Citrus Sinensis ID: 036078

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-----
MYRTAAKRLLSQGVTSINVRSGRTRLLPNLRQITCSSRFSTSTVNPQSGPNQQVNNEAPNFTDSKTTSSSSAAEEARDARSHKRERPRVVEYRDEQARVLEASLRHVAKHGWGEAAMIAGARDFFMDDCLQRLIDRIDSGEDLKDLIPSQRISKLVRIRLEMQAPYISKWPQALSIQAQPLNVPTSFKQRAMLVDEIWHAVGDEASDIDWYVKRTVLGGIYSTTEIYMLTDSSPDFCDTSRFLDDRVRDAFDLKKTFQEATYLAEAVGAGMGSSLQGFVSKVFKR
cHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHccccHHHHHHHHHHccccHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHccccHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc
cHHHHHHHHHHHHHHHccHccccccccccccccccccccccHHHcccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHcccccccHHHHHHHHHHccccHHHHHHHHHHHHHHcHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHcEEEEEccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc
MYRTAAKRLLSQGVtsinvrsgrtrllpnlrqitcssrfststvnpqsgpnqqvnneapnftdskttssssAAEEARDArshkrerprvveYRDEQARVLEASLRHVAKHGWGEAAMIAGARDFFMDDCLQRLIDRIdsgedlkdlipsqRISKLVRIRLEMqapyiskwpqalsiqaqplnvptsFKQRAMLVDEIWHAvgdeasdidWYVKRTVLGGIYSTTEiymltdsspdfcdtsrflDDRVRDAFDLKKTFQEATYLAEAVgagmgsslQGFVSKVFKR
myrtaakrllsqgvtsinvrsgrtrllpnlrqitcssrfststvnpqsgpnqqvnneapnftdskttssssaaeeardarshkrerprvveyrdEQARVLEASLRHVAKHGWGEAAMIAGARDFFMDDCLQRLIDRidsgedlkdlipsqrisKLVRIRLEMQAPYISKWPQALSIQAQPLNVPTSFKQRAMLVDEIWHAVGdeasdidwyvKRTVLGGIYSTTEIYMLTDSSPDFCDTSRFLDDRVRDAFDLKKTFQEATYLAEAVgagmgsslqgfvskvfkr
MYRTAAKRLLSQGVTSINVRSGRTRLLPNLRQITCSSRFSTSTVNPQSGPNQQVNNEAPNFTdskttssssaaeeardarsHKRERPRVVEYRDEQARVLEASLRHVAKHGWGEAAMIAGARDFFMDDCLQRLIDRIDSGEDLKDLIPSQRISKLVRIRLEMQAPYISKWPQALSIQAQPLNVPTSFKQRAMLVDEIWHAVGDEASDIDWYVKRTVLGGIYSTTEIYMLTDSSPDFCDTSRFLDDRVRDAFDLKKTFQEATYLAEAVGAGMGSSLQGFVSKVFKR
*************************LL**********************************************************************RVLEASLRHVAKHGWGEAAMIAGARDFFMDDCLQRLIDRIDSGEDLKDLIPSQRISKLVRIRLEMQAPYISKWPQALSIQAQPLNVPTSFKQRAMLVDEIWHAVGDEASDIDWYVKRTVLGGIYSTTEIYMLTDSSPDFCDTSRFLDDRVRDAFDLKKTFQEATYLAEAVGAGMGSSLQGF*******
*********LSQGVTSINVRSGRTRLL**********************************************************************RVLEASLRHVAKHGWGEAAMIAGARDFFMDDCLQRLID***************RISKLVRIRLEMQAPYISKWPQALSIQAQPLNVPTSFKQRAMLVDEIWHAVGDEASDIDWYVKRTVLGGIYSTTEIYMLTDSSPDFCDTSRFLDDRVRDAFDLKKTFQEATYLAEAVGAGMGSSLQGFVSKVFK*
MYRTAAKRLLSQGVTSINVRSGRTRLLPNLRQITCSS*************NQQVNNEAPN********************************RDEQARVLEASLRHVAKHGWGEAAMIAGARDFFMDDCLQRLIDRIDSGEDLKDLIPSQRISKLVRIRLEMQAPYISKWPQALSIQAQPLNVPTSFKQRAMLVDEIWHAVGDEASDIDWYVKRTVLGGIYSTTEIYMLTDSSPDFCDTSRFLDDRVRDAFDLKKTFQEATYLAEAVGAGMGSSLQGFVSKVFKR
MYRTAAKRLLSQGVTSINVRSGRTRLLPNLRQITCSSRFST***********************************************VVEYRDEQARVLEASLRHVAKHGWGEAAMIAGARDFFMDDCLQRLIDRIDSGEDLKDLIPSQRISKLVRIRLEMQAPYISKWPQALSIQAQPLNVPTSFKQRAMLVDEIWHAVGDEASDIDWYVKRTVLGGIYSTTEIYMLTDSSPDFCDTSRFLDDRVRDAFDLKKTFQEATYLAEAVGAGMGSSLQGFVSKVFKR
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MYRTAAKRLLSQGVTSINVRSGRTRLLPNLRQITCSSRFSTSTVNPQSGPNQQVNNEAPNFTDSKTTSSSSAAEEARDARSHKRERPRVVEYRDEQARVLEASLRHVAKHGWGEAAMIAGARDFFMDDCLQRLIDRIDSGEDLKDLIPSQRISKLVRIRLEMQAPYISKWPQALSIQAQPLNVPTSFKQRAMLVDEIWHAVGDEASDIDWYVKRTVLGGIYSTTEIYMLTDSSPDFCDTSRFLDDRVRDAFDLKKTFQEATYLAEAVGAGMGSSLQGFVSKVFKR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query285 2.2.26 [Sep-21-2011]
Q68FT1312 Ubiquinone biosynthesis p yes no 0.631 0.576 0.362 2e-32
Q8K1Z0313 Ubiquinone biosynthesis p yes no 0.631 0.575 0.357 3e-32
Q5RJV0317 Ubiquinone biosynthesis p yes no 0.631 0.567 0.352 4e-32
O75208318 Ubiquinone biosynthesis p yes no 0.852 0.764 0.319 4e-32
Q5PPX7293 Ubiquinone biosynthesis p N/A no 0.733 0.713 0.316 9e-32
Q2NL34319 Ubiquinone biosynthesis p yes no 0.631 0.564 0.352 1e-31
Q3B8B2317 Ubiquinone biosynthesis p N/A no 0.743 0.668 0.317 3e-31
Q86HS0307 Probable ubiquinone biosy yes no 0.624 0.579 0.318 2e-26
Q8MKN0326 Ubiquinone biosynthesis p yes no 0.547 0.478 0.338 5e-23
O13850250 Ubiquinone biosynthesis p yes no 0.6 0.684 0.280 4e-14
>sp|Q68FT1|COQ9_RAT Ubiquinone biosynthesis protein COQ9, mitochondrial OS=Rattus norvegicus GN=Coq9 PE=2 SV=2 Back     alignment and function desciption
 Score =  139 bits (351), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 75/207 (36%), Positives = 110/207 (53%), Gaps = 27/207 (13%)

Query: 96  QARVLEASLRHVAKHGWGEAAMIAGARDF--------------------FMDDCLQRLID 135
           Q R+L A+L  V  HGW   A+  GA+                      F+  C  RL  
Sbjct: 94  QHRILTAALEFVPDHGWTAEAIAEGAQSLGLSSAAASMFGSDGSELILHFVTQCNARLNH 153

Query: 136 RIDSGEDLKDLIPSQR------ISKLVRIRLEMQAPYISKWPQALSIQAQPLNVPTSFKQ 189
            ++  + L  L  +++      +   V  RL M  PYI  WP+ALSI   P N+P S   
Sbjct: 154 VLEEEQKLVQLGQAEKRKTDQFLRDAVETRLRMLIPYIEHWPRALSILLLPQNIPPSLSL 213

Query: 190 RAMLVDEIWHAVGDEASDIDWYVKRTVLGGIYSTTEIYMLTDSSPDFCDTSRFLDDRVRD 249
              +VD++WH  GD+++D +WY +R VL GIY+TTE+ M+ DSSPDF DT RFLD+R+ D
Sbjct: 214 LTSMVDDMWHYAGDQSTDFNWYTRRAVLAGIYNTTELVMMQDSSPDFEDTWRFLDNRIND 273

Query: 250 AFDLKKTFQEATYLAEAVGAG-MGSSL 275
           A ++  T ++     EA+  G MG+++
Sbjct: 274 AMNMGHTAKQVKSTGEALVQGLMGAAV 300
Involved in the biosynthesis of coenzyme Q.
Rattus norvegicus (taxid: 10116)
>sp|Q8K1Z0|COQ9_MOUSE Ubiquinone biosynthesis protein COQ9, mitochondrial OS=Mus musculus GN=Coq9 PE=1 SV=1 Back     alignment and function description
>sp|Q5RJV0|COQ9_XENTR Ubiquinone biosynthesis protein COQ9, mitochondrial OS=Xenopus tropicalis GN=coq9 PE=2 SV=1 Back     alignment and function description
>sp|O75208|COQ9_HUMAN Ubiquinone biosynthesis protein COQ9, mitochondrial OS=Homo sapiens GN=COQ9 PE=1 SV=1 Back     alignment and function description
>sp|Q5PPX7|COQ9B_XENLA Ubiquinone biosynthesis protein COQ9-B, mitochondrial OS=Xenopus laevis GN=coq9-b PE=2 SV=1 Back     alignment and function description
>sp|Q2NL34|COQ9_BOVIN Ubiquinone biosynthesis protein COQ9, mitochondrial OS=Bos taurus GN=COQ9 PE=2 SV=1 Back     alignment and function description
>sp|Q3B8B2|COQ9A_XENLA Ubiquinone biosynthesis protein COQ9-A, mitochondrial OS=Xenopus laevis GN=coq9-a PE=2 SV=2 Back     alignment and function description
>sp|Q86HS0|COQ9_DICDI Probable ubiquinone biosynthesis protein coq9, mitochondrial OS=Dictyostelium discoideum GN=coq9 PE=3 SV=2 Back     alignment and function description
>sp|Q8MKN0|COQ9_DROME Ubiquinone biosynthesis protein COQ9, mitochondrial OS=Drosophila melanogaster GN=Coq9 PE=1 SV=1 Back     alignment and function description
>sp|O13850|COQ9_SCHPO Ubiquinone biosynthesis protein coq9, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=coq9 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query285
224069176313 predicted protein [Populus trichocarpa] 0.989 0.900 0.629 1e-98
255550393318 Ubiquinone biosynthesis protein COQ9, mi 0.985 0.883 0.609 5e-96
225444671318 PREDICTED: ubiquinone biosynthesis prote 0.968 0.867 0.591 3e-93
297738536227 unnamed protein product [Vitis vinifera] 0.677 0.850 0.774 5e-91
18394701311 uncharacterized protein [Arabidopsis tha 0.975 0.893 0.568 9e-90
21593282311 unknown [Arabidopsis thaliana] 0.975 0.893 0.568 9e-90
42571541312 uncharacterized protein [Arabidopsis tha 0.975 0.891 0.566 1e-88
449500516311 PREDICTED: ubiquinone biosynthesis prote 0.971 0.890 0.579 3e-88
358248630291 uncharacterized protein LOC100775943 [Gl 0.950 0.931 0.6 7e-87
297850298309 hypothetical protein ARALYDRAFT_472138 [ 0.961 0.886 0.558 3e-86
>gi|224069176|ref|XP_002326293.1| predicted protein [Populus trichocarpa] gi|222833486|gb|EEE71963.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  365 bits (937), Expect = 1e-98,   Method: Compositional matrix adjust.
 Identities = 199/316 (62%), Positives = 235/316 (74%), Gaps = 34/316 (10%)

Query: 1   MYRTAA--KRLLSQGVTSINVRSGRTRLLPNLRQITCSSRFSTSTVN----PQSGPNQ-- 52
           MYRTAA  +RLLS G T+ N  + R R L NLR     SR+ T+  N    PQS  NQ  
Sbjct: 1   MYRTAALARRLLS-GATAGNNSNSRIRYL-NLRTTIIGSRYCTAVNNNHSFPQSIFNQNQ 58

Query: 53  --QVNNEAPNFTDSKTTSSSSAAEEARDARS-HKRERPRVVEYRDEQARVLEASLRHVAK 109
             + N E PN ++S ++S+ S +  A D R   +R++PR+ EY+++QARVLEASL HV +
Sbjct: 59  TPRANLEFPNQSESTSSSNWSTSSTAEDGRQRQERQKPRI-EYQEQQARVLEASLHHVLR 117

Query: 110 HGWGEAAMIAGARD--------------------FFMDDCLQRLIDRIDSGEDLKDLIPS 149
            GW E AMIAGARD                    FFMD+CLQ+LIDRIDSGE+L++L+PS
Sbjct: 118 LGWSEEAMIAGARDVGVSPSIVGSFPRKEAALVEFFMDECLQKLIDRIDSGEELQNLVPS 177

Query: 150 QRISKLVRIRLEMQAPYISKWPQALSIQAQPLNVPTSFKQRAMLVDEIWHAVGDEASDID 209
           +RISKL++IRLEMQ+PYISKWPQ LSIQA P N PTSFKQRAMLVDEIWHAVGD+ SDID
Sbjct: 178 ERISKLLKIRLEMQSPYISKWPQVLSIQAYPSNAPTSFKQRAMLVDEIWHAVGDQGSDID 237

Query: 210 WYVKRTVLGGIYSTTEIYMLTDSSPDFCDTSRFLDDRVRDAFDLKKTFQEATYLAEAVGA 269
           WYVKRTVLGGIYSTTEIYMLTDSSPDF DT  FLDDRV+DAFDLKKT QEA Y+AEAVGA
Sbjct: 238 WYVKRTVLGGIYSTTEIYMLTDSSPDFRDTWAFLDDRVKDAFDLKKTIQEAMYMAEAVGA 297

Query: 270 GMGSSLQGFVSKVFKR 285
           GMG+S QGFV +VF+R
Sbjct: 298 GMGNSFQGFVRRVFQR 313

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|255550393|ref|XP_002516247.1| Ubiquinone biosynthesis protein COQ9, mitochondrial precursor, putative [Ricinus communis] gi|223544733|gb|EEF46249.1| Ubiquinone biosynthesis protein COQ9, mitochondrial precursor, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|225444671|ref|XP_002277343.1| PREDICTED: ubiquinone biosynthesis protein COQ9-B, mitochondrial [Vitis vinifera] Back     alignment and taxonomy information
>gi|297738536|emb|CBI27781.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|18394701|ref|NP_564074.1| uncharacterized protein [Arabidopsis thaliana] gi|8954052|gb|AAF82225.1|AC069143_1 Contains similarity to a HSPC326 mRNA from Homo sapiens gb|AF161444. EST gb|AI997162 comes from this gene [Arabidopsis thaliana] gi|332191689|gb|AEE29810.1| uncharacterized protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|21593282|gb|AAM65231.1| unknown [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|42571541|ref|NP_973861.1| uncharacterized protein [Arabidopsis thaliana] gi|332191688|gb|AEE29809.1| uncharacterized protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|449500516|ref|XP_004161119.1| PREDICTED: ubiquinone biosynthesis protein COQ9, mitochondrial-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|358248630|ref|NP_001239658.1| uncharacterized protein LOC100775943 [Glycine max] gi|255648216|gb|ACU24561.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|297850298|ref|XP_002893030.1| hypothetical protein ARALYDRAFT_472138 [Arabidopsis lyrata subsp. lyrata] gi|297338872|gb|EFH69289.1| hypothetical protein ARALYDRAFT_472138 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query285
TAIR|locus:2011271312 AT1G19140 "AT1G19140" [Arabido 0.982 0.897 0.501 4.5e-66
UNIPROTKB|F1P310283 COQ9 "Uncharacterized protein" 0.529 0.533 0.392 2.4e-33
RGD|1586040312 Coq9 "coenzyme Q9 homolog (S. 0.529 0.483 0.398 5.5e-32
MGI|MGI:1915164313 Coq9 "coenzyme Q9 homolog (yea 0.529 0.482 0.392 1.4e-31
ZFIN|ZDB-GENE-061207-37331 coq9 "coenzyme Q9 homolog (S. 0.421 0.362 0.454 1.8e-31
UNIPROTKB|E2RQ22320 COQ9 "Uncharacterized protein" 0.529 0.471 0.392 5.7e-27
UNIPROTKB|I3LHS7319 COQ9 "Uncharacterized protein" 0.529 0.473 0.386 9.4e-27
DICTYBASE|DDB_G0274457307 coq9 "ubiquinone biosynthesis 0.512 0.475 0.38 1.2e-26
UNIPROTKB|Q2NL34319 COQ9 "Ubiquinone biosynthesis 0.529 0.473 0.392 1.5e-26
UNIPROTKB|O75208318 COQ9 "Ubiquinone biosynthesis 0.529 0.474 0.386 3.2e-26
TAIR|locus:2011271 AT1G19140 "AT1G19140" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 672 (241.6 bits), Expect = 4.5e-66, P = 4.5e-66
 Identities = 153/305 (50%), Positives = 196/305 (64%)

Query:     1 MYRTAAKRLLSQG-VTS---INVRSGRTRLLPN-LRQITCSSRFSTSTVNPQSGPNQQVN 55
             MYRTAAKRLL+ G +T+   + +   R+ ++P+      C+S    +T +P    +   N
Sbjct:     1 MYRTAAKRLLAGGGITTTRLLRLPKLRSTIIPSSYTSGLCTSSIGGNTESPMGKQSVNPN 60

Query:    56 NEAPNFTXXXXXXXXXXXXXXXXXXXH-KRERPRVVE----------YRDEQ----ARVL 100
                P  +                     + E+ RV+           + +E     +R +
Sbjct:    61 QSGPTASSSTGTGEGQRRHESRKPRAEFQEEQARVLSASLRHVPRLGWTEEAMMAGSRDV 120

Query:   101 EASLRHVAKHGWGEAAMIAGARDFFMDDCLQRLIDRIDSGEDLKDLIPSQRISKLVRIRL 160
               S   V      EAA++    +FFMD+CLQ L+DRIDSG DL++LIPS+RISKL+RIRL
Sbjct:   121 GVSPSIVGSFSRKEAALV----EFFMDECLQLLMDRIDSGLDLQNLIPSERISKLIRIRL 176

Query:   161 EMQAPYISKWPQALSIQAQPLNVPTSFKQRAMLVDEIWHAVGDEASDIDWYVKRTVLGGI 220
             EMQ PY+SKWPQALSIQA PLNVPTSFKQRAMLVDEIWHAVGD ASD+DWYVKRT+LGG+
Sbjct:   177 EMQVPYMSKWPQALSIQAHPLNVPTSFKQRAMLVDEIWHAVGDGASDLDWYVKRTILGGV 236

Query:   221 YSTTEIYMLTDSS-PDFCDTSRFLDDRVRDAFDLKKTFQEATYLAEAVGAGMGSSLQGFV 279
             YSTTEIYMLTD S  +  DT  FLDDRV+DAFDLKK+ QEA Y AE +GAG+G S+QG +
Sbjct:   237 YSTTEIYMLTDDSLAEHRDTWAFLDDRVKDAFDLKKSIQEAKYFAEDIGAGVGKSVQGLM 296

Query:   280 SKVFK 284
             + V +
Sbjct:   297 NGVMQ 301
GO:0003674 "molecular_function" evidence=ND
GO:0005739 "mitochondrion" evidence=ISM;IDA
GO:0006744 "ubiquinone biosynthetic process" evidence=IEA
UNIPROTKB|F1P310 COQ9 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
RGD|1586040 Coq9 "coenzyme Q9 homolog (S. cerevisiae)" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
MGI|MGI:1915164 Coq9 "coenzyme Q9 homolog (yeast)" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-061207-37 coq9 "coenzyme Q9 homolog (S. cerevisiae)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|E2RQ22 COQ9 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|I3LHS7 COQ9 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0274457 coq9 "ubiquinone biosynthesis protein" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
UNIPROTKB|Q2NL34 COQ9 "Ubiquinone biosynthesis protein COQ9, mitochondrial" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|O75208 COQ9 "Ubiquinone biosynthesis protein COQ9, mitochondrial" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query285
TIGR02396185 TIGR02396, diverge_rpsU, rpsU-divergently transcri 3e-62
pfam0851179 pfam08511, COQ9, COQ9 9e-32
COG5590229 COG5590, COG5590, Uncharacterized conserved protei 4e-19
>gnl|CDD|233846 TIGR02396, diverge_rpsU, rpsU-divergently transcribed protein Back     alignment and domain information 
 Score =  194 bits (495), Expect = 3e-62
 Identities = 69/181 (38%), Positives = 102/181 (56%), Gaps = 22/181 (12%)

Query: 96  QARVLEASLRHVAKHGWGEAAMIAGARD---------------------FFMDDCLQRLI 134
           +A++L+A+L HV   GW + A++  ARD                     FF D C   L+
Sbjct: 1   KAKLLDAALEHVPFLGWTDEALLLAARDLGYSDSLPGLLPPEGAADLIEFFEDYCDTALL 60

Query: 135 DRIDSGEDLKDLIPSQRISKLVRIRLEMQAPYISKWPQALSIQAQPLNVPTSFKQRAMLV 194
           + + S  DL+ L   ++I   V IRL+M  P I   PQAL+  AQP N+  S +  A L 
Sbjct: 61  EALKS-SDLEGLKVREKIELAVWIRLKMVIPIIQHLPQALAFLAQPQNLALSLRLLAELS 119

Query: 195 DEIWHAVGDEASDIDWYVKRTVLGGIYSTTEIYMLTDSSPDFCDTSRFLDDRVRDAFDLK 254
           D IW+  GD+++D +WY KR +L G+YS+TE++M+ D S  F DT  FLD R+++A  L+
Sbjct: 120 DAIWYLAGDKSTDFNWYTKRAILSGVYSSTELFMIQDKSEGFEDTWSFLDSRIKNAVKLQ 179

Query: 255 K 255
           K
Sbjct: 180 K 180

This uncharacterized protein is found in a number of Alphaproteobacteria and, with N-terminal regions long enough to be transit peptides, in eukaryotes. This phylogeny suggests mitochondrial derivation. In several Alphaproteobacteria, the gene for this protein is encoded divergently from rpsU, the gene for ribosomal protein S21. S21 is unusual in being encoded outside the usual long ribosomal protein operons, but rather in contexts that suggest regulation of the initiation of protein translation [Unknown function, General]. Length = 185
>gnl|CDD|192053 pfam08511, COQ9, COQ9 Back     alignment and domain information
>gnl|CDD|227877 COG5590, COG5590, Uncharacterized conserved protein [Function unknown] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 285
TIGR02396184 diverge_rpsU rpsU-divergently transcribed protein. 100.0
COG5590229 Uncharacterized conserved protein [Function unknow 100.0
PF0851179 COQ9: COQ9; InterPro: IPR013718 COQ9 is an enzyme 99.97
KOG2969264 consensus Uncharacterized conserved protein [Funct 99.95
PRK00767197 transcriptional regulator BetI; Validated 97.42
TIGR03384189 betaine_BetI transcriptional repressor BetI. BetI 97.05
PRK14996192 TetR family transcriptional regulator; Provisional 96.0
PRK15008212 HTH-type transcriptional regulator RutR; Provision 95.42
TIGR03613202 RutR pyrimidine utilization regulatory protein R. 94.75
PRK10668215 DNA-binding transcriptional repressor AcrR; Provis 94.71
PRK11202203 DNA-binding transcriptional repressor FabR; Provis 94.07
PRK09480194 slmA division inhibitor protein; Provisional 93.72
PRK09975213 DNA-binding transcriptional regulator EnvR; Provis 93.4
TIGR02366176 DHAK_reg probable dihydroxyacetone kinase regulato 90.73
PRK13756205 tetracycline repressor protein TetR; Provisional 89.76
PRK11552225 putative DNA-binding transcriptional regulator; Pr 88.12
PRK11640191 putative transcriptional regulator; Provisional 86.3
PF0044047 TetR_N: Bacterial regulatory proteins, tetR family 83.11
>TIGR02396 diverge_rpsU rpsU-divergently transcribed protein Back     alignment and domain information 
Probab=100.00  E-value=1.4e-48  Score=344.13  Aligned_cols=164  Identities=41%  Similarity=0.697  Sum_probs=148.3

Q ss_pred             HHHHHHHHHhHHhhcCccHHHHHHHHHH----------hccHHH---HH-------HHHHHhhcCCCCCCCChHHHHHHH
Q 036078           96 QARVLEASLRHVAKHGWGEAAMIAGARD----------FFMDDC---LQ-------RLIDRIDSGEDLKDLIPSQRISKL  155 (285)
Q Consensus        96 r~rIL~aAL~lVp~~GWt~~AL~~aA~d----------~F~~~~---~~-------~L~~~iD~~~~l~~l~~rERI~~l  155 (285)
                      +++||+++|+|||++||++.+|.++|++          +|+++.   .+       .+.+.+.. .++..++++|||+.+
T Consensus         1 ~~~iL~aal~~vp~~Gwt~~al~~aa~~lgl~~~~~~~~~~~g~~dLv~~~~~~~d~l~~~~~~-~~~~~~~~reri~~l   79 (184)
T TIGR02396         1 KAKILDAALEHVPFLGWTNEALLLAARELGYSDSTPGILPPEGAADLIEFFEDYCNALLASLKS-SDLEVLKVSEKIELA   79 (184)
T ss_pred             ChHHHHHHHHhhhhcCCCHHHHHHHHHHcCCCHHHHHHhCCchHHHHHHHHHHHHHHHHHHHhc-cccccCCHHHHHHHH
Confidence            4689999999999999999999999998          444432   22       33333321 356778999999999


Q ss_pred             HHHHHhhccchhhhHHHHHHhhcCCCCchHHHHHHHHHHHHHHHHhCCCCCCchhHHHHHHHHHHHHHHHHHHhcCCCCC
Q 036078          156 VRIRLEMQAPYISKWPQALSIQAQPLNVPTSFKQRAMLVDEIWHAVGDEASDIDWYVKRTVLGGIYSTTEIYMLTDSSPD  235 (285)
Q Consensus       156 L~~RLe~l~P~~e~~~qaLa~lalP~n~~~sl~~l~~laD~Iw~~AGD~StD~~wYtKRa~La~IY~stel~wL~D~S~d  235 (285)
                      |+.||++++||+++|+++++++++|+|++.+++++|+++|+||+++||+|+||||||||++|++||++|++|||+|+|||
T Consensus        80 i~~RL~~~~p~~~~~~~ala~~~~P~n~~~~~~~l~~l~D~iw~~aGD~s~D~~wYtKRa~L~~vY~st~l~~l~D~S~~  159 (184)
T TIGR02396        80 VWIRLKMNIPIIQHLPQALAFLAQPLNLITSLRLLARLSDAIWYLAGDKSTDFNWYTKRAILSGVYSSTELFMLQDKSEG  159 (184)
T ss_pred             HHHHHHhcccHHHHHHHHHHHHcCCCcHHHHHHHHHHHHHHHHHHhCCCcccchHHHHHHHHHHHHHHHHHHHhcCCCCC
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hHHHHHHHHHHHHHHHHHHHHHHHH
Q 036078          236 FCDTSRFLDDRVRDAFDLKKTFQEA  260 (285)
Q Consensus       236 ~~~T~aFLdrRL~~a~~l~~~~~~~  260 (285)
                      |++||+||||||+++++|++.++++
T Consensus       160 ~~~T~~FLdrri~~v~~~~~~k~~~  184 (184)
T TIGR02396       160 FEDTWSFLDSRIDNAVKLQKFKARL  184 (184)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHhcC
Confidence            9999999999999999999988753

This uncharacterized protein is found in a number of Alphaproteobacteria and, with N-terminal regions long enough to be transit peptides, in eukaryotes. This phylogeny suggests mitochondrial derivation. In several Alphaproteobacteria, the gene for this protein is encoded divergently from rpsU, the gene for ribosomal protein S21. S21 is unusual in being encoded outside the usual long ribosomal protein operons, but rather in contexts that suggest regulation of the initiation of protein translation.
>COG5590 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF08511 COQ9: COQ9; InterPro: IPR013718 COQ9 is an enzyme that is required for the biosynthesis of coenzyme Q [] Back     alignment and domain information
>KOG2969 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK00767 transcriptional regulator BetI; Validated Back     alignment and domain information
>TIGR03384 betaine_BetI transcriptional repressor BetI Back     alignment and domain information
>PRK14996 TetR family transcriptional regulator; Provisional Back     alignment and domain information
>PRK15008 HTH-type transcriptional regulator RutR; Provisional Back     alignment and domain information
>TIGR03613 RutR pyrimidine utilization regulatory protein R Back     alignment and domain information
>PRK10668 DNA-binding transcriptional repressor AcrR; Provisional Back     alignment and domain information
>PRK11202 DNA-binding transcriptional repressor FabR; Provisional Back     alignment and domain information
>PRK09480 slmA division inhibitor protein; Provisional Back     alignment and domain information
>PRK09975 DNA-binding transcriptional regulator EnvR; Provisional Back     alignment and domain information
>TIGR02366 DHAK_reg probable dihydroxyacetone kinase regulator Back     alignment and domain information
>PRK13756 tetracycline repressor protein TetR; Provisional Back     alignment and domain information
>PRK11552 putative DNA-binding transcriptional regulator; Provisional Back     alignment and domain information
>PRK11640 putative transcriptional regulator; Provisional Back     alignment and domain information
>PF00440 TetR_N: Bacterial regulatory proteins, tetR family; InterPro: IPR001647 This entry represents a DNA-binding domain with a helix-turn-helix (HTH) structure that is found in several bacterial and archaeal transcriptional regulators, such as TetR, the tetracycline resistance repressor Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query285
3ni7_A213 Bacterial regulatory proteins, TETR family; transc 3e-29
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 7e-05
1qzv_F154 Plant photosystem I: subunit PSAF; photosynthesis, 2e-04
>3ni7_A Bacterial regulatory proteins, TETR family; transcriptional regulator, structural genomics, PSI-2, structure initiative; HET: MSE; 2.78A {Nitrosomonas europaea} Length = 213 Back     alignment and structure
 Score =  109 bits (273), Expect = 3e-29
 Identities = 30/189 (15%), Positives = 65/189 (34%), Gaps = 24/189 (12%)

Query: 91  EYRDEQARVLEASLRHVAKHGWGEAAMIAGARD--------------------FFMDDCL 130
                +  +++ ++   A   W    +   A                       + D   
Sbjct: 4   NNDPMRDAIVDTAVELAAHTSWEAVRLYDIAARLAVSLDEIRLYFREKDELIDAWFDRAD 63

Query: 131 QRLIDRIDSGEDLKDLIPSQRISKLVRIRLEMQAPYISKWPQALSIQAQPLNVPTSFK-- 188
            R++   +S     DL+ S+RI  L+ I L+  A       Q +  + +  ++       
Sbjct: 64  SRMLKEAES-AGFLDLVASERIHHLIMIWLDALAVQRKVTRQMIMSKLEFGHIHIQIPAV 122

Query: 189 -QRAMLVDEIWHAVGDEASDIDWYVKRTVLGGIYSTTEIYMLTDSSPDFCDTSRFLDDRV 247
            + +  V  +  A   +A+ +   ++ + L  IY  T  + + D S +   T +FL   +
Sbjct: 123 MRVSRTVQWVREAAQRDATFMRRALEESTLTTIYLMTFFFWMRDESENSRHTRQFLKRHL 182

Query: 248 RDAFDLKKT 256
             A  L + 
Sbjct: 183 TMAAWLGQK 191
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1qzv_F Plant photosystem I: subunit PSAF; photosynthesis,plant photosynthetic reaction center, peripheral antenna; HET: CL1 PQN; 4.44A {Pisum sativum} SCOP: i.5.1.1 Length = 154 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query285
3ni7_A213 Bacterial regulatory proteins, TETR family; transc 99.86
2qib_A231 TETR-family transcriptional regulator; HTH DNA bin 97.9
3g1o_A255 Transcriptional regulatory repressor protein (TETR 97.69
2rae_A207 Transcriptional regulator, ACRR family protein; TE 97.69
3mnl_A203 KSTR, transcriptional regulatory protein (probably 97.64
3crj_A199 Transcription regulator; APC88200, TETR, structura 97.61
3q0w_A236 HTH-type transcriptional regulator EThr; TETR fami 97.6
3bni_A229 Putative TETR-family transcriptional regulator; st 97.59
2qko_A215 Possible transcriptional regulator, TETR family P; 97.56
3c07_A273 Putative TETR-family transcriptional regulator; AP 97.56
3nrg_A217 TETR family transcriptional regulator; structural 97.55
3on2_A199 Probable transcriptional regulator; protein struct 97.55
3bjb_A207 Probable transcriptional regulator, TETR family P; 97.54
3e7q_A215 Transcriptional regulator; structural genomics, PS 97.48
3f1b_A203 TETR-like transcriptional regulator; APC5888, rhod 97.43
3rd3_A197 Probable transcriptional regulator; 2.40A {Pseudom 97.39
3vib_A210 MTRR; helix-turn-helix motif, DNA binding, DNA bin 97.39
3g7r_A221 Putative transcriptional regulator; TETR, all-heli 97.36
3ppb_A195 Putative TETR family transcription regulator; DNA- 97.3
2nx4_A194 Transcriptional regulator, TETR family protein; HT 97.29
3kz9_A206 SMCR; transcriptional regulator, quorum S DNA-bind 97.28
3dcf_A218 Transcriptional regulator of the TETR/ACRR family; 97.28
3on4_A191 Transcriptional regulator, TETR family; structural 97.28
3jsj_A190 Putative TETR-family transcriptional regulator; DN 97.26
3bru_A222 Regulatory protein, TETR family; structural genomi 97.26
3qbm_A199 TETR transcriptional regulator; DNA/RNA-binding th 97.25
3pas_A195 TETR family transcription regulator; structural ge 97.22
2id3_A225 Putative transcriptional regulator; structural gen 97.16
2dg7_A195 Putative transcriptional regulator; helix-turn-hel 97.16
3kkc_A177 TETR family transcriptional regulator; APC20805, s 97.16
3knw_A212 Putative transcriptional regulator (TETR/ACRR FAM; 97.13
2g3b_A208 Putative TETR-family transcriptional regulator; tr 97.12
3he0_A196 Transcriptional regulator, TETR family; ACRR, vibr 97.12
3cjd_A198 Transcriptional regulator, TETR family; YP_510936. 97.12
3him_A211 Probable transcriptional regulator; TETR, bacteria 97.08
3qkx_A188 Uncharacterized HTH-type transcriptional regulato; 97.08
2oer_A214 Probable transcriptional regulator; helix-turn-hel 97.06
2f07_A197 YVDT; helix-turn-helix, transcription; HET: BTB; 2 97.03
3kkd_A237 Transcriptional regulator; TETR, structural genomi 97.0
2np5_A203 Transcriptional regulator; TETR family, structural 96.98
3aqt_A245 Bacterial regulatory proteins, TETR family; helix- 96.97
3mvp_A217 TETR/ACRR transcriptional regulator; PSI, MCSG, st 96.96
3lhq_A220 Acrab operon repressor (TETR/ACRR family); structu 96.96
3rh2_A212 Hypothetical TETR-like transcriptional regulator; 96.95
2of7_A260 Putative TETR-family transcriptional regulator; AP 96.94
2zb9_A214 Putative transcriptional regulator; transcription 96.93
3dpj_A194 Transcription regulator, TETR family; APC88616, si 96.9
3hta_A217 EBRA repressor; TETR family, DNA binding protein, 96.89
1zk8_A183 Transcriptional regulator, TETR family; TETR membe 96.89
4ich_A311 Transcriptional regulator; structural genomics, PS 96.88
3dew_A206 Transcriptional regulator, TETR family; S genomics 96.86
3frq_A195 Repressor protein MPHR(A); macrolide antibiotic. r 96.85
3bqz_B194 HTH-type transcriptional regulator QACR; multidrug 96.82
2g7s_A194 Transcriptional regulator, TETR family; APC5906, P 96.78
2hyj_A200 Putative TETR-family transcriptional regulator; HT 96.78
3nnr_A228 Transcriptional regulator, TETR family; TETR-famil 96.77
3c2b_A221 Transcriptional regulator, TETR family; structural 96.74
2fd5_A180 Transcriptional regulator; DNA-binding protein, st 96.73
2qtq_A213 Transcriptional regulator, TETR family; transcript 96.72
3s5r_A216 Transcriptional regulator TETR family; DNA/RNA-bin 96.68
1pb6_A212 Hypothetical transcriptional regulator YCDC; helix 96.67
2zcm_A192 Biofilm operon icaabcd HTH-type negative transcri 96.66
3f0c_A216 TETR-molecule A, transcriptional regulator; MCSG,P 96.66
2hku_A215 A putative transcriptional regulator; structural g 96.66
2dg8_A193 Putative TETR-family transcriptional regulatory P; 96.64
3lsj_A220 DEST; transcriptional repressor, TETR family, DNA- 96.59
3ccy_A203 Putative TETR-family transcriptional regulator; AP 96.53
3loc_A212 HTH-type transcriptional regulator RUTR; helix-tur 96.52
2w53_A219 Repressor, SMet; antibiotic resistance, multi-drug 96.51
3npi_A251 TETR family regulatory protein; structural genomic 96.49
3eup_A204 Transcriptional regulator, TETR family; structural 96.48
2eh3_A179 Transcriptional regulator; all alpha proteins, tet 96.45
2np3_A212 Putative TETR-family regulator; transcriptional re 96.45
1vi0_A206 Transcriptional regulator; structural genomics; HE 96.41
3egq_A170 TETR family transcriptional regulator; DNA-binding 96.39
2gfn_A209 HTH-type transcriptional regulator PKSA related P; 96.38
3qqa_A216 CMER; alpha-helical, helix-turn-helix, DNA-binding 96.37
3v6g_A208 Probable transcriptional regulatory protein (PROB 96.36
1ui5_A215 A-factor receptor homolog; helix-turn-helix, alpha 96.35
3anp_C204 Transcriptional repressor, TETR family; all alpha 96.29
2id6_A202 Transcriptional regulator, TETR family; 1.75A {The 96.28
3col_A196 Putative transcription regulator; structural genom 96.27
2hxo_A237 Putative TETR-family transcriptional regulator; TE 96.22
2fq4_A192 Transcriptional regulator, TETR family; DNA-bindin 96.2
3b81_A203 Transcriptional regulator, ACRR family; NP_350189. 96.16
3bhq_A211 Transcriptional regulator; bacterial RE proteins, 96.12
2yve_A185 Transcriptional regulator; helix-turn-helix, TETR- 96.11
2wui_A210 MEXZ, transcriptional regulator; gene regulation, 96.09
3lwj_A202 Putative TETR-family transcriptional regulator; st 96.06
4hku_A178 LMO2814 protein, TETR transcriptional regulator; s 96.06
2guh_A214 Putative TETR-family transcriptional regulator; he 96.05
3fiw_A211 Putative TETR-family transcriptional regulator; TE 96.05
2iai_A230 Putative transcriptional regulator SCO3833; struct 96.04
3vpr_A190 Transcriptional regulator, TETR family; all alpha, 95.84
3cwr_A208 Transcriptional regulator, TETR family; YP_425770. 95.79
2xdn_A210 HTH-type transcriptional regulator TTGR; transcrip 95.73
2hxi_A241 Putative transcriptional regulator; structural gen 95.69
4aci_A191 HTH-type transcriptional repressor ACNR; aconitase 95.67
3nxc_A212 HTH-type protein SLMA; nucleoid occlusion, cell di 95.61
2iu5_A195 DHAS, YCEG, HTH-type dhaklm operon transcriptional 95.6
2q24_A194 Putative TETR family transcriptional regulator; st 95.5
1sgm_A191 Putative HTH-type transcriptional regulator YXAF; 95.49
3gzi_A218 Transcriptional regulator, TETR family; TETR famil 95.48
1z0x_A220 Transcriptional regulator, TETR family; structural 95.3
2ibd_A204 Possible transcriptional regulator; probable trans 95.24
3vp5_A189 Transcriptional regulator; heme, sensor protein, T 95.23
2gen_A197 Probable transcriptional regulator; APC6095, TETR 95.1
1t33_A224 Putative transcriptional repressor (TETR/ACRR FAM; 95.09
2pz9_A226 Putative regulatory protein; structural genomics, 95.08
2g7l_A243 TETR-family transcriptional regulator; APC6062, pr 95.07
3cdl_A203 Transcriptional regulator AEFR; APC88582, TETR, ps 94.82
2jj7_A186 Hemolysin II regulatory protein; DNA-binding prote 94.52
4ac0_A202 Tetracycline repressor protein class B from trans 94.33
2vpr_A207 Tetracycline resistance repressor protein; transcr 94.32
2o7t_A199 Transcriptional regulator; transcription regulator 94.27
3bqy_A209 Putative TETR family transcriptional regulator; st 94.23
2y2z_A267 SIM16, SIMR, putative repressor simreg2; transcrip 94.17
2opt_A234 Actii protein; helical protein, TETR family, APO-p 94.17
2rek_A199 Putative TETR-family transcriptional regulator; su 94.16
3ljl_A156 Transcriptional regulator LUXT; structural genomic 94.01
2zcx_A231 SCO7815, TETR-family transcriptional regulator; he 93.92
2ras_A212 Transcriptional regulator, TETR family; bacterial 93.85
2i10_A202 Putative TETR transcriptional regulator; structura 93.78
2g7g_A213 RHA04620, putative transcriptional regulator; heli 93.61
2oi8_A216 Putative regulatory protein SCO4313; TETR, structu 93.54
2qwt_A196 Transcriptional regulator, TETR family; structural 93.54
1rkt_A205 Protein YFIR; transcription regulator, structural 93.21
3o60_A185 LIN0861 protein; PSI, MCSG, structural genomics, m 93.2
2fbq_A235 Probable transcriptional regulator; PA3006, APC589 92.88
2d6y_A202 Putative TETR family regulatory protein; helix-tur 92.47
2xpw_A207 Tetracycline repressor protein class D; transcript 92.44
2hyt_A197 TETR-family transcriptional regulator; structural 92.3
3geu_A189 Intercellular adhesion protein R; TETR family, int 91.81
2v57_A190 TETR family transcriptional repressor LFRR; DNA-bi 90.29
>3ni7_A Bacterial regulatory proteins, TETR family; transcriptional regulator, structural genomics, PSI-2, structure initiative; HET: MSE; 2.78A {Nitrosomonas europaea} Back     alignment and structure
Probab=99.86  E-value=1.7e-21  Score=168.85  Aligned_cols=165  Identities=19%  Similarity=0.243  Sum_probs=130.9

Q ss_pred             chHHHHHHHHHHhHHhhcCccHHHHHHHHHH----------hccHH--HHHHHHHHhhc-------CCCCCCCChHHHHH
Q 036078           93 RDEQARVLEASLRHVAKHGWGEAAMIAGARD----------FFMDD--CLQRLIDRIDS-------GEDLKDLIPSQRIS  153 (285)
Q Consensus        93 e~~r~rIL~aAL~lVp~~GWt~~AL~~aA~d----------~F~~~--~~~~L~~~iD~-------~~~l~~l~~rERI~  153 (285)
                      +..|++||++|++++.++||+..++.++|++          ||.++  ....+++....       ........+.++|.
T Consensus         6 ~~~r~~Il~aA~~l~~~~G~~~~tv~~Ia~~agvs~~t~y~~F~~K~~L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~   85 (213)
T 3ni7_A            6 DPMRDAIVDTAVELAAHTSWEAVRLYDIAARLAVSLDEIRLYFREKDELIDAWFDRADSRMLKEAESAGFLDLVASERIH   85 (213)
T ss_dssp             CHHHHHHHHHHHHHHHHSCSTTCCHHHHHHHTTSCHHHHHHHCSSHHHHHHHHHHHHHHHHHHHTTSTTGGGSCHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHcCccccCHHHHHHHhCCCHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHhhccCCCHHHHHH
Confidence            4579999999999999999999999999998          78766  22333322211       11223457899999


Q ss_pred             HHHHHHHhhccchhhhHHHHHHhhcCCCCchHH---HHHHHHHHHHHHHHhCCCCCCchhHHHHHHHHHHHHHHHHHHhc
Q 036078          154 KLVRIRLEMQAPYISKWPQALSIQAQPLNVPTS---FKQRAMLVDEIWHAVGDEASDIDWYVKRTVLGGIYSTTEIYMLT  230 (285)
Q Consensus       154 ~lL~~RLe~l~P~~e~~~qaLa~lalP~n~~~s---l~~l~~laD~Iw~~AGD~StD~~wYtKRa~La~IY~stel~wL~  230 (285)
                      .++..+++.+.+|.+.++.++..+..|.+....   ...++.+++.||..+|+.+.|++||+++..|+++|..++++|+.
T Consensus        86 ~~~~~~~~~~~~~~~~~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~l~~~~~~~~~~wl~  165 (213)
T 3ni7_A           86 HLIMIWLDALAVQRKVTRQMIMSKLEFGHIHIQIPAVMRVSRTVQWVREAAQRDATFMRRALEESTLTTIYLMTFFFWMR  165 (213)
T ss_dssp             HHHHHHHHHHHTTHHHHHHHHHHSCC--CHHHHHHHHHHHHHHHHHHHHHTCC-------CCCHHHHHHHHHHHHHHHHT
T ss_pred             HHHHHHHHHHHhCHHHHHHHHHHhcCCCchhhhhhhhHHHHHHHHHHHHHcCCCccchHHHHHHHHHHHHHHHHHHHHHc
Confidence            999999999999999999999999999998763   44788999999999999999999999999999999999999999


Q ss_pred             CCCCChHHHHHHHHHHHHHHHHHHHHH
Q 036078          231 DSSPDFCDTSRFLDDRVRDAFDLKKTF  257 (285)
Q Consensus       231 D~S~d~~~T~aFLdrRL~~a~~l~~~~  257 (285)
                      |.++++.+|++||+++|++++.++..+
T Consensus       166 d~~~~~~~t~~~ld~~l~~~~~~~~~~  192 (213)
T 3ni7_A          166 DESENSRHTRQFLKRHLTMAAWLGQKV  192 (213)
T ss_dssp             CCSGGGHHHHHHHHHHHHHHHHC----
T ss_pred             CCCccHHHHHHHHHHHHHHHHHHHHHH
Confidence            999999999999999999999988764
>2qib_A TETR-family transcriptional regulator; HTH DNA binding, STRU genomics, MCSG, PSI-2, protein structure initiative; HET: P6G; 1.70A {Streptomyces coelicolor A3} Back     alignment and structure
>3g1o_A Transcriptional regulatory repressor protein (TETR-family) EThr; TERT family, transcriptional repressor, DNA-binding; HET: RF1; 1.85A {Mycobacterium tuberculosis} Back     alignment and structure
>2rae_A Transcriptional regulator, ACRR family protein; TETR/ACRR family transcriptional regulator, structural genom 2, RHA08332, MCSG; 2.20A {Rhodococcus SP} Back     alignment and structure
>3mnl_A KSTR, transcriptional regulatory protein (probably TETR; TETR family of transcriptional regulator, all-helical; 1.80A {Mycobacterium tuberculosis} Back     alignment and structure
>3crj_A Transcription regulator; APC88200, TETR, structura genomics, PSI-2, protein structure initiative; HET: MSE; 2.60A {Haloarcula marismortui atcc 43049} Back     alignment and structure
>3q0w_A HTH-type transcriptional regulator EThr; TETR family, transcriptional repressor, transcription-transc inhibitor complex; HET: LL5; 1.60A {Mycobacterium tuberculosis} PDB: 3o8g_A* 3o8h_A* 3q0u_A* 3q0v_A* 3g1m_A* 3q3s_A* 3sdg_A* 3sfi_A* 1u9n_A* 1u9o_A* 3tp3_A 3qpl_A 3g1l_A* 1t56_A 3tp0_A* Back     alignment and structure
>3bni_A Putative TETR-family transcriptional regulator; structural genomics, APC7281; HET: PG4; 2.30A {Streptomyces coelicolor A3} Back     alignment and structure
>2qko_A Possible transcriptional regulator, TETR family P; TETR family protein, structural genomics, P protein structure initiative; 2.35A {Rhodococcus SP} Back     alignment and structure
>3c07_A Putative TETR-family transcriptional regulator; APC6322, structural GEN PSI-2, protein structure initiative; 2.70A {Streptomyces coelicolor A3} SCOP: a.4.1.9 a.121.1.1 PDB: 2ofl_A* Back     alignment and structure
>3nrg_A TETR family transcriptional regulator; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 2.56A {Chloroflexus aurantiacus} Back     alignment and structure
>3on2_A Probable transcriptional regulator; protein structure initiative, PSI-2, structural genomics, MI center for structural genomics, MCSG; HET: MSE PG6; 1.96A {Rhodococcus jostii} Back     alignment and structure
>3bjb_A Probable transcriptional regulator, TETR family P; APC7331, rhodococcus SP. RHA1, structural genomics, PS protein structure initiative; 2.50A {Rhodococcus SP} Back     alignment and structure
>3e7q_A Transcriptional regulator; structural genomics, PSI, MCSG, P structure initiative, midwest center for structural genomic binding; 2.20A {Pseudomonas aeruginosa} Back     alignment and structure
>3f1b_A TETR-like transcriptional regulator; APC5888, rhodococcus SP. RHA1, structural genomics, PS protein structure initiative; 2.40A {Rhodococcus} Back     alignment and structure
>3rd3_A Probable transcriptional regulator; 2.40A {Pseudomonas aeruginosa} Back     alignment and structure
>3vib_A MTRR; helix-turn-helix motif, DNA binding, DNA binding protein; HET: CXS; 2.40A {Neisseria gonorrhoeae} Back     alignment and structure
>3g7r_A Putative transcriptional regulator; TETR, all-helical, structural genomics, PSI-2, protein structure initiative; 1.38A {Streptomyces coelicolor A3} Back     alignment and structure
>3ppb_A Putative TETR family transcription regulator; DNA-binding, helix-turn-helix motif, HTH motif, DNA/RNA-BIND helical bundle fold; HET: MSE PG4; 2.10A {Shewanella loihica} Back     alignment and structure
>2nx4_A Transcriptional regulator, TETR family protein; HTH DNA binding motif, structural genomics, PSI-2, Pro structure initiative; 1.70A {Rhodococcus SP} Back     alignment and structure
>3kz9_A SMCR; transcriptional regulator, quorum S DNA-binding, transcription regulation, transcription regula; HET: MSE; 2.10A {Vibrio vulnificus} PDB: 2pbx_A Back     alignment and structure
>3dcf_A Transcriptional regulator of the TETR/ACRR family; YP_290855.1, structural genomics, joint center for structural genomics, JCSG; 2.50A {Thermobifida fusca YX} Back     alignment and structure
>3on4_A Transcriptional regulator, TETR family; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics; HET: MSE; 1.85A {Legionella pneumophila subsp} Back     alignment and structure
>3jsj_A Putative TETR-family transcriptional regulator; DNA-binding, transcription regulation; 2.10A {Streptomyces avermitilis ma-4680} Back     alignment and structure
>3bru_A Regulatory protein, TETR family; structural genomics, APC88928, PSI-2, protein structur initiative; 2.30A {Rhodobacter sphaeroides 2} Back     alignment and structure
>3qbm_A TETR transcriptional regulator; DNA/RNA-binding three-helical bundle, structural genomics, J center for structural genomics, JCSG; HET: MSE PGE; 1.80A {Chloroflexus aurantiacus} Back     alignment and structure
>3pas_A TETR family transcription regulator; structural genomics, joint center for structural genomics, J protein structure initiative; HET: MSE; 1.90A {Marinobacter aquaeolei} Back     alignment and structure
>2id3_A Putative transcriptional regulator; structural genomics, PSI-2, prote structure initiative; 1.70A {Streptomyces coelicolor} SCOP: a.4.1.9 a.121.1.1 Back     alignment and structure
>2dg7_A Putative transcriptional regulator; helix-turn-helix motif, TETR family, gene regulation; 2.30A {Streptomyces coelicolor} Back     alignment and structure
>3kkc_A TETR family transcriptional regulator; APC20805, structural genomics, PSI-2, protein structure initiative; 2.50A {Streptococcus agalactiae 2603V} Back     alignment and structure
>3knw_A Putative transcriptional regulator (TETR/ACRR FAM; TETR-like protein, MCSG, PSI, structural genomics, protein S initiative; 2.45A {Acinetobacter SP} Back     alignment and structure
>2g3b_A Putative TETR-family transcriptional regulator; transcription regulator, structural genomics, P protein structure initiative; HET: MSE; 2.00A {Rhodococcus SP} SCOP: a.4.1.9 a.121.1.1 Back     alignment and structure
>3he0_A Transcriptional regulator, TETR family; ACRR, vibrio parahaemolytic structural genomics, PSI-2, protein structure initiative; HET: MSE; 2.20A {Vibrio parahaemolyticus} Back     alignment and structure
>3cjd_A Transcriptional regulator, TETR family; YP_510936.1, putative TETR transcriptional regulator, struct genomics; HET: STE; 1.79A {Jannaschia SP} Back     alignment and structure
>3him_A Probable transcriptional regulator; TETR, bacterial, RHA1, PSI-2, MCSG, structural midwest center for structural genomics; 2.20A {Rhodococcus jostii} Back     alignment and structure
>3qkx_A Uncharacterized HTH-type transcriptional regulato; structural genomics, joint center for structural genomics; HET: MSE; 2.35A {Haemophilus influenzae} Back     alignment and structure
>2oer_A Probable transcriptional regulator; helix-turn-helix, alpha-beta, structural genomics, PSI-2, protein structure initiative; 2.00A {Pseudomonas aeruginosa} Back     alignment and structure
>2f07_A YVDT; helix-turn-helix, transcription; HET: BTB; 2.30A {Bacillus subtilis subsp} Back     alignment and structure
>3kkd_A Transcriptional regulator; TETR, structural genomics, PSI-2, structure initiative, midwest center for structural genomic DNA-binding; HET: PGE 15P; 2.10A {Pseudomonas aeruginosa PAO1} Back     alignment and structure
>2np5_A Transcriptional regulator; TETR family, structural genomics, protein structure initiative, midwest center for structural genomics, MCSG; HET: MSE LMT NDS; 1.80A {Rhodococcus SP} SCOP: a.4.1.9 a.121.1.1 Back     alignment and structure
>3aqt_A Bacterial regulatory proteins, TETR family; helix-turn-helix, all alpha, transcription, transcription RE transcription regulator; 2.50A {Corynebacterium glutamicum} PDB: 3aqs_A Back     alignment and structure
>3mvp_A TETR/ACRR transcriptional regulator; PSI, MCSG, structural genomics, midwest center for structura genomics, protein structure initiative; 1.85A {Streptococcus mutans} Back     alignment and structure
>3lhq_A Acrab operon repressor (TETR/ACRR family); structural genomics, IDP02616, csgid, DNA-binding, transcription, transcription regulation; 1.56A {Salmonella enterica subsp} PDB: 3bcg_A 2qop_A Back     alignment and structure
>3rh2_A Hypothetical TETR-like transcriptional regulator; DNA/RNA-binding 3-helical bundle, structural genomics, joint for structural genomics; 2.42A {Shewanella amazonensis} Back     alignment and structure
>2of7_A Putative TETR-family transcriptional regulator; APC7240, streptomyces coelicolor A3, structural genomics, PSI-2; 2.30A {Streptomyces coelicolor} Back     alignment and structure
>2zb9_A Putative transcriptional regulator; transcription regulator, TETR family, helix-turn-helix, DNA- binding, transcription regulation; 2.25A {Streptomyces coelicolor} Back     alignment and structure
>3dpj_A Transcription regulator, TETR family; APC88616, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; HET: MES; 1.90A {Silicibacter pomeroyi} Back     alignment and structure
>3hta_A EBRA repressor; TETR family, DNA binding protein, multidrug resistance, MULT binding protein, DNA-binding, transcription; 2.30A {Streptomyces lividans} PDB: 3hth_A* 3hti_A* 3htj_A* 3iuv_A Back     alignment and structure
>1zk8_A Transcriptional regulator, TETR family; TETR member,transcriptional regulator, STRU genomics, PSI, protein structure initiative; 2.15A {Bacillus cereus atcc 14579} SCOP: a.4.1.9 a.121.1.1 Back     alignment and structure
>4ich_A Transcriptional regulator; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, transcription RE; 1.95A {Saccharomonospora viridis} Back     alignment and structure
>3dew_A Transcriptional regulator, TETR family; S genomics, PSI-2, protein structure initiative, midwest CENT structural genomics, MCSG; HET: MSE; 1.75A {Geobacter sulfurreducens} Back     alignment and structure
>3frq_A Repressor protein MPHR(A); macrolide antibiotic. repressor, biosensor, erythromycin, STRPTOMYCES, natural products, biosynthesis, DNA-binding; HET: ERY; 1.76A {Escherichia coli} PDB: 3g56_A Back     alignment and structure
>3bqz_B HTH-type transcriptional regulator QACR; multidrug resistance, TETR, malachite green, DNA- binding, plasmid, repressor; HET: MGR; 2.17A {Staphylococcus aureus} PDB: 3br1_B* 3br3_B* 3pm1_B* 1rkw_B* 1jt0_A* 1jty_B* 1jum_B* 1jup_B* 1jtx_B* 1jus_B* 2dtz_B 2gby_B* 2hq5_B 3br2_B* 3br5_B* 1qvt_B* 1qvu_B* 3br0_B* 3br6_B* 1jt6_B* ... Back     alignment and structure
>2g7s_A Transcriptional regulator, TETR family; APC5906, PSI, protein structure initiat midwest center for structural genomics, MCSG; HET: MSE; 1.40A {Agrobacterium tumefaciens str} SCOP: a.4.1.9 a.121.1.1 Back     alignment and structure
>2hyj_A Putative TETR-family transcriptional regulator; HTH DNA binding motif, structural genomics, PSI-2, Pro structure initiative; 2.19A {Streptomyces coelicolor} SCOP: a.4.1.9 a.121.1.1 Back     alignment and structure
>3nnr_A Transcriptional regulator, TETR family; TETR-family transcriptional regulator, structural genomics, center for structural genomics, JCSG; HET: MSE; 2.49A {Marinobacter aquaeolei} Back     alignment and structure
>3c2b_A Transcriptional regulator, TETR family; structural genomics, APC5923, PSI-2, PR structure initiative; 2.10A {Agrobacterium tumefaciens str} Back     alignment and structure
>2fd5_A Transcriptional regulator; DNA-binding protein, structural G PSI, protein structure initiative, midwest center for struc genomics, MCSG; 1.70A {Pseudomonas aeruginosa} SCOP: a.4.1.9 a.121.1.1 Back     alignment and structure
>2qtq_A Transcriptional regulator, TETR family; transcription regulator, DNA/RNA-binding 3-helical bundle FO turn helix motif, HTH motif; HET: MSE; 1.85A {Novosphingobium aromaticivorans} PDB: 2rha_A* Back     alignment and structure
>3s5r_A Transcriptional regulator TETR family; DNA/RNA-binding 3-helical bundle, tetracyclin repressor-like structural genomics; 2.60A {Syntrophus aciditrophicus} Back     alignment and structure
>1pb6_A Hypothetical transcriptional regulator YCDC; helix-loop-helix, dimer, structural genomics, PSI, protein structure initiative; 2.50A {Escherichia coli} PDB: 3loc_A* Back     alignment and structure
>2zcm_A Biofilm operon icaabcd HTH-type negative transcri regulator ICAR; helix-turn-helix, TETR family, repressor; 1.33A {Staphylococcus epidermidis} PDB: 2zcn_A Back     alignment and structure
>3f0c_A TETR-molecule A, transcriptional regulator; MCSG,PSI, SAD, structural genomics, protein structure initiative; 2.96A {Cytophaga hutchinsonii} Back     alignment and structure
>2hku_A A putative transcriptional regulator; structural genomics, APC6040, TET rhodococcus SP. RHA1, PSI-2, protein structure initiative; HET: PG4; 2.00A {Rhodococcus SP} SCOP: a.4.1.9 a.121.1.1 Back     alignment and structure
>2dg8_A Putative TETR-family transcriptional regulatory P; helix-turn-helix motif, gene regulation; 2.21A {Streptomyces coelicolor} Back     alignment and structure
>3lsj_A DEST; transcriptional repressor, TETR family, DNA-binding, transcription, transcription regulation; HET: PLM COA; 2.30A {Pseudomonas aeruginosa} PDB: 3lsp_A* 3lsr_A* Back     alignment and structure
>3ccy_A Putative TETR-family transcriptional regulator; APC88698, structural G PSI-2, protein structure initiative; HET: MSE; 2.01A {Bordetella parapertussis 12822} Back     alignment and structure
>3loc_A HTH-type transcriptional regulator RUTR; helix-turn-helix, putative transcriptional regulator, dimer, structural genomics, PSI; HET: MSE; 2.50A {Escherichia coli} Back     alignment and structure
>2w53_A Repressor, SMet; antibiotic resistance, multi-drug efflux pump, transcription regulation, transcriptional repressor, DNA binding; 2.00A {Stenotrophomonas maltophilia} PDB: 3p9t_A* Back     alignment and structure
>3npi_A TETR family regulatory protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; 2.96A {Corynebacterium diphtheriae} Back     alignment and structure
>3eup_A Transcriptional regulator, TETR family; structural genomics, MCSG, protein structure initiative, midwest center for STRU genomics; 1.99A {Cytophaga hutchinsonii} Back     alignment and structure
>2eh3_A Transcriptional regulator; all alpha proteins, tetracyclin repressor-like, C-terminal D homeodomain-like, DNA/RNA-binding 3-helical bundle; 1.55A {Aquifex aeolicus} Back     alignment and structure
>2np3_A Putative TETR-family regulator; transcriptional regulator, structural genomics, PSI-2, structure initiative; HET: MSE; 2.35A {Streptomyces coelicolor} SCOP: a.4.1.9 a.121.1.1 Back     alignment and structure
>1vi0_A Transcriptional regulator; structural genomics; HET: MSE DCC; 1.65A {Bacillus subtilis} SCOP: a.4.1.9 a.121.1.1 Back     alignment and structure
>3egq_A TETR family transcriptional regulator; DNA-binding, transcription regulation, bacterial regulatory DNA/RNA-binding 3-helical bundle fold; HET: MSE PE8; 2.55A {Archaeoglobus fulgidus} Back     alignment and structure
>2gfn_A HTH-type transcriptional regulator PKSA related P; transcriptional regulato PSI-2, regulatory protein, structural genomics, protein STR initiative; 1.90A {Rhodococcus SP} SCOP: a.4.1.9 a.121.1.1 Back     alignment and structure
>3qqa_A CMER; alpha-helical, helix-turn-helix, DNA-binding, transcription regulation, transcription repressor, drug binding, transcri; HET: TCH; 2.20A {Campylobacter jejuni} PDB: 3hgy_A* 3qps_A* 2qco_A 3hgg_A* Back     alignment and structure
>3v6g_A Probable transcriptional regulatory protein (PROB family); helix-turn-helix DNA binding domain; 1.82A {Mycobacterium tuberculosis} Back     alignment and structure
>1ui5_A A-factor receptor homolog; helix-turn-helix, alpha-helix-bundle, antibiotic; 2.40A {Streptomyces coelicolor} SCOP: a.4.1.9 a.121.1.1 PDB: 1ui6_A Back     alignment and structure
>3anp_C Transcriptional repressor, TETR family; all alpha protein, DNA, acyl-COA; HET: DCC DAO; 1.95A {Thermus thermophilus} PDB: 3ang_C* Back     alignment and structure
>2id6_A Transcriptional regulator, TETR family; 1.75A {Thermotoga maritima} SCOP: a.4.1.9 a.121.1.1 PDB: 3ih2_A 3ih3_A 3ih4_A 1zkg_A* 2iek_A* 1z77_A* Back     alignment and structure
>3col_A Putative transcription regulator; structural genomics, PSI-2, protein structure initiative, midwest CENT structural genomics, MCSG; HET: MSE; 2.10A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>2hxo_A Putative TETR-family transcriptional regulator; TETR transcriptional regulator, structural genomics, PSI-2, structure initiative; 2.40A {Streptomyces coelicolor} Back     alignment and structure
>2fq4_A Transcriptional regulator, TETR family; DNA-binding protein, bacillu structural genomics, PSI, protein structure initiative; 1.79A {Bacillus cereus} SCOP: a.4.1.9 a.121.1.1 Back     alignment and structure
>3b81_A Transcriptional regulator, ACRR family; NP_350189.1, predicted DNA-binding transcriptional regulator TETR/ACRR family; 2.10A {Clostridium acetobutylicum atcc 824} Back     alignment and structure
>3bhq_A Transcriptional regulator; bacterial RE proteins, structural genomics, joint center for structural JCSG, protein structure initiative, PSI-2; HET: MSE; 1.54A {Mesorhizobium loti} Back     alignment and structure
>2yve_A Transcriptional regulator; helix-turn-helix, TETR-family; HET: MBT; 1.40A {Corynebacterium glutamicum} PDB: 1v7b_A 2zoy_A 2yvh_A 2dh0_A* 2zoz_A* Back     alignment and structure
>2wui_A MEXZ, transcriptional regulator; gene regulation, transcription regulation, TETR, DNA-binding transcription; 2.90A {Pseudomonas aeruginosa} Back     alignment and structure
>3lwj_A Putative TETR-family transcriptional regulator; structural G joint center for structural genomics, JCSG, protein structu initiative; 2.07A {Syntrophomonas wolfei subsp} Back     alignment and structure
>4hku_A LMO2814 protein, TETR transcriptional regulator; structural genomics, PSI-biology; 2.30A {Listeria monocytogenes} Back     alignment and structure
>2guh_A Putative TETR-family transcriptional regulator; helix-turn-helix, TETR fold, structural genomics, PSI, prote structure initiative; HET: MSE; 1.52A {Rhodococcus SP} Back     alignment and structure
>3fiw_A Putative TETR-family transcriptional regulator; TETR-family transcriptional regulator streptomyces, structur genomics, PSI-2; 2.20A {Streptomyces coelicolor} Back     alignment and structure
>2iai_A Putative transcriptional regulator SCO3833; structural genomics, TETR, unknow function, PSI-2, protein structure initiative; 1.65A {Streptomyces coelicolor} Back     alignment and structure
>3vpr_A Transcriptional regulator, TETR family; all alpha, helix-turn-helix, transcriptional repressor, DNA protein; 2.27A {Thermus thermophilus} Back     alignment and structure
>3cwr_A Transcriptional regulator, TETR family; YP_425770.1, transcriptional regulator of TETR family, bacterial regulatory proteins; 1.50A {Rhodospirillum rubrum atcc 11170} Back     alignment and structure
>2xdn_A HTH-type transcriptional regulator TTGR; transcription regulation, TETR family; 2.20A {Pseudomonas putida} PDB: 2uxu_A* 2uxi_A* 2uxo_A* 2uxp_A* 2uxh_A* Back     alignment and structure
>2hxi_A Putative transcriptional regulator; structural genomics, APC6293, TET streptomyces coelicolor A3(2), PSI-2; 1.70A {Streptomyces coelicolor} Back     alignment and structure
>4aci_A HTH-type transcriptional repressor ACNR; aconitase, citrate, TETR superfamily; HET: CIT; 1.65A {Corynebacterium glutamicum} PDB: 4ac6_A* Back     alignment and structure
>3nxc_A HTH-type protein SLMA; nucleoid occlusion, cell division, TETR family member, DNA B protein; 2.50A {Escherichia coli} Back     alignment and structure
>2iu5_A DHAS, YCEG, HTH-type dhaklm operon transcriptional activator; synthase, TETR family; 1.6A {Lactococcus lactis subsp} SCOP: a.4.1.9 a.121.1.1 Back     alignment and structure
>2q24_A Putative TETR family transcriptional regulator; structural genomics, PSI, protein structure initiative; 1.80A {Streptomyces coelicolor A3} Back     alignment and structure
>1sgm_A Putative HTH-type transcriptional regulator YXAF; structural genomics, PSI, protein structure initiative; 2.00A {Bacillus subtilis} SCOP: a.4.1.9 a.121.1.1 Back     alignment and structure
>3gzi_A Transcriptional regulator, TETR family; TETR family transcriptional regulator, structural genomics, center for structural genomics, JCSG; 2.05A {Shewanella loihica pv-4} Back     alignment and structure
>1z0x_A Transcriptional regulator, TETR family; structural genomics, PSI, P structure initiative; 2.40A {Enterococcus faecalis} SCOP: a.4.1.9 a.121.1.1 Back     alignment and structure
>2ibd_A Possible transcriptional regulator; probable transcriptional regulatory protein, rhodococcus SP. structural genomics, PSI-2; 1.50A {Rhodococcus SP} Back     alignment and structure
>3vp5_A Transcriptional regulator; heme, sensor protein, TETR superf transcription; HET: HEM; 1.90A {Lactococcus lactis} PDB: 3vox_A 3vok_A* Back     alignment and structure
>2gen_A Probable transcriptional regulator; APC6095, TETR family, structural genomics, PSI, protein structure initiative; 1.70A {Pseudomonas aeruginosa PAO1} SCOP: a.4.1.9 a.121.1.1 Back     alignment and structure
>1t33_A Putative transcriptional repressor (TETR/ACRR FAM; structural genomics, TETR/CCRR FA helix turn helix DNA binding domain, PSI; 2.20A {Salmonella typhimurium} SCOP: a.4.1.9 a.121.1.1 Back     alignment and structure
>2pz9_A Putative regulatory protein; structural genomics, transcriptional regulator, PSI, protein structure initiative; 2.80A {Streptomyces coelicolor A3} Back     alignment and structure
>2g7l_A TETR-family transcriptional regulator; APC6062, protein structure initiativ midwest center for structural genomics, MCSG; 2.10A {Streptomyces coelicolor} SCOP: a.4.1.9 a.121.1.1 Back     alignment and structure
>3cdl_A Transcriptional regulator AEFR; APC88582, TETR, pseudomonas syringae PV. tomato STR. DC3000, structural genomics, PSI-2; HET: MSE; 2.36A {Pseudomonas syringae PV} Back     alignment and structure
>2jj7_A Hemolysin II regulatory protein; DNA-binding protein, transcription regulation, DNA-binding, family, transcription, transcriptional regulator; 2.10A {Bacillus cereus} PDB: 2wv1_A 2jk3_A 2fx0_A Back     alignment and structure
>4ac0_A Tetracycline repressor protein class B from trans TN1 0; transcription; HET: MIY; 2.45A {Escherichia coli} Back     alignment and structure
>2vpr_A Tetracycline resistance repressor protein; transcription, metal-binding, antibiotic resistance, transcr regulator; HET: TDC; 2.49A {Pasteurella multocida} Back     alignment and structure
>2o7t_A Transcriptional regulator; transcription regulator, DNA/RNA-binding 3-helical bundle FO turn helix motif, HTH motif; HET: UNL; 2.10A {Corynebacterium glutamicum} SCOP: a.4.1.9 a.121.1.1 Back     alignment and structure
>3bqy_A Putative TETR family transcriptional regulator; structural genomics, strept coelicolor, PSI-2, protein structure initiative; 1.95A {Streptomyces coelicolor A3} Back     alignment and structure
>2y2z_A SIM16, SIMR, putative repressor simreg2; transcription, simocyclinone regulator, TETR-family; 1.95A {Streptomyces antibioticus} PDB: 2y30_A* 2y31_A* 3zql_A Back     alignment and structure
>2opt_A Actii protein; helical protein, TETR family, APO-protein, transcriptional R transcription; 2.05A {Streptomyces coelicolor} PDB: 3b6a_A* 3b6c_A* Back     alignment and structure
>2rek_A Putative TETR-family transcriptional regulator; sulfur, SAD, structural genomics, PSI-2, protein structure initiative; 1.86A {Streptomyces coelicolor A3} Back     alignment and structure
>3ljl_A Transcriptional regulator LUXT; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MES; 3.20A {Vibrio parahaemolyticus} Back     alignment and structure
>2zcx_A SCO7815, TETR-family transcriptional regulator; helix-turn-helix, DNA-binding, transcription regulation; 2.22A {Streptomyces coelicolor} Back     alignment and structure
>2ras_A Transcriptional regulator, TETR family; bacterial regulatory proteins, DNA-binding, DNA binding 3-helical bundle fold; 1.80A {Novosphingobium aromaticivorans} Back     alignment and structure
>2i10_A Putative TETR transcriptional regulator; structural genomics, APC5890, TETR family, PSI-2, protein ST initiative; HET: MSE NPO PGE; 2.05A {Rhodococcus SP} SCOP: a.4.1.9 a.121.1.1 Back     alignment and structure
>2g7g_A RHA04620, putative transcriptional regulator; helix-turn-helix, structural genomics, PSI, protein structur initiative; 2.01A {Rhodococcus SP} SCOP: a.4.1.9 a.121.1.1 Back     alignment and structure
>2oi8_A Putative regulatory protein SCO4313; TETR, structural genomics, PSI-2, P structure initiative; 2.50A {Streptomyces coelicolor} SCOP: a.4.1.9 a.121.1.1 Back     alignment and structure
>2qwt_A Transcriptional regulator, TETR family; structural genomics, PSI-2, protein structure initiative; 2.30A {Mycobacterium vanbaalenii pyr-1} Back     alignment and structure
>1rkt_A Protein YFIR; transcription regulator, structural genomics, PSI, protein S initiative, midwest center for structural genomics, MCSG; 1.95A {Bacillus subtilis} SCOP: a.4.1.9 a.121.1.1 Back     alignment and structure
>3o60_A LIN0861 protein; PSI, MCSG, structural genomics, midwest center for structura genomics, protein structure initiative, unknown function; 2.80A {Listeria innocua} Back     alignment and structure
>2fbq_A Probable transcriptional regulator; PA3006, APC5893, structural genom protein structure initiative; 1.80A {Pseudomonas aeruginosa} SCOP: a.4.1.9 a.121.1.1 Back     alignment and structure
>2d6y_A Putative TETR family regulatory protein; helix-turn-helix, gene regulation; HET: TLA; 2.30A {Streptomyces coelicolor} SCOP: a.4.1.9 a.121.1.1 Back     alignment and structure
>2xpw_A Tetracycline repressor protein class D; transcription, transcription regulator, helix-turn-helix, ME coordination; HET: OTC MES; 1.44A {Escherichia coli} PDB: 1bjy_A* 1bj0_A 1du7_A* 1ork_A* 2fj1_A* 1bjz_A* 2o7o_A* 2x6o_A* 2x9d_A* 2xps_A* 2xpt_A* 2vke_A* 2xpu_A* 2xpv_A* 2tct_A* 2xb5_A* 2trt_A* 2xrl_A* 1qpi_A* 1a6i_A ... Back     alignment and structure
>2hyt_A TETR-family transcriptional regulator; structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.64A {Pectobacterium atrosepticum} Back     alignment and structure
>3geu_A Intercellular adhesion protein R; TETR family, intercellular adhesion regulator, IDP00851, DNA repressor, transcription; HET: MSE; 1.90A {Staphylococcus aureus} Back     alignment and structure
>2v57_A TETR family transcriptional repressor LFRR; DNA-binding, transcription regulation; HET: PRL; 1.90A {Mycobacterium smegmatis} PDB: 2wgb_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query285
d3c07a2146 Putative transcriptional regulator SCO4850 {Strept 98.12
d2gfna177 Probable transcriptional regulator RHA1_ro04631 {R 95.55
d3c07a175 Putative transcriptional regulator SCO4850 {Strept 94.36
d2g7sa174 Putative transcriptional regulator Atu0279 {Agroba 94.34
d2np5a169 Transcriptional regulator RHA1_ro04179 {Rhodococcu 94.21
d1ui5a171 A-factor receptor homolog CprB {Streptomyces coeli 94.19
d1t56a173 Ethr repressor {Mycobacterium tuberculosis [TaxId: 93.97
d2fx0a173 Hemolysin II regulatory protein, HlyIIR {Bacillus 93.85
d2d6ya168 Putative regulator SCO4008 {Streptomyces coelicolo 93.73
d2hyja175 Putative transcriptional regulator SCO4940 {Strept 93.54
d1rkta181 Hypothetical transcriptional regulator YfiR {Bacil 93.51
d1sgma173 Putative transcriptional regulator YxaF {Bacillus 93.43
d2fbqa179 Transcriptional regulator PsrA {Pseudomonas aerugi 93.36
d2oi8a179 Putative regulatory protein Sco4313 {Streptomyces 93.3
d1jt6a171 Multidrug binding protein QacR {Staphylococcus aur 93.28
d1v7ba174 Transcriptional regulator Cgl2612 {Corynebacterium 93.27
d2gena170 Probable transcriptional regulator PA1836 {Pseudom 93.22
d2fd5a176 Probable transcriptional regulator PA3133 {Pseudom 93.02
d2g3ba172 Putative transcriptional regulator {Rhodococcus sp 92.99
d1z0xa168 Transcriptional regulator EF0787 {Enterococcus fae 92.88
d2i10a169 Putative transcriptional regulator RHA1_ro09068 {R 92.83
d1vi0a172 Hypothetical transcriptional regulator YsiA {Bacil 92.79
d2o7ta178 Transcriptional regulator Cgl1640/Cg1846 {Coryneba 92.78
d2id3a168 Putative transcriptional regulator SCO5951 {Strept 92.58
d2vkva162 Tetracyclin repressor (Tet-repressor, TetR) {Esche 92.48
d2g7la168 Putative transcriptional regulator SCO7704 {Strept 92.09
d1pb6a172 Hypothetical transcriptional regulator YcdC {Esche 91.37
d2fq4a169 Transcriptional regulator BC3163 {Bacillus cereus 91.22
d1zk8a172 Transcriptional regulator BC5000 {Bacillus cereus 90.68
d2iu5a171 Transcriptional activator DhaS {Lactococcus lactis 90.46
d1t33a188 Putative transcriptional repressor YbiH {Salmonell 89.87
d2id6a175 Transcriptional regulator TM1030 {Thermotoga marit 89.51
d2hkua170 Putative transcriptional regulator RHA1_ro03468 {R 87.93
d2g7ga165 Putative transcriptional regulator Rha04620 {Rhodo 87.37
d2np3a165 Putative transcriptional regulator SCO0857 {Strept 82.65
>d3c07a2 a.121.1.1 (A:90-235) Putative transcriptional regulator SCO4850 {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
class: All alpha proteins
fold: Tetracyclin repressor-like, C-terminal domain
superfamily: Tetracyclin repressor-like, C-terminal domain
family: Tetracyclin repressor-like, C-terminal domain
domain: Putative transcriptional regulator SCO4850
species: Streptomyces coelicolor [TaxId: 1902]

Probab=98.12  E-value=3.9e-05  Score=62.90  Aligned_cols=106  Identities=10%  Similarity=0.054  Sum_probs=76.3

Q ss_pred             hHHHHHHHHHHHHhhccchhhhHHHHHHhhcCCCCc----h---HHHHHH-HHHHHHHHHHhCCCCCCchhHHHH--HHH
Q 036078          148 PSQRISKLVRIRLEMQAPYISKWPQALSIQAQPLNV----P---TSFKQR-AMLVDEIWHAVGDEASDIDWYVKR--TVL  217 (285)
Q Consensus       148 ~rERI~~lL~~RLe~l~P~~e~~~qaLa~lalP~n~----~---~sl~~l-~~laD~Iw~~AGD~StD~~wYtKR--a~L  217 (285)
                      ..+|+...+..+|+++.||++...+-+..-+-|.+.    +   ..+++. -.+..++...++++-  -..+.+.  -.+
T Consensus         3 l~~RL~~~l~t~Ldvl~pyr~F~~~~l~~a~~P~~plspfs~es~~aR~~a~~l~~e~i~~~~~~~--~~~l~~~lp~l~   80 (146)
T d3c07a2           3 LEARLAGVLKVWLDIATPYHEFAVQFFKNAADPDSPLSPFSPESEHARVEAIGIHRAVLAGAKTKV--PEELRDILPELM   80 (146)
T ss_dssp             HHHHHHHHHHHHHHHHGGGHHHHHHHHHHHTCTTSTTSTTSGGGHHHHHHHHHHHHHHHHTSSSCC--CGGGTTHHHHHH
T ss_pred             HHHHHHHHHHHHHHHhcccHHHHHHHHHhhcCCCCCCCCCCcccHHHHHHHHHHHHHHHhcCCCCC--ChHHHHHHHHHH
Confidence            578999999999999999999999999999999653    2   222221 233333333333322  1334444  344


Q ss_pred             HHHHHHHHHHHhcCCCCChHHHHHHHHHHHHHHHHHHH
Q 036078          218 GGIYSTTEIYMLTDSSPDFCDTSRFLDDRVRDAFDLKK  255 (285)
Q Consensus       218 a~IY~stel~wL~D~S~d~~~T~aFLdrRL~~a~~l~~  255 (285)
                      =.-|....+||+.|+|++|++|..++|+-+.-+.++-+
T Consensus        81 W~~~l~il~fW~~D~S~~~ekT~~lieksv~l~~~lI~  118 (146)
T d3c07a2          81 WLSQMGLVLYWIFDRTEGRERSYRLAERGARLTARGVV  118 (146)
T ss_dssp             HHHHHHHHHHHHHCCSTTSHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHhcCCCcchHHHHHHHHHHHHHHHHHHH
Confidence            55566789999999999999999999999988776654
>d2gfna1 a.4.1.9 (A:4-80) Probable transcriptional regulator RHA1_ro04631 {Rhodococcus sp. rha1 [TaxId: 101510]} Back     information, alignment and structure
>d3c07a1 a.4.1.9 (A:15-89) Putative transcriptional regulator SCO4850 {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d2g7sa1 a.4.1.9 (A:3-76) Putative transcriptional regulator Atu0279 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2np5a1 a.4.1.9 (A:9-77) Transcriptional regulator RHA1_ro04179 {Rhodococcus sp. [TaxId: 1831]} Back     information, alignment and structure
>d1ui5a1 a.4.1.9 (A:5-75) A-factor receptor homolog CprB {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1t56a1 a.4.1.9 (A:22-94) Ethr repressor {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2fx0a1 a.4.1.9 (A:4-76) Hemolysin II regulatory protein, HlyIIR {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d2d6ya1 a.4.1.9 (A:7-74) Putative regulator SCO4008 {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d2hyja1 a.4.1.9 (A:8-82) Putative transcriptional regulator SCO4940 {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1rkta1 a.4.1.9 (A:2-82) Hypothetical transcriptional regulator YfiR {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1sgma1 a.4.1.9 (A:5-77) Putative transcriptional regulator YxaF {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2fbqa1 a.4.1.9 (A:2-80) Transcriptional regulator PsrA {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2oi8a1 a.4.1.9 (A:8-86) Putative regulatory protein Sco4313 {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1jt6a1 a.4.1.9 (A:2-72) Multidrug binding protein QacR {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1v7ba1 a.4.1.9 (A:1-74) Transcriptional regulator Cgl2612 {Corynebacterium glutamicum [TaxId: 1718]} Back     information, alignment and structure
>d2gena1 a.4.1.9 (A:6-75) Probable transcriptional regulator PA1836 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2fd5a1 a.4.1.9 (A:1-76) Probable transcriptional regulator PA3133 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2g3ba1 a.4.1.9 (A:2-73) Putative transcriptional regulator {Rhodococcus sp. rha1 [TaxId: 101510]} Back     information, alignment and structure
>d1z0xa1 a.4.1.9 (A:4-71) Transcriptional regulator EF0787 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d2i10a1 a.4.1.9 (A:10-78) Putative transcriptional regulator RHA1_ro09068 {Rhodococcus sp. [TaxId: 1831]} Back     information, alignment and structure
>d1vi0a1 a.4.1.9 (A:6-77) Hypothetical transcriptional regulator YsiA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2o7ta1 a.4.1.9 (A:1-78) Transcriptional regulator Cgl1640/Cg1846 {Corynebacterium glutamicum [TaxId: 1718]} Back     information, alignment and structure
>d2id3a1 a.4.1.9 (A:13-80) Putative transcriptional regulator SCO5951 {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d2vkva1 a.4.1.9 (A:6-67) Tetracyclin repressor (Tet-repressor, TetR) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2g7la1 a.4.1.9 (A:16-83) Putative transcriptional regulator SCO7704 {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1pb6a1 a.4.1.9 (A:14-85) Hypothetical transcriptional regulator YcdC {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fq4a1 a.4.1.9 (A:9-77) Transcriptional regulator BC3163 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1zk8a1 a.4.1.9 (A:6-77) Transcriptional regulator BC5000 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d2iu5a1 a.4.1.9 (A:1-71) Transcriptional activator DhaS {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d1t33a1 a.4.1.9 (A:1-88) Putative transcriptional repressor YbiH {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2id6a1 a.4.1.9 (A:1-75) Transcriptional regulator TM1030 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2hkua1 a.4.1.9 (A:18-87) Putative transcriptional regulator RHA1_ro03468 {Rhodococcus sp. RHA1 [TaxId: 101510]} Back     information, alignment and structure
>d2g7ga1 a.4.1.9 (A:9-73) Putative transcriptional regulator Rha04620 {Rhodococcus sp. rha1 [TaxId: 101510]} Back     information, alignment and structure
>d2np3a1 a.4.1.9 (A:35-99) Putative transcriptional regulator SCO0857 {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure