Citrus Sinensis ID: 036075

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470----
MPNFEELDLGGCTRLREIHPTLLLHKKIILLNLKDCKSLTTLPDKICMESLKILVLSGCRKFKNFREIVGSRKCLSELLLDGTDIKELPKHKRSKISSNFESFWPFQFSEFSEIMTSMEHLLELHLEGTAIRGLPVSIEHLTGLVLLNLRDCKNLETLPSTIDGLKSLRNLYLSGCSKLKSMPGNFGKVESLEVLDLSGCKGPPLSSSWYLPFLISLMRRCSDPMALGFPSLSGLCSLRKLDLSDSNLGEGAIPNDIGNLCSLKELYLSKNSFITLPASINRLFNLEKLELEDCKRLQSMPQLPPSIEEVRVNGCASLETLSGALKLCNSEYISINCIDDLKLLGCNGFAFSMLKEYLEVMSNPKQKFDIVVPGSEIPEWFMHQNDGSSIKFIMPSNLYCKNKALGYAVCCVFHVHNHSPGLEVKRCGFHPVYRHNVEFFNQPRNQWTRYTTYNLNEFYPNFVVTKMAVATTSN
cccccEEEEccccccccccccccccccccEEEccccccccccccccccccccEEEcccccccccccccccccccccEEEccccccccccccccccccccEEcccccccccccccccccccccEEEccccccccccccccccccccEEEcccccccccccccccccccccEEEcccccccccccccccccccccEEEccccccccccccccHHHHHHHHHccccccccccccccccccccEEEccccccccccccccccccccccEEEccccccccccHHHHccccccEEEccccccccccccccccccEEcccccccccccccccccccccccccccccHHHHccccccccHHHHHHHHHHccccccEEEEEccccccccccccccccEEEEEccccccccccEEEEEEEEEEEEccccccccEEEEEEEEEEccccEEEcccccccEEEEEEEEcccccccEEEEEEEEcccc
ccccEEEEccccccccccccHHcccccccEEEccccccccccccHcccccccEEEcccccccccccHHHccccccEEEEccccccccccHHHccccccEEEEccccccccccHHccccccccEEEccccccccccccHcccccccEEEcccccccccccHHHcccccccEEEcccccccccccHHHcccccccEEEccccccccccccccHHHHHHHHHHcccccccccccHcccccccEEEccccccccccccHHHcccccccEEEccccccccccHHHHHHHcccEEEccccccccccccccccccEEEccccccccccccccccccHHHHHHHHHHHHHcccccccccHccHHHHHHHHccccccccEcccccccHHHcccccccEEEEEccccccccccccEEEEEEEEEccccccccccEEEEEEEEEEEcccccccccccEEEcEEEccccccccccccEEEEEEEcc
mpnfeeldlggctrlreihptLLLHKKIILLNlkdckslttlpdkicMESLKILVLSGCRKFKNFREIVGSRKCLSELlldgtdikelpkhkrskissnfesfwpfqfsEFSEIMTSMEHLLELHLegtairglpvsiEHLTGLVLLNlrdcknletlpstIDGLKSLRNLYLSGCsklksmpgnfgkveslevldlsgckgpplssswylPFLISLMRrcsdpmalgfpslsglcslrkldlsdsnlgegaipndignlcslkelylsknsfitlPASINRLFNLEKLELEDCkrlqsmpqlppsieeVRVNGCASLETLSGALKLcnseyisinciddlkllgcnGFAFSMLKEYLEVmsnpkqkfdivvpgseipewfmhqndgssikfimpsnlycknkalgYAVCCVFHvhnhspglevkrcgfhpvyrhnveffnqprnqwtryttynlnefypnFVVTKMAVATTSN
mpnfeeldlggcTRLREIHPTLLLHKKIILLNLKDCKSLTTLPDKICMESLKILVLSGCRKFKNFREIVGSRKCLSELLldgtdikelpkhkrskissnfesFWPFQFSEFSEIMTSMEHLLELHLEGTAIRGLPVSIEHLTGLVLLNLRDCKNLETLPSTIDGLKSLRNLYLSGCSKLKSMPGNFGKVESLEVLDLSGCKGPPLSSSWYLPFLISLMRRCSDPMALGFPSLSGLCSLRKLDLSDSNLGEGAIPNDIGNLCSLKELYLSKNSFITLPASINRLFNLEKLELEDCKRLQSMPQLPPSIEEVRVNGCASLETLSGALKLCNSEYISINCIDDLKLLGCNGFAFSMLKEYLEVMSNPKQKFDIVVPGSEIPEWFMHQNDGSSIKFIMPSNLYCKNKALGYAVCCVFHVHNHSPGLEVKRCGFHPVYRHNVeffnqprnqWTRYTTYNLNEFYPNFVVTKMAVATTSN
MPNFEELDLGGCTRLREIHPTlllhkkiillnlkDCKSLTTLPDKICMESLKILVLSGCRKFKNFREIVGSRKCLSELLLDGTDIKELPKHKRSKISSNFESFWPFQFSEFSEIMTSMEHLLELHLEGTAIRGLPVSIEHLTGLVLLNLRDCKNLETLPSTIDGLKSLRNLYLSGCSKLKSMPGNFGKVESLEVLDLSGCKGPPLSSSWYLPFLISLMRRCSDPMALGFPSLSGLCSLRKLDLSDSNLGEGAIPNDIGNLCSLKELYLSKNSFITLPASINRLFNLEKLELEDCKRLQSMPQLPPSIEEVRVNGCASLETLSGALKLCNSEYISINCIDDLKLLGCNGFAFSMLKEYLEVMSNPKQKFDIVVPGSEIPEWFMHQNDGSSIKFIMPSNLYCKNKALGYAVCCVFHVHNHSPGLEVKRCGFHPVYRHNVEFFNQPRNQWTRYTTYNLNEFYPNFVVTKMAVATTSN
******LDLGGCTRLREIHPTLLLHKKIILLNLKDCKSLTTLPDKICMESLKILVLSGCRKFKNFREIVGSRKCLSELLLDGTDIKEL*******ISSNFESFWPFQFSEFSEIMTSMEHLLELHLEGTAIRGLPVSIEHLTGLVLLNLRDCKNLETLPSTIDGLKSLRNLYLSGCSKLKSMPGNFGKVESLEVLDLSGCKGPPLSSSWYLPFLISLMRRCSDPMALGFPSLSGLCSLRKLDLSDSNLGEGAIPNDIGNLCSLKELYLSKNSFITLPASINRLFNLEKLELEDCKRL*********IEEVRVNGCASLETLSGALKLCNSEYISINCIDDLKLLGCNGFAFSMLKEYLEVMSNPKQKFDIVVPGSEIPEWFMHQNDGSSIKFIMPSNLYCKNKALGYAVCCVFHVHNHSPGLEVKRCGFHPVYRHNVEFFNQPRNQWTRYTTYNLNEFYPNFVVTKMAV*****
MPNFEELDLGGCTRLREIHPTLLLHKKIILLNLKDCKSLTTLPDKICMESLKILVLSGCRKFKNFREIVGSRKCLSELLLDGTDIKELPKHKRSKISSNFESFWPFQFSEFSEIMTSMEHLLELHLEGTAIRGLPVSIEHLTGLVLLNLRDCKNLETLPSTIDGLKSLRNLYLSGCSKLKSMPGNFGKVESLEVLDLSGCKGPPLSSS*YLPFLIS**RRCSD**ALGFPSLSGLCSLRKLDLSDSNLGEGAIPNDIGNLCSLKELYLSKNSFITLPASINRLFNLEKLELEDCKRLQSMPQLPPSIEEVRVNGCASLETLSGALKLCNSEYISINCIDDLKLLGCNGFAFSMLKEYLEVMSNPKQKFDIVVPGSEIPEWFMHQNDGSSIKFIMPSNLYCKNKALGYAVCCVFHVHNHSPGLEVKRCGFHPVYRHNVEFFNQPRNQWTRYTTYNLNEFYPNFVVTKMAVATT**
MPNFEELDLGGCTRLREIHPTLLLHKKIILLNLKDCKSLTTLPDKICMESLKILVLSGCRKFKNFREIVGSRKCLSELLLDGTDIKELPKHKRSKISSNFESFWPFQFSEFSEIMTSMEHLLELHLEGTAIRGLPVSIEHLTGLVLLNLRDCKNLETLPSTIDGLKSLRNLYLSGCSKLKSMPGNFGKVESLEVLDLSGCKGPPLSSSWYLPFLISLMRRCSDPMALGFPSLSGLCSLRKLDLSDSNLGEGAIPNDIGNLCSLKELYLSKNSFITLPASINRLFNLEKLELEDCKRLQSMPQLPPSIEEVRVNGCASLETLSGALKLCNSEYISINCIDDLKLLGCNGFAFSMLKEYLEVMSNPKQKFDIVVPGSEIPEWFMHQNDGSSIKFIMPSNLYCKNKALGYAVCCVFHVHNHSPGLEVKRCGFHPVYRHNVEFFNQPRNQWTRYTTYNLNEFYPNFVVTKMAVATTSN
*PNFEELDLGGCTRLREIHPTLLLHKKIILLNLKDCKSLTTLPDKICMESLKILVLSGCRKFKNFREIVGSRKCLSELLLDGTDIKELPKHKRSKISSNFESFWPFQFSEFSEIMTSMEHLLELHLEGTAIRGLPVSIEHLTGLVLLNLRDCKNLETLPSTIDGLKSLRNLYLSGCSKLKSMPGNFGKVESLEVLDLSGCKGPPLSSSWYLPFLISLMRRCSDPMALGFPSLSGLCSLRKLDLSDSNLGEGAIPNDIGNLCSLKELYLSKNSFITLPASINRLFNLEKLELEDCKRLQSMPQLPPSIEEVRVNGCASLETLSGALKLCNSEYISINCIDDLKLLGCNGFAFSMLKEYLEVMSNPKQKFDIVVPGSEIPEWFMHQNDGSSIKFIMPSNLYCKNKALGYAVCCVFHVHNHSPGLEVKRCGFHPVYRHNVEFFNQPRNQWTRYTTYNLNEFYPNFVVTKMAVATTSN
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPNFEELDLGGCTRLREIHPTLLLHKKIILLNLKDCKSLTTLPDKICMESLKILVLSGCRKFKNFREIVGSRKCLSELLLDGTDIKELPKHKRSKISSNFESFWPFQFSEFSEIMTSMEHLLELHLEGTAIRGLPVSIEHLTGLVLLNLRDCKNLETLPSTIDGLKSLRNLYLSGCSKLKSMPGNFGKVESLEVLDLSGCKGPPLSSSWYLPFLISLMRRCSDPMALGFPSLSGLCSLRKLDLSDSNLGEGAIPNDIGNLCSLKELYLSKNSFITLPASINRLFNLEKLELEDCKRLQSMPQLPPSIEEVRVNGCASLETLSGALKLCNSEYISINCIDDLKLLGCNGFAFSMLKEYLEVMSNPKQKFDIVVPGSEIPEWFMHQNDGSSIKFIMPSNLYCKNKALGYAVCCVFHVHNHSPGLEVKRCGFHPVYRHNVEFFNQPRNQWTRYTTYNLNEFYPNFVVTKMAVATTSN
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query474 2.2.26 [Sep-21-2011]
Q403921144 TMV resistance protein N N/A no 0.755 0.312 0.338 4e-45
O23530 1301 Protein SUPPRESSOR OF npr no no 0.624 0.227 0.303 9e-16
Q9SZ67 1895 Probable WRKY transcripti no no 0.352 0.088 0.317 1e-13
Q9RBS2 1024 Protein PopC OS=Ralstonia yes no 0.493 0.228 0.282 2e-13
O82500 1095 Putative disease resistan no no 0.765 0.331 0.249 1e-12
Q9FKN7 1613 Protein DA1-related 4 OS= no no 0.354 0.104 0.323 4e-12
Q7KRY7 1851 Protein lap4 OS=Drosophil no no 0.476 0.122 0.311 7e-12
Q8VDB8371 Leucine-rich repeat-conta yes no 0.362 0.463 0.343 2e-10
Q4H4B6 1724 Protein scribble homolog yes no 0.493 0.135 0.279 3e-10
Q14160 1630 Protein scribble homolog yes no 0.421 0.122 0.276 1e-09
>sp|Q40392|TMVRN_NICGU TMV resistance protein N OS=Nicotiana glutinosa GN=N PE=1 SV=1 Back     alignment and function desciption
 Score =  182 bits (463), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 144/425 (33%), Positives = 211/425 (49%), Gaps = 67/425 (15%)

Query: 1    MPNFEELDLGGCTRLREIHPTLLLHKKIILLNLKDCKSLTTLPDKICMESLKILVLSGCR 60
            MPN E ++L  C+ L E+H +L    K+I L L DCKSL   P  + +ESL+ L L  C 
Sbjct: 641  MPNLEYVNLYQCSNLEEVHHSLGCCSKVIGLYLNDCKSLKRFP-CVNVESLEYLGLRSCD 699

Query: 61   KFKNFREIVGSRKCLSELLLDGTDIKELPKHKRSKISSNFESFWPFQFSEFSEIMTSMEH 120
              +   EI G                                               M+ 
Sbjct: 700  SLEKLPEIYGR----------------------------------------------MKP 713

Query: 121  LLELHLEGTAIRGLPVSI----EHLTGLVLLNLRDCKNLETLPSTIDGLKSLRNLYLSGC 176
             +++H++G+ IR LP SI     H+T L+L N+   KNL  LPS+I  LKSL +L +SGC
Sbjct: 714  EIQIHMQGSGIRELPSSIFQYKTHVTKLLLWNM---KNLVALPSSICRLKSLVSLSVSGC 770

Query: 177  SKLKSMPGNFGKVESLEVLDLSGCK--GPPLSSSWYLPFLISLMRRCSDPMALGFPSLS- 233
            SKL+S+P   G +++L V D S      PP S       +I + R   D +   FP ++ 
Sbjct: 771  SKLESLPEEIGDLDNLRVFDASDTLILRPPSSIIRLNKLIILMFRGFKDGVHFEFPPVAE 830

Query: 234  GLCSLRKLDLSDSNLGEGAIPNDIGNLCSLKELYLSKNSFITLPASINRLFNLEKLELED 293
            GL SL  L+LS  NL +G +P +IG+L SLK+L LS+N+F  LP+SI +L  L+ L+L+D
Sbjct: 831  GLHSLEYLNLSYCNLIDGGLPEEIGSLSSLKKLDLSRNNFEHLPSSIAQLGALQSLDLKD 890

Query: 294  CKRLQSMPQLPPSIEEVRVNGCASLETLSGALKLCNSEYISINCIDDLKLLGCNGFAFSM 353
            C+RL  +P+LPP + E+ V+   +L+ +   L     +   +   D       N FA++M
Sbjct: 891  CQRLTQLPELPPELNELHVDCHMALKFIH-YLVTKRKKLHRVKLDDAHNDTMYNLFAYTM 949

Query: 354  LKEYLEVMSNPKQKFD----IVVPGS----EIPEWFMHQNDGSSIKFIMPSNLYCKNKAL 405
             +  +  M +     D     V  G     +IP WF HQ   SS+   +P N Y  +K L
Sbjct: 950  FQN-ISSMRHDISASDSLSLTVFTGQPYPEKIPSWFHHQGWDSSVSVNLPENWYIPDKFL 1008

Query: 406  GYAVC 410
            G+AVC
Sbjct: 1009 GFAVC 1013
Disease resistance protein. Resistance proteins guard the plant against pathogens that contain an appropriate avirulence protein via a direct or indirect interaction with this avirulence protein. That triggers a defense system including the hypersensitive response, which restricts the pathogen growth.
Nicotiana glutinosa (taxid: 35889)
>sp|O23530|SNC1_ARATH Protein SUPPRESSOR OF npr1-1, CONSTITUTIVE 1 OS=Arabidopsis thaliana GN=SNC1 PE=1 SV=3 Back     alignment and function description
>sp|Q9SZ67|WRK19_ARATH Probable WRKY transcription factor 19 OS=Arabidopsis thaliana GN=WRKY19 PE=2 SV=1 Back     alignment and function description
>sp|Q9RBS2|POPC_RALSO Protein PopC OS=Ralstonia solanacearum (strain GMI1000) GN=popC PE=4 SV=2 Back     alignment and function description
>sp|O82500|Y4117_ARATH Putative disease resistance protein At4g11170 OS=Arabidopsis thaliana GN=At4g11170 PE=2 SV=1 Back     alignment and function description
>sp|Q9FKN7|DAR4_ARATH Protein DA1-related 4 OS=Arabidopsis thaliana GN=DAR4 PE=1 SV=2 Back     alignment and function description
>sp|Q7KRY7|LAP4_DROME Protein lap4 OS=Drosophila melanogaster GN=scrib PE=1 SV=1 Back     alignment and function description
>sp|Q8VDB8|LRRC2_MOUSE Leucine-rich repeat-containing protein 2 OS=Mus musculus GN=Lrrc2 PE=2 SV=1 Back     alignment and function description
>sp|Q4H4B6|SCRIB_DANRE Protein scribble homolog OS=Danio rerio GN=scrib PE=1 SV=1 Back     alignment and function description
>sp|Q14160|SCRIB_HUMAN Protein scribble homolog OS=Homo sapiens GN=SCRIB PE=1 SV=4 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query474
147802475 1244 hypothetical protein VITISV_027841 [Viti 0.879 0.335 0.418 5e-80
296090591 771 unnamed protein product [Vitis vinifera] 0.839 0.516 0.429 1e-79
224114311 1144 tir-nbs-lrr resistance protein [Populus 0.803 0.333 0.402 4e-72
359496026 1250 PREDICTED: TMV resistance protein N-like 0.742 0.281 0.417 9e-72
224126507 1741 tir-nbs-lrr resistance protein [Populus 0.810 0.220 0.404 2e-71
224120770 1120 tir-nbs-lrr resistance protein [Populus 0.803 0.340 0.394 3e-70
224108373 1279 tir-nbs-lrr resistance protein [Populus 0.803 0.297 0.400 4e-70
224114331 1119 tir-nbs-lrr resistance protein [Populus 0.801 0.339 0.396 4e-69
224116210 1017 tir-nbs-lrr resistance protein [Populus 0.803 0.374 0.394 3e-68
105922631 1336 TIR-NBS-LRR-TIR type disease resistance 0.793 0.281 0.394 5e-68
>gi|147802475|emb|CAN61853.1| hypothetical protein VITISV_027841 [Vitis vinifera] Back     alignment and taxonomy information
 Score =  305 bits (780), Expect = 5e-80,   Method: Compositional matrix adjust.
 Identities = 203/485 (41%), Positives = 270/485 (55%), Gaps = 68/485 (14%)

Query: 1    MPNFEELDLGGCTRLREIHPTLLLHKKIILLNLKDCKSLTTLPDKICMESLKILVLSGCR 60
            MPN E L L GCT   E+ P++ +  K+I LNLK+CK L + P  I +E LK L LSGC 
Sbjct: 552  MPNLERLVLEGCTSFLEVDPSIEVLNKLIFLNLKNCKKLRSFPRSIKLECLKYLSLSGCS 611

Query: 61   KFKNFREIVGSRKCLSELLLDGTDIKELP-----------------KHKRSKISS--NFE 101
              KNF EI G+ + LSEL LDGT I ELP                 K  +S  SS    +
Sbjct: 612  DLKNFPEIQGNMQHLSELYLDGTAISELPFSIGYLTGLILLDLENCKRLKSLPSSICKLK 671

Query: 102  SFWPF------QFSEFSEIMTSMEHLLELHLEGTAIRGLPVSIEHLTGLVLLNLRDCKNL 155
            S          +   F EIM +MEHL +L L+GTA++ L  SIEHL GLV LNLRDCKNL
Sbjct: 672  SLETLILSACSKLESFPEIMENMEHLKKLLLDGTALKQLHPSIEHLNGLVSLNLRDCKNL 731

Query: 156  ETLPSTIDGLKSLRNLYLSGCSKLKSMPGNFGKVE-----------------------SL 192
             TLP +I  LKSL  L +SGCSKL+ +P N G ++                       +L
Sbjct: 732  ATLPCSIGNLKSLETLIVSGCSKLQQLPENLGSLQCLVKLQADGTLVRQPPSSIVLLRNL 791

Query: 193  EVLDLSGCKGPPLSSSWYLPFLISLM-RRCSDPMALGFPSLSGLCSLRKLDLSDSNLGEG 251
            E+L   GCKG   S+SW   F   L+ R+ SD + L  PSLSGLCSLR+LD+SD NL EG
Sbjct: 792  EILSFGGCKGLA-SNSWSSLFSFWLLPRKSSDTIGLQLPSLSGLCSLRELDISDCNLMEG 850

Query: 252  AIPNDIGNLCSLKELYLSKNSFITLPASINRLFNLEKLELEDCKRLQSMPQLPPSIEEVR 311
            A+P DI NL SL+ L LS+N+F +LPA I++L  L  L L  CK L  +P+LP SI EV 
Sbjct: 851  AVPFDICNLSSLETLNLSRNNFFSLPAGISKLSKLRFLSLNHCKSLLQIPELPSSIIEVN 910

Query: 312  VNGCASLETLSGALKLCNSE-------YISINCIDDLKLLGCNGFAFSMLKEYLEVMSNP 364
               C+SL T+     +CN++       +   NC +      C+    +++   +++++N 
Sbjct: 911  AQYCSSLNTILTPSSVCNNQPVCRWLVFTLPNCFNLDAENPCSN-DMAIISPRMQIVTNM 969

Query: 365  KQK---------FDIVVPGSEIPEWFMHQNDGSSIKFIMPSNLYCKNKALGYAVCCVFHV 415
             QK         F I +PGSEIP+W  +QN GS +   +P + +  N  LG+AVCCVF  
Sbjct: 970  LQKLQNFLPDFGFSIFLPGSEIPDWISNQNLGSEVTIELPPHWFESN-FLGFAVCCVFAF 1028

Query: 416  HNHSP 420
             + +P
Sbjct: 1029 EDIAP 1033

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|296090591|emb|CBI40960.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|224114311|ref|XP_002332395.1| tir-nbs-lrr resistance protein [Populus trichocarpa] gi|222832718|gb|EEE71195.1| tir-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|359496026|ref|XP_002277166.2| PREDICTED: TMV resistance protein N-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|224126507|ref|XP_002319855.1| tir-nbs-lrr resistance protein [Populus trichocarpa] gi|222858231|gb|EEE95778.1| tir-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224120770|ref|XP_002330947.1| tir-nbs-lrr resistance protein [Populus trichocarpa] gi|222873141|gb|EEF10272.1| tir-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224108373|ref|XP_002333401.1| tir-nbs-lrr resistance protein [Populus trichocarpa] gi|222836441|gb|EEE74848.1| tir-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224114331|ref|XP_002332400.1| tir-nbs-lrr resistance protein [Populus trichocarpa] gi|222832723|gb|EEE71200.1| tir-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224116210|ref|XP_002331988.1| tir-nbs-lrr resistance protein [Populus trichocarpa] gi|222832112|gb|EEE70589.1| tir-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|105922631|gb|ABF81427.1| TIR-NBS-LRR-TIR type disease resistance protein [Populus trichocarpa] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query474
UNIPROTKB|Q403921144 N "TMV resistance protein N" [ 0.772 0.319 0.359 2.4e-41
TAIR|locus:2122965 1210 AT4G19510 [Arabidopsis thalian 0.782 0.306 0.325 3.7e-36
TAIR|locus:2175991 1294 AT5G17680 [Arabidopsis thalian 0.822 0.301 0.307 9.3e-34
TAIR|locus:2118106 1219 AT4G12010 [Arabidopsis thalian 0.751 0.292 0.322 2.6e-32
TAIR|locus:22058241384 AT1G27170 [Arabidopsis thalian 0.780 0.267 0.285 5.2e-27
TAIR|locus:22058041556 AT1G27180 [Arabidopsis thalian 0.780 0.237 0.278 1.2e-24
TAIR|locus:2170333 1197 CSA1 "constitutive shade-avoid 0.607 0.240 0.324 4.5e-23
TAIR|locus:2122209 1179 AT4G36150 [Arabidopsis thalian 0.729 0.293 0.292 5.8e-23
TAIR|locus:2158475 1217 RPS4 "RESISTANT TO P. SYRINGAE 0.696 0.271 0.284 3.3e-20
TAIR|locus:2094498 1981 AT3G25510 [Arabidopsis thalian 0.662 0.158 0.295 4.9e-20
UNIPROTKB|Q40392 N "TMV resistance protein N" [Nicotiana glutinosa (taxid:35889)] Back     alignment and assigned GO terms
 Score = 450 (163.5 bits), Expect = 2.4e-41, P = 2.4e-41
 Identities = 141/392 (35%), Positives = 206/392 (52%)

Query:    37 KSLTTLPDKICMESLKILVLSGCRKFKNFREIVGSRKCLSELL-LDGTDIKELPKHKRSK 95
             K LT  PD   M +L+ + L  C    N  E+  S  C S+++ L   D K L +     
Sbjct:   630 KRLTRTPDFTGMPNLEYVNLYQC---SNLEEVHHSLGCCSKVIGLYLNDCKSLKRFPCVN 686

Query:    96 ISS-NFESFWPFQFSE-FSEIMTSMEHLLELHLEGTAIRGLPVSI----EHLTGLVLLNL 149
             + S  +         E   EI   M+  +++H++G+ IR LP SI     H+T L+L N+
Sbjct:   687 VESLEYLGLRSCDSLEKLPEIYGRMKPEIQIHMQGSGIRELPSSIFQYKTHVTKLLLWNM 746

Query:   150 RDCKNLETLPSTIDGLKSLRNLYLSGCSKLKSMPGNFGKVESLEVLDLSGCK--GPPLSS 207
                KNL  LPS+I  LKSL +L +SGCSKL+S+P   G +++L V D S      PP SS
Sbjct:   747 ---KNLVALPSSICRLKSLVSLSVSGCSKLESLPEEIGDLDNLRVFDASDTLILRPP-SS 802

Query:   208 SWYLPFLISLM-RRCSDPMALGFPSLS-GLCSLRKLDLSDSNLGEGAIPNDIGNLCSLKE 265
                L  LI LM R   D +   FP ++ GL SL  L+LS  NL +G +P +IG+L SLK+
Sbjct:   803 IIRLNKLIILMFRGFKDGVHFEFPPVAEGLHSLEYLNLSYCNLIDGGLPEEIGSLSSLKK 862

Query:   266 LYLSKNSFITLPASINRLFNLEKLELEDCKRLQSMPQLPPSIEEVRVNGCASLETLSGAL 325
             L LS+N+F  LP+SI +L  L+ L+L+DC+RL  +P+LPP + E+ V+   +L+ +   L
Sbjct:   863 LDLSRNNFEHLPSSIAQLGALQSLDLKDCQRLTQLPELPPELNELHVDCHMALKFIH-YL 921

Query:   326 KLCNSEYISINCIDDLKLLGCNGFAFSMLKEYLEVMSN--PKQKFDIVV----PGSE-IP 378
                  +   +   D       N FA++M +    +  +        + V    P  E IP
Sbjct:   922 VTKRKKLHRVKLDDAHNDTMYNLFAYTMFQNISSMRHDISASDSLSLTVFTGQPYPEKIP 981

Query:   379 EWFMHQNDGSSIKFIMPSNLYCKNKALGYAVC 410
              WF HQ   SS+   +P N Y  +K LG+AVC
Sbjct:   982 SWFHHQGWDSSVSVNLPENWYIPDKFLGFAVC 1013
GO:0005515 "protein binding" evidence=IPI
TAIR|locus:2122965 AT4G19510 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2175991 AT5G17680 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2118106 AT4G12010 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2205824 AT1G27170 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2205804 AT1G27180 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2170333 CSA1 "constitutive shade-avoidance1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2122209 AT4G36150 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2158475 RPS4 "RESISTANT TO P. SYRINGAE 4" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2094498 AT3G25510 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query474
PLN032101153 PLN03210, PLN03210, Resistant to P 3e-23
PLN03210 1153 PLN03210, PLN03210, Resistant to P 2e-13
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 1e-07
PLN032101153 PLN03210, PLN03210, Resistant to P 6e-07
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 1e-05
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 1e-05
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-04
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 5e-04
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 6e-04
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 6e-04
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 0.002
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information 
 Score =  103 bits (258), Expect = 3e-23
 Identities = 97/323 (30%), Positives = 153/323 (47%), Gaps = 30/323 (9%)

Query: 3   NFEELDLGGCTRLREIHPTLLLHKKIILLNLKDCKSLTTLPDKICMESLKILVLSGCRKF 62
           N E L L  C+ L E+  ++    K+  L++  C++L  LP  I ++SL  L LSGC + 
Sbjct: 658 NLETLKLSDCSSLVELPSSIQYLNKLEDLDMSRCENLEILPTGINLKSLYRLNLSGCSRL 717

Query: 63  KNFREIVGSRKCLSELLLDGTDIKELPKHKR-------SKISSNFESFWPFQFSEFSEIM 115
           K+F +I  +   +S L LD T I+E P + R              E  W  +    + +M
Sbjct: 718 KSFPDISTN---ISWLDLDETAIEEFPSNLRLENLDELILCEMKSEKLWE-RVQPLTPLM 773

Query: 116 TSMEH-LLELHLEGT-AIRGLPVSIEHLTGLVLLNLRDCKNLETLPSTIDGLKSLRNLYL 173
           T +   L  L L    ++  LP SI++L  L  L + +C NLETLP+ I+ L+SL +L L
Sbjct: 774 TMLSPSLTRLFLSDIPSLVELPSSIQNLHKLEHLEIENCINLETLPTGIN-LESLESLDL 832

Query: 174 SGCSKLKSMPGNFGKVESLEVLDLSGCKGPPLSSSWYLPFLISL----MRRCSDPMALGF 229
           SGCS+L++ P     +  L  L  +G +  P    W++    +L    M  C++   +  
Sbjct: 833 SGCSRLRTFPDISTNISDL-NLSRTGIEEVP----WWIEKFSNLSFLDMNGCNNLQRVS- 886

Query: 230 PSLSGLCSLRKLDLSDSNLGEGAIPNDIGNLCSLKELYLSKNSFITLPASI-NRLFNLEK 288
            ++S L  L  +D SD     GA+     N    +    + N    LP+++     N   
Sbjct: 887 LNISKLKHLETVDFSDC----GALTEASWNGSPSEVAMATDNIHSKLPSTVCINFINCFN 942

Query: 289 LELEDCKRLQSM-PQLPPSIEEV 310
           L+ E   + QS+  QL  S EEV
Sbjct: 943 LDQEALLQQQSIFKQLILSGEEV 965

syringae 6; Provisional. Length = 1153
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 474
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 100.0
PLN032101153 Resistant to P. syringae 6; Provisional 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.94
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.94
PLN032101153 Resistant to P. syringae 6; Provisional 99.9
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.87
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.86
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.83
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.79
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.77
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.77
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.71
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.66
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.64
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.61
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.58
KOG0617264 consensus Ras suppressor protein (contains leucine 99.57
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.57
KOG0617264 consensus Ras suppressor protein (contains leucine 99.56
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.5
KOG4237498 consensus Extracellular matrix protein slit, conta 99.36
KOG4237498 consensus Extracellular matrix protein slit, conta 99.33
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 99.29
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 99.2
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.17
KOG4341483 consensus F-box protein containing LRR [General fu 99.14
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 99.1
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.08
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 99.06
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.01
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.99
KOG4341483 consensus F-box protein containing LRR [General fu 98.98
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.94
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 98.91
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.86
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.77
PRK15386426 type III secretion protein GogB; Provisional 98.75
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.68
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.67
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.56
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.54
PLN03150623 hypothetical protein; Provisional 98.41
PLN03150623 hypothetical protein; Provisional 98.39
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.37
PRK15386426 type III secretion protein GogB; Provisional 98.37
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.25
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.25
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.24
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.24
KOG2982418 consensus Uncharacterized conserved protein [Funct 97.99
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.97
KOG1947482 consensus Leucine rich repeat proteins, some prote 97.92
KOG2982418 consensus Uncharacterized conserved protein [Funct 97.88
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 97.88
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.81
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.81
KOG1947482 consensus Leucine rich repeat proteins, some prote 97.76
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.71
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.57
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.5
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 97.48
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 97.24
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.08
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.07
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 97.04
KOG2123388 consensus Uncharacterized conserved protein [Funct 96.17
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.14
KOG2123388 consensus Uncharacterized conserved protein [Funct 95.8
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.48
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 95.14
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 94.92
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 94.28
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 94.22
KOG3864221 consensus Uncharacterized conserved protein [Funct 94.14
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 92.59
smart0037026 LRR Leucine-rich repeats, outliers. 89.7
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 89.7
KOG3864221 consensus Uncharacterized conserved protein [Funct 88.63
smart0036726 LRR_CC Leucine-rich repeat - CC (cysteine-containi 86.57
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 86.23
smart0037026 LRR Leucine-rich repeats, outliers. 86.23
KOG4308478 consensus LRR-containing protein [Function unknown 84.67
KOG4308478 consensus LRR-containing protein [Function unknown 82.06
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information 
Probab=100.00  E-value=9.7e-39  Score=307.37  Aligned_cols=446  Identities=18%  Similarity=0.182  Sum_probs=309.4

Q ss_pred             CCCccEEEecCccccccccccccccCcccEEecCCCCCCcccCCccc-cCCccEEEccCCcCCccchhhhcccCccceee
Q 036075            1 MPNFEELDLGGCTRLREIHPTLLLHKKIILLNLKDCKSLTTLPDKIC-MESLKILVLSGCRKFKNFREIVGSRKCLSELL   79 (474)
Q Consensus         1 ~~nL~~L~L~~c~~l~~~~~~~~~l~~L~~L~L~~c~~l~~lp~~~~-l~~L~~L~L~~c~~l~~~~~~~~~l~~L~~L~   79 (474)
                      +|||+++++..+ .++.+|...+...+|+.|+|.+|..-..-.+.+. ++.|++|||+.|...+.--..+..-.++++|+
T Consensus       101 l~nLq~v~l~~N-~Lt~IP~f~~~sghl~~L~L~~N~I~sv~se~L~~l~alrslDLSrN~is~i~~~sfp~~~ni~~L~  179 (873)
T KOG4194|consen  101 LPNLQEVNLNKN-ELTRIPRFGHESGHLEKLDLRHNLISSVTSEELSALPALRSLDLSRNLISEIPKPSFPAKVNIKKLN  179 (873)
T ss_pred             CCcceeeeeccc-hhhhcccccccccceeEEeeeccccccccHHHHHhHhhhhhhhhhhchhhcccCCCCCCCCCceEEe
Confidence            478888888774 6777877777777788888887543322222333 77888888888653332224566667888888


Q ss_pred             ccCCCccccCccccccccCCcccc--ccCCchhhHH-HHhcCCcccEEEccCcCcccc-CCcccCCCCCcEEeccCCcCC
Q 036075           80 LDGTDIKELPKHKRSKISSNFESF--WPFQFSEFSE-IMTSMEHLLELHLEGTAIRGL-PVSIEHLTGLVLLNLRDCKNL  155 (474)
Q Consensus        80 L~~~~l~~l~~~~~~~~~~~L~~l--~~~~~~~l~~-~l~~l~~L~~L~L~~~~i~~l-~~~i~~l~~L~~L~L~~c~~l  155 (474)
                      |++|.|+.+.... +..+.+|..+  ..++++.+|. .|+++++|+.|+|..|+|+.+ .-.+.++.+|+.|.+.+|..-
T Consensus       180 La~N~It~l~~~~-F~~lnsL~tlkLsrNrittLp~r~Fk~L~~L~~LdLnrN~irive~ltFqgL~Sl~nlklqrN~I~  258 (873)
T KOG4194|consen  180 LASNRITTLETGH-FDSLNSLLTLKLSRNRITTLPQRSFKRLPKLESLDLNRNRIRIVEGLTFQGLPSLQNLKLQRNDIS  258 (873)
T ss_pred             ecccccccccccc-ccccchheeeecccCcccccCHHHhhhcchhhhhhccccceeeehhhhhcCchhhhhhhhhhcCcc
Confidence            8888888776542 3333355544  4778888885 556699999999999999987 456899999999999998765


Q ss_pred             CccCccCCCCCCCCEEeccCCCCCccCCCCccCCCCCcEEecCCCCCCCCC-CCCchhhHHHhhhccCCCCccCCC-CCC
Q 036075          156 ETLPSTIDGLKSLRNLYLSGCSKLKSMPGNFGKVESLEVLDLSGCKGPPLS-SSWYLPFLISLMRRCSDPMALGFP-SLS  233 (474)
Q Consensus       156 ~~lp~~l~~L~~L~~L~l~~c~~l~~~~~~l~~l~~L~~L~l~~~~~~~~~-~~~~~~~l~~l~~~~~~~~~~~l~-~l~  233 (474)
                      +--...++.+.++++|+++.|........++.++++|+.|+++.|.+..+. +.|.+..-...+....|......+ ++.
T Consensus       259 kL~DG~Fy~l~kme~l~L~~N~l~~vn~g~lfgLt~L~~L~lS~NaI~rih~d~WsftqkL~~LdLs~N~i~~l~~~sf~  338 (873)
T KOG4194|consen  259 KLDDGAFYGLEKMEHLNLETNRLQAVNEGWLFGLTSLEQLDLSYNAIQRIHIDSWSFTQKLKELDLSSNRITRLDEGSFR  338 (873)
T ss_pred             cccCcceeeecccceeecccchhhhhhcccccccchhhhhccchhhhheeecchhhhcccceeEeccccccccCChhHHH
Confidence            555667889999999999998777777788889999999999999866543 445554433333333333333333 377


Q ss_pred             CCCcccEEEccCCCCCCCCccccccCCCCCCEEeCCCCCCC----cccHhhhcCCCcceeccccccccccCCCC----CC
Q 036075          234 GLCSLRKLDLSDSNLGEGAIPNDIGNLCSLKELYLSKNSFI----TLPASINRLFNLEKLELEDCKRLQSMPQL----PP  305 (474)
Q Consensus       234 ~l~~L~~L~l~~~~l~~~~~~~~l~~l~~L~~L~L~~~~l~----~lp~~l~~l~~L~~L~l~~c~~l~~l~~l----~~  305 (474)
                      .+..|++|+|+.|.+.. --...+..+++|++|||+.|.+.    +-...+.++++|++|.+.++ +++++|.-    .+
T Consensus       339 ~L~~Le~LnLs~Nsi~~-l~e~af~~lssL~~LdLr~N~ls~~IEDaa~~f~gl~~LrkL~l~gN-qlk~I~krAfsgl~  416 (873)
T KOG4194|consen  339 VLSQLEELNLSHNSIDH-LAEGAFVGLSSLHKLDLRSNELSWCIEDAAVAFNGLPSLRKLRLTGN-QLKSIPKRAFSGLE  416 (873)
T ss_pred             HHHHhhhhcccccchHH-HHhhHHHHhhhhhhhcCcCCeEEEEEecchhhhccchhhhheeecCc-eeeecchhhhccCc
Confidence            77888888888887642 22335677888888888888765    33446777888888888887 56666631    24


Q ss_pred             CcceeeccccccccccccccccCccccccccccccccccCCCchhhhHHHHHHhhcCCCCCceeEecCCCCCCcccccCC
Q 036075          306 SIEEVRVNGCASLETLSGALKLCNSEYISINCIDDLKLLGCNGFAFSMLKEYLEVMSNPKQKFDIVVPGSEIPEWFMHQN  385 (474)
Q Consensus       306 ~L~~L~i~~c~~L~~l~~~~~l~~l~~~~c~~L~~l~~~~c~~~~~~~~~~~~~~~~~~~~~~~~~~pg~~iP~w~~~~~  385 (474)
                      +|++|++.+-+ +.++..      -.|..+ .|++|.+.. .++.+++...|+++|-......+.++..+.+|+|+..|+
T Consensus       417 ~LE~LdL~~Na-iaSIq~------nAFe~m-~Lk~Lv~nS-ssflCDCql~Wl~qWl~~~~lq~sv~a~CayPe~Lad~~  487 (873)
T KOG4194|consen  417 ALEHLDLGDNA-IASIQP------NAFEPM-ELKELVMNS-SSFLCDCQLKWLAQWLYRRKLQSSVIAKCAYPEPLADQS  487 (873)
T ss_pred             ccceecCCCCc-ceeecc------cccccc-hhhhhhhcc-cceEEeccHHHHHHHHHhcccccceeeeccCCcccccce
Confidence            66667665543 333321      234444 566665555 556667777788887665555678888999999999998


Q ss_pred             CCceEEEEcCCCccCCCcee-----------------eEEEEEEEeecCCCCCceEEEeee-------------------
Q 036075          386 DGSSIKFIMPSNLYCKNKAL-----------------GYAVCCVFHVHNHSPGLEVKRCGF-------------------  429 (474)
Q Consensus       386 ~g~si~~~~p~~~~~~~~~~-----------------g~~~c~v~~~~~~~~~~~~~~~g~-------------------  429 (474)
                           .+.+++..+.|++++                 .+.+-|..+..+.+|+..+|+.+.                   
T Consensus       488 -----i~svd~~~lvC~DspkpqI~~qPe~~~al~g~nirftC~a~sssasplsi~WR~dnevq~rv~ved~a~~~~q~r  562 (873)
T KOG4194|consen  488 -----IVSVDTANLVCDDSPKPQIVTQPETVSALIGENIRFTCNAYSSSASPLSIEWRKDNEVQPRVDVEDFATFLSQNR  562 (873)
T ss_pred             -----eEeechhhceecCCCCcceecCchHhhhhhccceEEEEEeccCCCCCceeEeeeccccCcccchhcchhhhhhhc
Confidence                 555666555444454                 344433333335567666666544                   


Q ss_pred             ------EEEecCccccccccccceeeeccccccccCCceeE
Q 036075          430 ------HPVYRHNVEFFNQPRNQWTRYTTYNLNEFYPNFVV  464 (474)
Q Consensus       430 ------~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  464 (474)
                            +..|+..++.+|+++.+.|||||+++||||++|+.
T Consensus       563 ~~~~~e~~~~~~~L~L~nVt~td~grYQCVvtN~FGStysq  603 (873)
T KOG4194|consen  563 NGTFGEREEYTAILHLDNVTFTDEGRYQCVVTNHFGSTYSQ  603 (873)
T ss_pred             cCccchhhhhhheeeeeeeecccCceEEEEEecccCcchhh
Confidence                  56666677889999999999999999999999985

>PLN03210 Resistant to P Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query474
4fcg_A328 Structure Of The Leucine-Rich Repeat Domain Of The 4e-09
3fxi_A 605 Crystal Structure Of The Human Tlr4-Human Md-2-E.Co 1e-04
4g8a_A 635 Crystal Structure Of Human Tlr4 Polymorphic Variant 1e-04
2z63_A 570 Crystal Structure Of The Tv8 Hybrid Of Human Tlr4 A 1e-04
2z62_A276 Crystal Structure Of The Tv3 Hybrid Of Human Tlr4 A 3e-04
3ul9_A278 Structure Of The Tv3 Mutant M41e Length = 278 3e-04
3ula_A279 Crystal Structure Of The Tv3 Mutant F63w-Md-2-Erito 3e-04
3ul7_A278 Crystal Structure Of The Tv3 Mutant F63w Length = 2 3e-04
3ul8_A279 Crystal Structure Of The Tv3 Mutant V134l Length = 4e-04
>pdb|4FCG|A Chain A, Structure Of The Leucine-Rich Repeat Domain Of The Type Iii Effector Xcv3220 (Xopl) Length = 328 Back     alignment and structure 
Iteration: 1

 Score = 59.7 bits (143), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 64/209 (30%), Positives = 93/209 (44%), Gaps = 18/209 (8%)
Query: 108 FSEFSEIMTSMEHLLELHLEGTAIRGLPVSIEHLTGLVLLNLRDCKN-LETLPSTIDGLK 166
             +F +    + HL    ++   +  LP + +   GL  L L   +N L  LP++I  L 
Sbjct: 93  LPQFPDQAFRLSHLQHXTIDAAGLXELPDTXQQFAGLETLTL--ARNPLRALPASIASLN 150
Query: 167 SLRNLYLSGCSKLKSMP---------GNFGKVESLEVLDL--SGCKGPPLSSSWYLPFLI 215
            LR L +  C +L  +P         G    + +L+ L L  +G +  P S +  L  L 
Sbjct: 151 RLRELSIRACPELTELPEPLASTDASGEHQGLVNLQSLRLEWTGIRSLPASIA-NLQNLK 209
Query: 216 SLMRRCSDPMALGFPSLSGLCSLRKLDLSDSNLGEGAIPNDIGNLCSLKELYLSK-NSFI 274
           SL  R S   ALG P++  L  L +LDL          P   G    LK L L   ++ +
Sbjct: 210 SLKIRNSPLSALG-PAIHHLPKLEELDLRGCTALRN-YPPIFGGRAPLKRLILKDCSNLL 267
Query: 275 TLPASINRLFNLEKLELEDCKRLQSMPQL 303
           TLP  I+RL  LEKL+L  C  L  +P L
Sbjct: 268 TLPLDIHRLTQLEKLDLRGCVNLSRLPSL 296
>pdb|3FXI|A Chain A, Crystal Structure Of The Human Tlr4-Human Md-2-E.Coli Lps Ra Complex Length = 605 Back     alignment and structure
>pdb|4G8A|A Chain A, Crystal Structure Of Human Tlr4 Polymorphic Variant D299g And T399i In Complex With Md-2 And Lps Length = 635 Back     alignment and structure
>pdb|2Z63|A Chain A, Crystal Structure Of The Tv8 Hybrid Of Human Tlr4 And Hagfish Vlrb.61 Length = 570 Back     alignment and structure
>pdb|2Z62|A Chain A, Crystal Structure Of The Tv3 Hybrid Of Human Tlr4 And Hagfish Vlrb.61 Length = 276 Back     alignment and structure
>pdb|3UL9|A Chain A, Structure Of The Tv3 Mutant M41e Length = 278 Back     alignment and structure
>pdb|3ULA|A Chain A, Crystal Structure Of The Tv3 Mutant F63w-Md-2-Eritoran Complex Length = 279 Back     alignment and structure
>pdb|3UL7|A Chain A, Crystal Structure Of The Tv3 Mutant F63w Length = 278 Back     alignment and structure
>pdb|3UL8|A Chain A, Crystal Structure Of The Tv3 Mutant V134l Length = 279 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query474
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-42
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 5e-28
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 4e-23
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-12
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 1e-29
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-21
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 3e-21
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 3e-21
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 1e-12
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-28
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 5e-24
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-13
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-26
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-20
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-20
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-15
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 2e-14
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-23
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-19
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-18
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 2e-11
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 9e-06
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-19
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 7e-18
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-15
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 2e-10
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 8e-10
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-17
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 6e-15
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 4e-12
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-17
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-14
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 6e-13
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 6e-11
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 7e-04
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-17
4fmz_A347 Internalin; leucine rich repeat, structural genomi 8e-17
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-16
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 7e-17
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-16
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-16
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-15
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-13
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-12
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 3e-04
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-16
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 8e-12
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-11
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 6e-05
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-16
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-12
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 6e-12
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-05
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 3e-16
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 3e-13
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 2e-12
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 4e-11
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 6e-11
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 6e-07
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-06
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-16
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-15
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-10
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 7e-04
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 6e-16
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-12
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-10
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 3e-10
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-15
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 4e-15
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-14
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-12
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 1e-15
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 4e-11
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 2e-05
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-15
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 7e-07
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-04
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 2e-15
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 5e-14
1o6v_A466 Internalin A; bacterial infection, extracellular r 3e-15
1o6v_A466 Internalin A; bacterial infection, extracellular r 3e-15
1o6v_A466 Internalin A; bacterial infection, extracellular r 6e-13
1o6v_A 466 Internalin A; bacterial infection, extracellular r 3e-12
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 3e-15
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 4e-12
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 5e-07
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 3e-05
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 4e-15
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 3e-14
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-04
4ezg_A197 Putative uncharacterized protein; internalin-A, le 6e-15
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-09
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 7e-15
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 4e-13
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-11
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-07
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-14
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 7e-12
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 4e-08
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 7e-05
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 1e-14
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 3e-14
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 2e-06
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 7e-14
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 4e-12
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 7e-14
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 2e-06
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 8e-14
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 5e-13
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 9e-09
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 7e-13
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-11
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-10
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 4e-07
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 9e-13
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 3e-12
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 4e-06
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 3e-12
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 3e-12
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 8e-06
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 9e-12
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-10
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 1e-11
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 4e-10
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 3e-09
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 1e-11
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 1e-04
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 2e-11
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 6e-09
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 2e-05
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 3e-11
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 1e-06
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 8e-06
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 4e-05
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 3e-11
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-10
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 5e-11
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-10
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 3e-06
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 7e-11
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-10
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-10
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 1e-08
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-06
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 3e-10
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 3e-10
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 3e-08
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-04
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 3e-10
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 4e-08
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 3e-10
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 4e-09
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 4e-05
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 6e-10
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-07
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 6e-10
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 5e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-09
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 9e-08
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 3e-04
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 1e-07
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 1e-06
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 7e-06
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 3e-07
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 1e-06
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 3e-06
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 8e-04
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 9e-06
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 1e-05
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 1e-05
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 3e-05
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-04
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
 Score =  151 bits (384), Expect = 3e-42
 Identities = 73/324 (22%), Positives = 115/324 (35%), Gaps = 58/324 (17%)

Query: 3   NFEELDLGGCTRLREIHPTLLLHKKIILLNLKDCKSLTTLPDKICMESLKILVLSGCRKF 62
             E L   G T LR  H  L   ++    +     S     +     +   +     R  
Sbjct: 13  GRENLYFQGSTALRPYHDVLSQWQRHYNADRNRWHSAWRQAN----SNNPQIETRTGRAL 68

Query: 63  KNFREIVG--SRKCLSELLLDGTDIKELPKH-------KRSKISSNFESFWPFQFSEFSE 113
           K   +++   ++     L L    + + P         +   I +           E  +
Sbjct: 69  KATADLLEDATQPGRVALELRSVPLPQFPDQAFRLSHLQHMTIDAA-------GLMELPD 121

Query: 114 IMTSMEHLLELHLEGTAIRGLPVSIEHLTGLVLLNLRDCKNLETLPSTI---------DG 164
            M     L  L L    +R LP SI  L  L  L++R C  L  LP  +          G
Sbjct: 122 TMQQFAGLETLTLARNPLRALPASIASLNRLRELSIRACPELTELPEPLASTDASGEHQG 181

Query: 165 LKSLRNLYLSGCSKLKSMPGNFGKVESLEVLDLSGCKGPPLSSSWYLPFLISLMRRCSDP 224
           L +L++L L   + ++S+P +   +++L+ L +       LS+   L             
Sbjct: 182 LVNLQSLRLE-WTGIRSLPASIANLQNLKSLKIRNSP---LSA---LG------------ 222

Query: 225 MALGFPSLSGLCSLRKLDLSDSNLGEGAIPNDIGNLCSLKELYLS-KNSFITLPASINRL 283
                P++  L  L +LDL          P   G    LK L L   ++ +TLP  I+RL
Sbjct: 223 -----PAIHHLPKLEELDLRGCTALRN-YPPIFGGRAPLKRLILKDCSNLLTLPLDIHRL 276

Query: 284 FNLEKLELEDCKRLQSMPQLPPSI 307
             LEKL+L  C  L     LP  I
Sbjct: 277 TQLEKLDLRGCVNLSR---LPSLI 297
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query474
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.96
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.95
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.95
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.95
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.95
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 99.95
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.95
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 99.95
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.94
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.94
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.94
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.94
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.94
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.94
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.94
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.94
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.94
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.93
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.93
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.93
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.93
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.93
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.93
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.93
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.93
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.93
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.93
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.92
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.92
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.92
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.92
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.92
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.92
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.92
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.92
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.92
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.92
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.91
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.91
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.91
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.91
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 99.91
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.9
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.9
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.9
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.9
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 99.9
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.9
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.89
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.89
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.89
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.89
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.89
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.88
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.88
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.88
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.88
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.88
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.87
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.87
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 99.85
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 99.85
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.85
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.84
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.84
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.84
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.84
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.82
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.81
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.81
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.81
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.81
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.81
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.81
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.8
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.8
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.8
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.79
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.79
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.79
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.79
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.79
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.79
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.78
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.77
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.77
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.76
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.76
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.74
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.73
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.73
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.73
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.72
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.71
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.71
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.7
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.67
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.66
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.65
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.65
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.65
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.65
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.65
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.64
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.64
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.61
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.61
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.59
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.58
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.57
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.57
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.57
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.56
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.56
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.54
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.54
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.52
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.51
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.5
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.47
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.46
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.45
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.41
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.37
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.34
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.34
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.33
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.31
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.27
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.26
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.24
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.24
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.24
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.23
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.17
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.17
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.06
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.03
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.0
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 98.99
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 98.97
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 98.96
4fdw_A401 Leucine rich hypothetical protein; putative cell s 98.94
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 98.81
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 98.79
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 98.69
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 98.63
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.63
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.48
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 98.43
4gt6_A394 Cell surface protein; leucine rich repeats, putati 98.34
4gt6_A394 Cell surface protein; leucine rich repeats, putati 98.21
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.14
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.1
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.08
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.05
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 97.91
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 97.75
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.74
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.62
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 96.57
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 95.79
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 94.41
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 92.53
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
Probab=99.96  E-value=7.4e-29  Score=261.67  Aligned_cols=331  Identities=17%  Similarity=0.196  Sum_probs=257.7

Q ss_pred             CCCccEEEecCcccccc-----------------cccccc--ccCcccEEecCCCCCCcccCCccc-cCCccEEEccCCc
Q 036075            1 MPNFEELDLGGCTRLRE-----------------IHPTLL--LHKKIILLNLKDCKSLTTLPDKIC-MESLKILVLSGCR   60 (474)
Q Consensus         1 ~~nL~~L~L~~c~~l~~-----------------~~~~~~--~l~~L~~L~L~~c~~l~~lp~~~~-l~~L~~L~L~~c~   60 (474)
                      +++|++|+|++|...+.                 +|..++  ++++|++|+|++|...+.+|..+. +++|++|++++|.
T Consensus       205 l~~L~~L~Ls~n~l~~~~~~~~~~~~~~~~~~~~ip~~l~~~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~Ls~n~  284 (636)
T 4eco_A          205 LTKLRQFYMGNSPFVAENICEAWENENSEYAQQYKTEDLKWDNLKDLTDVEVYNCPNLTKLPTFLKALPEMQLINVACNR  284 (636)
T ss_dssp             CTTCCEEEEESCCCCGGGBSSSCSCTTSHHHHHHTTSCCCGGGCTTCCEEEEECCTTCSSCCTTTTTCSSCCEEECTTCT
T ss_pred             ccCCCEEECcCCccccccccccccccccchhcccCchhhhhcccCCCCEEEecCCcCCccChHHHhcCCCCCEEECcCCC
Confidence            57899999999864443                 999999  999999999999999999998888 9999999999998


Q ss_pred             -CCc-cchhhhccc------CccceeeccCCCccccCccccccccCCccccc--cCCch-hhHHHHhcCCcccEEEccCc
Q 036075           61 -KFK-NFREIVGSR------KCLSELLLDGTDIKELPKHKRSKISSNFESFW--PFQFS-EFSEIMTSMEHLLELHLEGT  129 (474)
Q Consensus        61 -~l~-~~~~~~~~l------~~L~~L~L~~~~l~~l~~~~~~~~~~~L~~l~--~~~~~-~l~~~l~~l~~L~~L~L~~~  129 (474)
                       ... .+|..++++      ++|++|++++|.+..+|....+..+.+|+.|.  .+.+. .+| .+..+++|++|++++|
T Consensus       285 ~l~~~~lp~~~~~L~~~~~l~~L~~L~L~~n~l~~ip~~~~l~~l~~L~~L~L~~N~l~g~ip-~~~~l~~L~~L~L~~N  363 (636)
T 4eco_A          285 GISGEQLKDDWQALADAPVGEKIQIIYIGYNNLKTFPVETSLQKMKKLGMLECLYNQLEGKLP-AFGSEIKLASLNLAYN  363 (636)
T ss_dssp             TSCHHHHHHHHHHHHHSGGGGTCCEEECCSSCCSSCCCHHHHTTCTTCCEEECCSCCCEEECC-CCEEEEEESEEECCSS
T ss_pred             CCccccchHHHHhhhccccCCCCCEEECCCCcCCccCchhhhccCCCCCEEeCcCCcCccchh-hhCCCCCCCEEECCCC
Confidence             444 689888876      99999999999999888733355566677664  45566 788 8889999999999999


Q ss_pred             CccccCCcccCCCC-CcEEeccCCcCCCccCccCCCCC--CCCEEeccCCCCCccCCCCcc-------CCCCCcEEecCC
Q 036075          130 AIRGLPVSIEHLTG-LVLLNLRDCKNLETLPSTIDGLK--SLRNLYLSGCSKLKSMPGNFG-------KVESLEVLDLSG  199 (474)
Q Consensus       130 ~i~~l~~~i~~l~~-L~~L~L~~c~~l~~lp~~l~~L~--~L~~L~l~~c~~l~~~~~~l~-------~l~~L~~L~l~~  199 (474)
                      .+..+|..++.+++ |++|++++|. ++.+|..+..++  +|+.|++++|......|..+.       .+++|+.|++++
T Consensus       364 ~l~~lp~~l~~l~~~L~~L~Ls~N~-l~~lp~~~~~~~l~~L~~L~Ls~N~l~~~~p~~l~~~~~~~~~~~~L~~L~Ls~  442 (636)
T 4eco_A          364 QITEIPANFCGFTEQVENLSFAHNK-LKYIPNIFDAKSVSVMSAIDFSYNEIGSVDGKNFDPLDPTPFKGINVSSINLSN  442 (636)
T ss_dssp             EEEECCTTSEEECTTCCEEECCSSC-CSSCCSCCCTTCSSCEEEEECCSSCTTTTTTCSSCTTCSSCCCCCCEEEEECCS
T ss_pred             ccccccHhhhhhcccCcEEEccCCc-CcccchhhhhcccCccCEEECcCCcCCCcchhhhcccccccccCCCCCEEECcC
Confidence            99999999999999 9999999987 458888777655  899999999988888888777       788999999999


Q ss_pred             CCCCCCCCCC--chhhHHHhhhccCCCCccCCCC--CC-------CCCcccEEEccCCCCCCCCcccccc--CCCCCCEE
Q 036075          200 CKGPPLSSSW--YLPFLISLMRRCSDPMALGFPS--LS-------GLCSLRKLDLSDSNLGEGAIPNDIG--NLCSLKEL  266 (474)
Q Consensus       200 ~~~~~~~~~~--~~~~l~~l~~~~~~~~~~~l~~--l~-------~l~~L~~L~l~~~~l~~~~~~~~l~--~l~~L~~L  266 (474)
                      |.....+...  .++.+..+....+...  .+|.  +.       ++++|+.|++++|++.  .+|..+.  .+++|++|
T Consensus       443 N~l~~lp~~~~~~l~~L~~L~Ls~N~l~--~i~~~~~~~~~~~~~~l~~L~~L~Ls~N~l~--~lp~~~~~~~l~~L~~L  518 (636)
T 4eco_A          443 NQISKFPKELFSTGSPLSSINLMGNMLT--EIPKNSLKDENENFKNTYLLTSIDLRFNKLT--KLSDDFRATTLPYLVGI  518 (636)
T ss_dssp             SCCCSCCTHHHHTTCCCSEEECCSSCCS--BCCSSSSEETTEECTTGGGCCEEECCSSCCC--BCCGGGSTTTCTTCCEE
T ss_pred             CccCcCCHHHHccCCCCCEEECCCCCCC--CcCHHHhccccccccccCCccEEECcCCcCC--ccChhhhhccCCCcCEE
Confidence            9877544321  1333433332222222  3333  22       2338999999999987  4888887  89999999


Q ss_pred             eCCCCCCCcccHhhhcCCCcceecccc------ccccccCCCC---CCCcceeeccccccccccccccccCccccccccc
Q 036075          267 YLSKNSFITLPASINRLFNLEKLELED------CKRLQSMPQL---PPSIEEVRVNGCASLETLSGALKLCNSEYISINC  337 (474)
Q Consensus       267 ~L~~~~l~~lp~~l~~l~~L~~L~l~~------c~~l~~l~~l---~~~L~~L~i~~c~~L~~l~~~~~l~~l~~~~c~~  337 (474)
                      ++++|+++.+|..+..+++|+.|++++      +.....+|..   .++|+.|+++++.- +.++...       .  ++
T Consensus       519 ~Ls~N~l~~ip~~~~~l~~L~~L~Ls~N~~ls~N~l~~~~p~~l~~l~~L~~L~Ls~N~l-~~ip~~~-------~--~~  588 (636)
T 4eco_A          519 DLSYNSFSKFPTQPLNSSTLKGFGIRNQRDAQGNRTLREWPEGITLCPSLTQLQIGSNDI-RKVNEKI-------T--PN  588 (636)
T ss_dssp             ECCSSCCSSCCCGGGGCSSCCEEECCSCBCTTCCBCCCCCCTTGGGCSSCCEEECCSSCC-CBCCSCC-------C--TT
T ss_pred             ECCCCCCCCcChhhhcCCCCCEEECCCCcccccCcccccChHHHhcCCCCCEEECCCCcC-CccCHhH-------h--Cc
Confidence            999999999999999999999999955      4445555532   26788999988864 6665331       1  56


Q ss_pred             cccccccCCC
Q 036075          338 IDDLKLLGCN  347 (474)
Q Consensus       338 L~~l~~~~c~  347 (474)
                      |+.|++.++.
T Consensus       589 L~~L~Ls~N~  598 (636)
T 4eco_A          589 ISVLDIKDNP  598 (636)
T ss_dssp             CCEEECCSCT
T ss_pred             CCEEECcCCC
Confidence            7777776643
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 474
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 6e-10
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 9e-09
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 2e-07
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 6e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 0.001
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 0.002
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 4e-07
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 3e-06
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 1e-05
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 3e-05
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 2e-05
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 3e-04
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 6e-04
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]

 Score = 58.5 bits (140), Expect = 6e-10
 Identities = 37/179 (20%), Positives = 70/179 (39%), Gaps = 11/179 (6%)

Query: 115 MTSMEHLLELHLEGTAIRGLPVSIEHLTGLVLLNLRDCKNLETLPSTIDGLKSLRNLYLS 174
           +  + +L EL L G  ++ +  ++  LT L  L+L + +     P  + GL  L  L L 
Sbjct: 215 LGILTNLDELSLNGNQLKDIG-TLASLTNLTDLDLANNQISNLAP--LSGLTKLTELKLG 271

Query: 175 GCSKLKSMPGNFGKVESLEVLDLSGCKGPPLSSSWYLPFLISLMRRCSDPMALGFPSLSG 234
                   P     + +L  L+L+  +   +S    L  L  L              +S 
Sbjct: 272 ANQISNISP--LAGLTALTNLELNENQLEDISPISNLKNLTYL--TLYFNNISDISPVSS 327

Query: 235 LCSLRKLDLSDSNLGEGAIPNDIGNLCSLKELYLSKNSFITLPASINRLFNLEKLELED 293
           L  L++L  +++ + +    + + NL ++  L    N    L   +  L  + +L L D
Sbjct: 328 LTKLQRLFFANNKVSD---VSSLANLTNINWLSAGHNQISDLTP-LANLTRITQLGLND 382
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query474
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.89
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.88
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.85
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.83
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.83
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.8
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.8
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.8
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.75
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.74
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.73
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.73
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.71
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.68
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.67
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.67
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.64
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.62
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.61
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.61
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.53
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.45
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.37
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.33
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.33
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.31
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.3
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.28
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.22
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.21
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.2
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.15
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.11
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 98.99
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.84
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.72
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.0
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.71
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.68
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.64
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.12
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 96.86
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]

Probab=99.89  E-value=8.6e-24  Score=201.24  Aligned_cols=139  Identities=18%  Similarity=0.323  Sum_probs=67.8

Q ss_pred             cccEEecCCCCCCc--ccCCccc-cCCccEEEccCCcCC-ccchhhhcccCccceeeccCCCccccCccccccccCCccc
Q 036075           27 KIILLNLKDCKSLT--TLPDKIC-MESLKILVLSGCRKF-KNFREIVGSRKCLSELLLDGTDIKELPKHKRSKISSNFES  102 (474)
Q Consensus        27 ~L~~L~L~~c~~l~--~lp~~~~-l~~L~~L~L~~c~~l-~~~~~~~~~l~~L~~L~L~~~~l~~l~~~~~~~~~~~L~~  102 (474)
                      +++.|+|+++...+  .+|..++ +++|++|+|++|..+ ..+|..++++++|++|+|++|.+..++..           
T Consensus        51 ~v~~L~L~~~~l~g~~~lp~~l~~L~~L~~L~Ls~~N~l~g~iP~~i~~L~~L~~L~Ls~N~l~~~~~~-----------  119 (313)
T d1ogqa_          51 RVNNLDLSGLNLPKPYPIPSSLANLPYLNFLYIGGINNLVGPIPPAIAKLTQLHYLYITHTNVSGAIPD-----------  119 (313)
T ss_dssp             CEEEEEEECCCCSSCEECCGGGGGCTTCSEEEEEEETTEESCCCGGGGGCTTCSEEEEEEECCEEECCG-----------
T ss_pred             EEEEEECCCCCCCCCCCCChHHhcCccccccccccccccccccccccccccccchhhhccccccccccc-----------
Confidence            45666666543332  3555555 666666666653333 24566666666666666666655543321           


Q ss_pred             cccCCchhhHHHHhcCCcccEEEccCcCccc-cCCcccCCCCCcEEeccCCcCCCccCccCCCCCCC-CEEeccCCCCCc
Q 036075          103 FWPFQFSEFSEIMTSMEHLLELHLEGTAIRG-LPVSIEHLTGLVLLNLRDCKNLETLPSTIDGLKSL-RNLYLSGCSKLK  180 (474)
Q Consensus       103 l~~~~~~~l~~~l~~l~~L~~L~L~~~~i~~-l~~~i~~l~~L~~L~L~~c~~l~~lp~~l~~L~~L-~~L~l~~c~~l~  180 (474)
                                 .+..+.+|+.+++++|.+.. +|..++.+++|+.+++++|.....+|..+..+.++ +.++++++....
T Consensus       120 -----------~~~~~~~L~~l~l~~N~~~~~~p~~l~~l~~L~~l~l~~n~l~~~ip~~~~~l~~l~~~l~~~~n~l~~  188 (313)
T d1ogqa_         120 -----------FLSQIKTLVTLDFSYNALSGTLPPSISSLPNLVGITFDGNRISGAIPDSYGSFSKLFTSMTISRNRLTG  188 (313)
T ss_dssp             -----------GGGGCTTCCEEECCSSEEESCCCGGGGGCTTCCEEECCSSCCEEECCGGGGCCCTTCCEEECCSSEEEE
T ss_pred             -----------cccchhhhcccccccccccccCchhhccCcccceeeccccccccccccccccccccccccccccccccc
Confidence                       23344445555555444332 34445555555555555544444444444444443 444444443333


Q ss_pred             cCCCCcc
Q 036075          181 SMPGNFG  187 (474)
Q Consensus       181 ~~~~~l~  187 (474)
                      ..|..++
T Consensus       189 ~~~~~~~  195 (313)
T d1ogqa_         189 KIPPTFA  195 (313)
T ss_dssp             ECCGGGG
T ss_pred             ccccccc
Confidence            3333333
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure