehydratase; magnesium binding, enzyme function initiative, isomerase; 2.00A {Pectobacterium carotovorum subsp} Back     alignment and structure
>1p0k_A Isopentenyl-diphosphate delta-isomerase; terpene biosynthesis, dimethylallyl diphosphate, flavoprotein; 1.90A {Bacillus subtilis} SCOP: c.1.4.1 PDB: 1p0n_A* Back     alignment and structure
>2zc8_A N-acylamino acid racemase; octamer, TIM beta/alpha-barrel, metal-binding, metal binding; 1.95A {Thermus thermophilus} Back     alignment and structure
>1r0m_A N-acylamino acid racemase; isomerase; 1.30A {Deinococcus radiodurans} SCOP: c.1.11.2 d.54.1.1 PDB: 1xpy_A* 1xs2_A 2ggj_A 2ggi_A 2ggh_A* 2ggg_A* 2fkp_A Back     alignment and structure
>1hjs_A Beta-1,4-galactanase; 4-galactanases, family 53 glycoside hydrolase, thermostability, PH optimum, CLAN GH-A, thermophIle, alkalophIle; HET: NAG EPE; 1.87A {Thielavia heterothallica} SCOP: c.1.8.3 PDB: 1hju_A* 1hjq_A* Back     alignment and structure
>1ur4_A Galactanase; hydrolase, beta-1, glycoside hydrolase, substrate specificity, pectin, GH-A, family 53, plant cell WALL degradation; HET: B2G PGE; 2.2A {Bacillus licheniformis} SCOP: c.1.8.3 PDB: 1r8l_A* 1ur0_A* 2ccr_A* 2j74_A* 2gft_A* Back     alignment and structure
>3ddm_A Putative mandelate racemase/muconate lactonizing enzyme; structural genomics, NYSGXRC, target 9284B, enolase family, PSI-2; 2.60A {Bordetella bronchiseptica} Back     alignment and structure
>3rr1_A GALD, putative D-galactonate dehydratase; enolase, magnesium binding site, lyase; 1.95A {Ralstonia pickettii} PDB: 3rra_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 193
d1q45a_ 380 c.1.4.1 (A:) 12-oxophytodienoate reductase (OPR, O 2e-21
d1gwja_ 374 c.1.4.1 (A:) Morphinone reductase {Pseudomonas put 8e-19
d1icpa_ 364 c.1.4.1 (A:) 12-oxophytodienoate reductase (OPR, O 2e-17
d1vyra_ 363 c.1.4.1 (A:) Pentaerythritol tetranirate reductase 1e-16
d1z41a1 337 c.1.4.1 (A:2-338) NADPH dehydrogenase NamA {Bacill 1e-15
d1oyaa_ 399 c.1.4.1 (A:) Old yellow enzyme (OYE) {Lager yeast 2e-15
d1ps9a1 330 c.1.4.1 (A:1-330) 2,4-dienoyl-CoA reductase, N-ter 2e-08
d1djqa1 340 c.1.4.1 (A:1-340) Trimethylamine dehydrogenase, N- 2e-07
>d1q45a_ c.1.4.1 (A:) 12-oxophytodienoate reductase (OPR, OYE homolog) {Thale cress (Arabidopsis thaliana), OPR3 [TaxId: 3702]} Length = 380 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: FMN-linked oxidoreductases
family: FMN-linked oxidoreductases
domain: 12-oxophytodienoate reductase (OPR, OYE homolog)
species: Thale cress (Arabidopsis thaliana), OPR3 [TaxId: 3702]

 Score = 88.1 bits (217), Expect = 2e-21
 Identities = 66/127 (51%), Positives = 81/127 (63%), Gaps = 8/127 (6%)

Query: 4   RTTNGGFLIAEATGVFDTVQGYPNTPGIWTKEQVEAWKPIVDAVHQKGGTFFCQLWHVGR 63
           RTT GGFLI+E T V     G+P+ PGI++ EQVEAWK +V+AVH KGG  FCQLWHVGR
Sbjct: 46  RTTPGGFLISEGTMVSPGSAGFPHVPGIYSDEQVEAWKQVVEAVHAKGGFIFCQLWHVGR 105

Query: 64  VSTFGLQPNGKAPISSTN--------KGVTPGLDGQDWSSPRPLRTEEIPQIVNDFRLAA 115
            S    QPNG +PISSTN        + + P      +  PR L   EIP++V D+ L+A
Sbjct: 106 ASHAVYQPNGGSPISSTNKPISENRWRVLLPDGSHVKYPKPRALEASEIPRVVEDYCLSA 165

Query: 116 RNAIEAG 122
            NAI AG
Sbjct: 166 LNAIRAG 172
>d1gwja_ c.1.4.1 (A:) Morphinone reductase {Pseudomonas putida [TaxId: 303]} Length = 374 Back     information, alignment and structure
>d1icpa_ c.1.4.1 (A:) 12-oxophytodienoate reductase (OPR, OYE homolog) {Tomato (Lycopersicon esculentum), OPR1 [TaxId: 4081]} Length = 364 Back     information, alignment and structure
>d1vyra_ c.1.4.1 (A:) Pentaerythritol tetranirate reductase {Enterobacter cloacae [TaxId: 550]} Length = 363 Back     information, alignment and structure
>d1z41a1 c.1.4.1 (A:2-338) NADPH dehydrogenase NamA {Bacillus subtilis [TaxId: 1423]} Length = 337 Back     information, alignment and structure
>d1oyaa_ c.1.4.1 (A:) Old yellow enzyme (OYE) {Lager yeast (Saccharomyces pastorianus) [TaxId: 27292]} Length = 399 Back     information, alignment and structure
>d1ps9a1 c.1.4.1 (A:1-330) 2,4-dienoyl-CoA reductase, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 330 Back     information, alignment and structure
>d1djqa1 c.1.4.1 (A:1-340) Trimethylamine dehydrogenase, N-terminal domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Length = 340 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query193
d1ps9a1330 2,4-dienoyl-CoA reductase, N-terminal domain {Esch 100.0
d1djqa1 340 Trimethylamine dehydrogenase, N-terminal domain {M 100.0
d1oyaa_ 399 Old yellow enzyme (OYE) {Lager yeast (Saccharomyce 100.0
d1vyra_ 363 Pentaerythritol tetranirate reductase {Enterobacte 100.0
d1z41a1 337 NADPH dehydrogenase NamA {Bacillus subtilis [TaxId 100.0
d1gwja_ 374 Morphinone reductase {Pseudomonas putida [TaxId: 3 100.0
d1q45a_ 380 12-oxophytodienoate reductase (OPR, OYE homolog) { 100.0
d1icpa_ 364 12-oxophytodienoate reductase (OPR, OYE homolog) { 100.0
d2gl5a1 278 Putative dehydratase protein STM2273 {Salmonella t 96.02
d1gtea2 312 Dihydropyrimidine dehydrogenase, domain 4 {Pig (Su 91.8
d2aama1285 Hypothetical protein TM1410 {Thermotoga maritima [ 88.99
d1foba_ 334 Beta-1,4-galactanase {Fungus (Aspergillus aculeatu 88.58
d1k77a_ 260 Hypothetical protein YgbM (EC1530) {Escherichia co 83.72
d1vhna_ 305 Putative flavin oxidoreducatase TM0096 {Thermotoga 81.91
d2guya2 381 Fungal alpha-amylases {Aspergillus oryzae, Taka-am 81.09
d1rvka1 255 Hypothetical protein Atu3453 {Agrobacterium tumefa 80.35
>d1ps9a1 c.1.4.1 (A:1-330) 2,4-dienoyl-CoA reductase, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: FMN-linked oxidoreductases
family: FMN-linked oxidoreductases
domain: 2,4-dienoyl-CoA reductase, N-terminal domain
species: Escherichia coli [TaxId: 562]

Probab=100.00  E-value=5.3e-56  Score=382.29  Aligned_cols=177  Identities=20%  Similarity=0.254  Sum_probs=161.9

Q ss_pred             CccccCC-ccEEEeCCceeCCCCCCCCCCccCCCHHhHHhHHHHHHHHHhcCCeEEEcccCCccccCCCCCCCCCCcccc
Q 036028            1 MLKRTTN-GGFLIAEATGVFDTVQGYPNTPGIWTKEQVEAWKPIVDAVHQKGGTFFCQLWHVGRVSTFGLQPNGKAPISS   79 (193)
Q Consensus         1 y~~rA~G-~GlIi~~~~~V~~~~~~~~~~~~i~~~~~i~~~~~l~~~vh~~G~~i~~QL~h~G~~~~~~~~~~~~~~~~p   79 (193)
                      |++||+| +||||+|++.|++.+...++++++|+|+++++||+++++||++|+++++||+|+||.+...      .+++|
T Consensus        43 y~~rA~gG~glIi~e~~~v~~~~~~~~~~~~~~~d~~i~~~k~l~~~vh~~g~~i~~QL~H~Gr~~~~~------~~~~p  116 (330)
T d1ps9a1          43 YAERARHGVALIVSGGIAPDLTGVGMEGGAMLNDASQIPHHRTITEAVHQEGGKIALQILHTGRYSYQP------HLVAP  116 (330)
T ss_dssp             HHHHHHTTCSEEEEEEEBSSSTTCSBTTCCBCCSGGGHHHHHHHHHHHHHTTCCEEEEECCCGGGSBST------TCEES
T ss_pred             HHHHHhCCeEEEEEeeeEEcCCccccCCCcccCCcccccccccceeeeecCCCeehhhhhhcCCccccC------cccCC
Confidence            6889997 6999999999999999999999999999999999999999999999999999999998654      36789


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHhCCCeEEE-ecchhhHHhhcCCCCCCCC-----Chhhhh
Q 036028           80 TNKGVTPGLDGQDWSSPRPLRTEEIPQIVNDFRLAARNAIEAGDSNSDF-SNLNYMLIFSIKSDVEGRR-----SYKQRK  153 (193)
Q Consensus        80 S~~~~~~~~~g~~~~~~~~mt~~eI~~ii~~f~~AA~~a~~AGfDgVEI-~ahGyLl~qFlSp~~N~Rt-----s~eNR~  153 (193)
                      |.++.+.     ....|++||++||+++|++|++||+||++|||||||| +||||||+|||||.+|+||     |+|||+
T Consensus       117 s~~~~~~-----~~~~p~~lt~~eI~~ii~~f~~aA~ra~~AGfDgVEIh~ahGyLl~qFlSp~~N~RtDeYGGs~enR~  191 (330)
T d1ps9a1         117 SALQAPI-----NRFVPHELSHEEILQLIDNFARCAQLAREAGYDGVEVMGSEGYLINEFLTLRTNQRSDQWGGDYRNRM  191 (330)
T ss_dssp             SSCCCTT-----CSSCCEECCHHHHHHHHHHHHHHHHHHHHTTCSEEEEEECBTSHHHHHHCTTTCCCCSTTSSSHHHHH
T ss_pred             ccccccc-----cCCCChhcChhHHHHHHHHHHHHHHHHHHhCcCeeeeccchHHHHHHHHHhhcccccccCCccHhhhh
Confidence            8876542     1357999999999999999999999999999999999 9999999999999999999     999999


Q ss_pred             hHHHHHHHHHHHhcCCCCCcEEEEc-CcCCC-CCcccc
Q 036028          154 RLRQDRVERLHQWQEPPPPPFLFSL-PTEWD-SSISLT  189 (193)
Q Consensus       154 Rf~~Eii~aIR~~vg~~~~~~~~ri-~~e~~-~~~~~~  189 (193)
                      ||++|||++||++||+ +++|.+|+ ++|+. ++.+++
T Consensus       192 Rf~~Eii~air~~vg~-d~~v~~R~s~~d~~~~g~~~~  228 (330)
T d1ps9a1         192 RFAVEVVRAVRERVGN-DFIIIYRLSMLDLVEDGGTFA  228 (330)
T ss_dssp             HHHHHHHHHHHHHHCS-SSEEEEEEEEECCSTTCCCHH
T ss_pred             HHHHHHHHHHHHHcCC-CceeEecccccccccCCCCHH
Confidence            9999999999999998 69999999 77774 466654
>d1djqa1 c.1.4.1 (A:1-340) Trimethylamine dehydrogenase, N-terminal domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1oyaa_ c.1.4.1 (A:) Old yellow enzyme (OYE) {Lager yeast (Saccharomyces pastorianus) [TaxId: 27292]} Back     information, alignment and structure
>d1vyra_ c.1.4.1 (A:) Pentaerythritol tetranirate reductase {Enterobacter cloacae [TaxId: 550]} Back     information, alignment and structure
>d1z41a1 c.1.4.1 (A:2-338) NADPH dehydrogenase NamA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1gwja_ c.1.4.1 (A:) Morphinone reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1q45a_ c.1.4.1 (A:) 12-oxophytodienoate reductase (OPR, OYE homolog) {Thale cress (Arabidopsis thaliana), OPR3 [TaxId: 3702]} Back     information, alignment and structure
>d1icpa_ c.1.4.1 (A:) 12-oxophytodienoate reductase (OPR, OYE homolog) {Tomato (Lycopersicon esculentum), OPR1 [TaxId: 4081]} Back     information, alignment and structure
>d2gl5a1 c.1.11.2 (A:123-400) Putative dehydratase protein STM2273 {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1gtea2 c.1.4.1 (A:533-844) Dihydropyrimidine dehydrogenase, domain 4 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2aama1 c.1.8.15 (A:28-312) Hypothetical protein TM1410 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1foba_ c.1.8.3 (A:) Beta-1,4-galactanase {Fungus (Aspergillus aculeatus) [TaxId: 5053]} Back     information, alignment and structure
>d1k77a_ c.1.15.5 (A:) Hypothetical protein YgbM (EC1530) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vhna_ c.1.4.1 (A:) Putative flavin oxidoreducatase TM0096 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2guya2 c.1.8.1 (A:1-381) Fungal alpha-amylases {Aspergillus oryzae, Taka-amylase [TaxId: 5062]} Back     information, alignment and structure
>d1rvka1 c.1.11.2 (A:127-381) Hypothetical protein Atu3453 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure