Citrus Sinensis ID: 036170

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-----
QRRVLERAKELINEAIADKLDLKLLKIDTSSTFRVADLGCSTGPNTFIAMQNIIEAIELKLFQASHKNPATVEFQVFFNDHPENNFNTLFKTLPHSRKYFAAGVPGFFQDRLFPNSTLHIVHSSFALHWISKIPEEIAGGKSLAWNKESIQGKRFVKEVAEAYSTQFKKDIESFLNARAQELVAGGLMSQTTFGIFFDVFGSCLMDMAKMGITSNEKIDSFNIPNHHPTPKELESIIKTNKYFTI
cHHHHHHHHHHHHHHHHHHHHHHHccccccccEEEEEEcccccccHHHHHHHHHHHHHHHHHHcccccccccEEEEEEcccccccHHHHHHHccccccccEEEccccccccccccccccEEEEccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHcccccHHHHHccccccccccHHHHHHHHHccccEEc
cHHHHHHHHHHHHHHHHHHHHHHcccccccccEEEEEccccccHHHHHHHHHHHHHHHHHHHHHccccccccEEEEEEcccccccHHHHHHHccccccEEEEEccccccccccccccEEEEEcHHHHHHHHccccHHccccccccccccEEEccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccHEHEEHHHHHHHHHHHHHHHHHHcccccHHHccccccccccccHHHHHHHHHHcccccc
QRRVLERAKELINEAIADKLDLKLlkidtsstfrvadlgcstgpntFIAMQNIIEAIELKLFqashknpatvEFQVFFndhpennfnTLFKTLPhsrkyfaagvpgffqdrlfpnstlhivHSSFALHWIskipeeiaggkslawnkesiqGKRFVKEVAEAYSTQFKKDIESFLNARAQELVagglmsqttFGIFFDVFGSCLMDMAKmgitsnekidsfnipnhhptpkELESIIKTNKYFTI
QRRVLERAKELIneaiadkldlklLKIDTSSTFRVADLGCSTGPNTFIAMQNIIEAIELKLFQASHKNPATVEFQVFFNDHPENNFNTLFKTLPHSRKYFAAGVPGFFQDRLFPNSTLHIVHSSFALHWISKIPEEIAGGKSLAWNKESIQGKRFVKEVAEAYSTQFKKDIESFLNARAQELVAGGLMSQTTFGIFFDVFGSCLMDMAKMGITSNEKIDSfnipnhhptpkelesiiktnkyfti
QRRVLERAKELINEaiadkldlkllkidTSSTFRVADLGCSTGPNTFIAMQNIIEAIELKLFQASHKNPATVEFQVFFNDHPENNFNTLFKTLPHSRKYFAAGVPGFFQDRLFPNSTLHIVHSSFALHWISKIPEEIAGGKSLAWNKESIQGKRFVKEVAEAYSTQFKKDIESFLNARAQELVAGGLMSQTTFGIFFDVFGSCLMDMAKMGITSNEKIDSFNIPNHHPTPKELESIIKTNKYFTI
**********LINEAIADKLDLKLLKIDTSSTFRVADLGCSTGPNTFIAMQNIIEAIELKLFQASHKNPATVEFQVFFNDHPENNFNTLFKTLPHSRKYFAAGVPGFFQDRLFPNSTLHIVHSSFALHWISKIPEEIAGGKSLAWNKESIQGKRFVKEVAEAYSTQFKKDIESFLNARAQELVAGGLMSQTTFGIFFDVFGSCLMDMAKMGITSN******************************
QR****RAKELINEAIADKLDLKLLKIDTSSTFRVADLGCSTGPNTFIAMQNIIEAIELKLFQA****PATVEFQVFFNDHPENNFNTLFKTLPHSRKYFAAGVPGFFQDRLFPNSTLHIVHSSFALHWISKIPEEIAGGKSLAWNKESIQGKRFVKEVAEAYSTQFKKDIESFLNARAQELVAGGLMSQTTFGIFFDVFGSCLMDMAKMGITSNEKIDSFNIPNHHPTPKELESIIKTNKYFTI
QRRVLERAKELINEAIADKLDLKLLKIDTSSTFRVADLGCSTGPNTFIAMQNIIEAIELKLFQASHKNPATVEFQVFFNDHPENNFNTLFKTLPHSRKYFAAGVPGFFQDRLFPNSTLHIVHSSFALHWISKIPEEIAGGKSLAWNKESIQGKRFVKEVAEAYSTQFKKDIESFLNARAQELVAGGLMSQTTFGIFFDVFGSCLMDMAKMGITSNEKIDSFNIPNHHPTPKELESIIKTNKYFTI
QRRVLERAKELINEAIADKLDLKLLKIDTSSTFRVADLGCSTGPNTFIAMQNIIEAIELKLFQASHKNPATVEFQVFFNDHPENNFNTLFKTLPHSRKYFAAGVPGFFQDRLFPNSTLHIVHSSFALHWISKIPEEIAGGKSLAWNKESIQGKRFVKEVAEAYSTQFKKDIESFLNARAQELVAGGLMSQTTFGIFFDVFGSCLMDMAKMGITSNEKIDSFNIPNHHPTPKELESIIKTNKYFT*
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
QRRVxxxxxxxxxxxxxxxxxxxxxKIDTSSTFRVADLGCSTGPNTFIAMQNIIEAIELKLFQASHKNPATVEFQVFFNDHPENNFNTLFKTLPHSRKYFAAGVPGFFQDRLFPNSTLHIVHSSFALHWISKIPEEIAGGKSLAWNKESIQGKRFVKEVAEAYSTQFKKDIESFLNARAQELVAGGLMSQTTFGIFFDVFGSCLMDMAKMGITSNEKIDSFNIPNHHPTPKELESIIKTNKYFTI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query245 2.2.26 [Sep-21-2011]
Q9LS10359 Probable S-adenosylmethio yes no 0.991 0.676 0.471 9e-61
Q9FKR0361 Probable S-adenosylmethio no no 0.963 0.653 0.469 2e-59
Q9FKC8362 Probable S-adenosylmethio no no 1.0 0.676 0.458 5e-58
Q9FKD0362 Probable S-adenosylmethio no no 1.0 0.676 0.446 5e-57
Q0J998404 Indole-3-acetate O-methyl yes no 0.926 0.561 0.330 2e-37
Q68CM3365 Probable caffeine synthas N/A no 0.828 0.556 0.357 2e-36
Q9SPV4359 Salicylate O-methyltransf N/A no 0.946 0.646 0.353 3e-36
Q9FLN8386 Indole-3-acetate O-methyl no no 0.840 0.533 0.361 2e-35
Q9FYZ9364 Benzoate carboxyl methylt N/A no 0.959 0.645 0.324 6e-35
Q9FZN8369 Caffeine synthase 1 OS=Ca N/A no 0.828 0.550 0.348 3e-34
>sp|Q9LS10|MT810_ARATH Probable S-adenosylmethionine-dependent methyltransferase At5g38100 OS=Arabidopsis thaliana GN=At5g38100 PE=2 SV=1 Back     alignment and function desciption
 Score =  233 bits (594), Expect = 9e-61,   Method: Compositional matrix adjust.
 Identities = 123/261 (47%), Positives = 162/261 (62%), Gaps = 18/261 (6%)

Query: 1   QRRVLERAKELINEAIADKLDLKLLKIDTSSTFRVADLGCSTGPNTFIAMQNIIEAIELK 60
           Q+  +  A E     I +KLDL+L       TFR+AD GCS GPNTF   Q+II+ ++ K
Sbjct: 26  QKAAISSAVEKTRRCIFEKLDLQLSS--DFGTFRIADFGCSIGPNTFHVAQSIIDTVKSK 83

Query: 61  LFQASHKNP-ATVEFQVFFNDHPENNFNTLFKTLPHS--RKYFAAGVPGFFQDRLFPNST 117
             + S +N    +EFQVFFND P N+FNTLF+T P S  R+YF+ GVPG F  R+ P ++
Sbjct: 84  RLEESTENSLVPLEFQVFFNDQPTNDFNTLFRTQPLSPEREYFSVGVPGSFYGRVLPRNS 143

Query: 118 LHIVHSSFALHWISKIPEEIAGGKSLAWNKESIQGKRFVKEVAEAYSTQFKKDIESFLNA 177
           +HI H+S+  HW+SK+P+ +   KS+AWNK  IQ    ++EV +AY  QF KD+E FL+A
Sbjct: 144 IHIGHTSYTTHWLSKVPDNVCDKKSMAWNKNYIQCNNLLEEVTKAYKVQFIKDMEIFLDA 203

Query: 178 RAQELVAGGLM-------------SQTTFGIFFDVFGSCLMDMAKMGITSNEKIDSFNIP 224
           RA+ELV GGLM              +T  G   D  G CLMDMAK GITS EKID F++P
Sbjct: 204 RAEELVPGGLMIVIGECLPDGVSLYETWQGYVMDTIGDCLMDMAKSGITSEEKIDLFSLP 263

Query: 225 NHHPTPKELESIIKTNKYFTI 245
            + P   EL+  I+ N  FTI
Sbjct: 264 VYFPQFSELKGEIEKNGSFTI 284

Arabidopsis thaliana (taxid: 3702)
EC: 2EC: .EC: 1EC: .EC: 1EC: .EC: -
>sp|Q9FKR0|MT878_ARATH Probable S-adenosylmethionine-dependent methyltransferase At5g38780 OS=Arabidopsis thaliana GN=At5g38780 PE=2 SV=1 Back     alignment and function description
>sp|Q9FKC8|MT799_ARATH Probable S-adenosylmethionine-dependent methyltransferase At5g37990 OS=Arabidopsis thaliana GN=At5g37990 PE=2 SV=2 Back     alignment and function description
>sp|Q9FKD0|MT797_ARATH Probable S-adenosylmethionine-dependent methyltransferase At5g37970 OS=Arabidopsis thaliana GN=At5g37970 PE=1 SV=1 Back     alignment and function description
>sp|Q0J998|IAMT1_ORYSJ Indole-3-acetate O-methyltransferase 1 OS=Oryza sativa subsp. japonica GN=IAMT1 PE=1 SV=1 Back     alignment and function description
>sp|Q68CM3|TCS2_CAMSI Probable caffeine synthase 2 OS=Camellia sinensis GN=TCS2 PE=2 SV=1 Back     alignment and function description
>sp|Q9SPV4|SAMT_CLABR Salicylate O-methyltransferase OS=Clarkia breweri GN=SAMT PE=1 SV=1 Back     alignment and function description
>sp|Q9FLN8|IAMT1_ARATH Indole-3-acetate O-methyltransferase 1 OS=Arabidopsis thaliana GN=IAMT1 PE=1 SV=1 Back     alignment and function description
>sp|Q9FYZ9|BAMT_ANTMA Benzoate carboxyl methyltransferase OS=Antirrhinum majus GN=BAMT PE=1 SV=1 Back     alignment and function description
>sp|Q9FZN8|TCS1_CAMSI Caffeine synthase 1 OS=Camellia sinensis GN=TCS1 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query245
224144825 351 predicted protein [Populus trichocarpa] 0.995 0.695 0.553 8e-74
224069525 370 predicted protein [Populus trichocarpa] 0.995 0.659 0.532 9e-72
147833899 521 hypothetical protein VITISV_030502 [Viti 0.979 0.460 0.509 2e-71
225462819 377 PREDICTED: probable S-adenosylmethionine 0.979 0.636 0.509 5e-71
296087219 806 unnamed protein product [Vitis vinifera] 0.979 0.297 0.509 8e-71
359488227 370 PREDICTED: probable S-adenosylmethionine 0.995 0.659 0.544 2e-68
296087220 357 unnamed protein product [Vitis vinifera] 0.995 0.683 0.544 2e-68
225456081 369 PREDICTED: probable S-adenosylmethionine 0.987 0.655 0.507 3e-67
224118708 364 predicted protein [Populus trichocarpa] 0.991 0.667 0.476 6e-67
224157929257 predicted protein [Populus trichocarpa] 0.853 0.813 0.582 8e-66
>gi|224144825|ref|XP_002336178.1| predicted protein [Populus trichocarpa] gi|222875362|gb|EEF12493.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  282 bits (722), Expect = 8e-74,   Method: Compositional matrix adjust.
 Identities = 144/260 (55%), Positives = 183/260 (70%), Gaps = 16/260 (6%)

Query: 1   QRRVLERAKELINEAIADKLDLKLLKIDTSS--TFRVADLGCSTGPNTFIAMQNIIEAIE 58
           QR  L    EL+NE I DKL+      D+S+  TFR+AD GCS GPNTF+AM+ IIEA+E
Sbjct: 17  QRGGLVIVNELMNEGIKDKLEFISPCSDSSNICTFRIADFGCSAGPNTFLAMEKIIEAVE 76

Query: 59  LKLFQASHKNPATVEFQVFFNDHPENNFNTLFKTLPHSRKYFAAGVPGFFQDRLFPNSTL 118
            K + A  KN   +EFQVFFND   N+FNTLFKTLP  +KYFAAGVPG F  RLFP STL
Sbjct: 77  QK-YHAQFKNSPPLEFQVFFNDVTTNDFNTLFKTLPLYQKYFAAGVPGTFYGRLFPKSTL 135

Query: 119 HIVHSSFALHWISKIPEEIAGGKSLAWNKESIQGKRFVKEVAEAYSTQFKKDIESFLNAR 178
            + +SS++LHW+SK+PEE+   KS AWNK SIQ     KEVA+AYS QFK D+++FLNAR
Sbjct: 136 RLAYSSYSLHWLSKVPEEVVDTKSPAWNKGSIQCSGTAKEVAKAYSAQFKTDMDNFLNAR 195

Query: 179 AQELVAGGLM-------------SQTTFGIFFDVFGSCLMDMAKMGITSNEKIDSFNIPN 225
           AQE++ GGLM             SQT  G  +++FGSCL+DMAK+G+ S EK+D+FN+P 
Sbjct: 196 AQEIIGGGLMVIIILGLPDGILLSQTVAGKSYELFGSCLIDMAKLGVISEEKVDTFNLPL 255

Query: 226 HHPTPKELESIIKTNKYFTI 245
           ++ + KELE IIK + +F I
Sbjct: 256 YYSSAKELEEIIKNHGHFCI 275

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224069525|ref|XP_002302990.1| predicted protein [Populus trichocarpa] gi|222844716|gb|EEE82263.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|147833899|emb|CAN73170.1| hypothetical protein VITISV_030502 [Vitis vinifera] Back     alignment and taxonomy information
>gi|225462819|ref|XP_002266476.1| PREDICTED: probable S-adenosylmethionine-dependent methyltransferase At5g37990 [Vitis vinifera] Back     alignment and taxonomy information
>gi|296087219|emb|CBI33593.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|359488227|ref|XP_002266288.2| PREDICTED: probable S-adenosylmethionine-dependent methyltransferase At5g37990-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|296087220|emb|CBI33594.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|225456081|ref|XP_002277876.1| PREDICTED: probable S-adenosylmethionine-dependent methyltransferase At5g38780 [Vitis vinifera] gi|297734281|emb|CBI15528.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|224118708|ref|XP_002317887.1| predicted protein [Populus trichocarpa] gi|222858560|gb|EEE96107.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224157929|ref|XP_002337913.1| predicted protein [Populus trichocarpa] gi|222870005|gb|EEF07136.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query245
TAIR|locus:2144461359 AT5G38100 [Arabidopsis thalian 0.873 0.596 0.495 1.1e-53
TAIR|locus:2166640361 AT5G38780 [Arabidopsis thalian 0.877 0.595 0.491 1.5e-53
TAIR|locus:2082157348 AT3G44840 [Arabidopsis thalian 0.971 0.683 0.476 1.9e-51
TAIR|locus:2082112348 FAMT "farnesoic acid carboxyl- 0.942 0.663 0.458 2.5e-49
TAIR|locus:2082117 379 AT3G44870 "AT3G44870" [Arabido 0.959 0.620 0.445 3.2e-49
TAIR|locus:504956193351 AT1G15125 [Arabidopsis thalian 0.959 0.669 0.450 2.9e-48
TAIR|locus:2200186363 AT1G68040 [Arabidopsis thalian 0.987 0.666 0.403 3.3e-47
TAIR|locus:2033409353 PXMT1 [Arabidopsis thaliana (t 0.979 0.679 0.420 1.2e-44
TAIR|locus:2033414353 AT1G66690 "AT1G66690" [Arabido 0.979 0.679 0.413 2.2e-43
TAIR|locus:2033389352 AT1G66720 [Arabidopsis thalian 0.979 0.681 0.401 5.7e-43
TAIR|locus:2144461 AT5G38100 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 555 (200.4 bits), Expect = 1.1e-53, P = 1.1e-53
 Identities = 114/230 (49%), Positives = 149/230 (64%)

Query:    32 TFRVADLGCSTGPNTFIAMQNIIEAIELKLFQASHKNPAT-VEFQVFFNDHPENNFNTLF 90
             TFR+AD GCS GPNTF   Q+II+ ++ K  + S +N    +EFQVFFND P N+FNTLF
Sbjct:    55 TFRIADFGCSIGPNTFHVAQSIIDTVKSKRLEESTENSLVPLEFQVFFNDQPTNDFNTLF 114

Query:    91 KTLPHS--RKYFAAGVPGFFQDRLFPNSTLHIVHSSFALHWISKIPEEIAGGKSLAWNKE 148
             +T P S  R+YF+ GVPG F  R+ P +++HI H+S+  HW+SK+P+ +   KS+AWNK 
Sbjct:   115 RTQPLSPEREYFSVGVPGSFYGRVLPRNSIHIGHTSYTTHWLSKVPDNVCDKKSMAWNKN 174

Query:   149 SIQGKRFVKEVAEAYSTQFKKDIESFLNARAQELVAGGLMS-------------QTTFGI 195
              IQ    ++EV +AY  QF KD+E FL+ARA+ELV GGLM              +T  G 
Sbjct:   175 YIQCNNLLEEVTKAYKVQFIKDMEIFLDARAEELVPGGLMIVIGECLPDGVSLYETWQGY 234

Query:   196 FFDVFGSCLMDMAKMGITSNEKIDSFNIPNHHPTPKELESIIKTNKYFTI 245
               D  G CLMDMAK GITS EKID F++P + P   EL+  I+ N  FTI
Sbjct:   235 VMDTIGDCLMDMAKSGITSEEKIDLFSLPVYFPQFSELKGEIEKNGSFTI 284
GO:0008168 "methyltransferase activity" evidence=IEA;ISS
GO:0009507 "chloroplast" evidence=ISM
TAIR|locus:2166640 AT5G38780 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2082157 AT3G44840 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2082112 FAMT "farnesoic acid carboxyl-O-methyltransferase" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2082117 AT3G44870 "AT3G44870" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:504956193 AT1G15125 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2200186 AT1G68040 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2033409 PXMT1 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2033414 AT1G66690 "AT1G66690" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2033389 AT1G66720 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query245
pfam03492331 pfam03492, Methyltransf_7, SAM dependent carboxyl 3e-98
PLN02668386 PLN02668, PLN02668, indole-3-acetate carboxyl meth 5e-51
>gnl|CDD|217591 pfam03492, Methyltransf_7, SAM dependent carboxyl methyltransferase Back     alignment and domain information 
 Score =  289 bits (742), Expect = 3e-98
 Identities = 117/251 (46%), Positives = 161/251 (64%), Gaps = 23/251 (9%)

Query: 12  INEAIADKLDLKLLKIDTSSTFRVADLGCSTGPNTFIAMQNIIEAIELKLFQASHKNPAT 71
           + EAI++ L    L+    ++ ++ADLGCS+GPNTF+A+ NII+ +E K  + +   P  
Sbjct: 1   LEEAISELL----LRNLFPNSIKIADLGCSSGPNTFLAVSNIIDTVEKKYQKENILEPP- 55

Query: 72  VEFQVFFNDHPENNFNTLFKTLPHS----RKYFAAGVPGFFQDRLFPNSTLHIVHSSFAL 127
            EFQVFFND P N+FNTLFK LP      R YF +GVPG F  RLFP ++LH VHSS++L
Sbjct: 56  -EFQVFFNDLPSNDFNTLFKLLPPFQKKKRSYFVSGVPGSFYGRLFPRNSLHFVHSSYSL 114

Query: 128 HWISKIPEEIAGGKSLAWNKESIQGKRF-VKEVAEAYSTQFKKDIESFLNARAQELVAGG 186
           HW+S++P+ +   +S AWNK +I       +EV +AY  QFKKD   FL ARA+ELV+GG
Sbjct: 115 HWLSQVPKGLEDKESPAWNKGNIYISGASPEEVYKAYLDQFKKDFSLFLRARAEELVSGG 174

Query: 187 LM------------SQTTFGIFFDVFGSCLMDMAKMGITSNEKIDSFNIPNHHPTPKELE 234
           LM            S+T  GIF+D+ G  L D+   G+   EK+DSFNIP + P+P+E++
Sbjct: 175 LMVLTFLGRPSVDPSETECGIFWDLLGDALNDLVSEGLIEEEKLDSFNIPIYAPSPEEVK 234

Query: 235 SIIKTNKYFTI 245
            II+    FTI
Sbjct: 235 EIIEKEGSFTI 245

This family of plant methyltransferases contains enzymes that act on a variety of substrates including salicylic acid, jasmonic acid and 7-Methylxanthine. Caffeine is synthesised through sequential three-step methylation of xanthine derivatives at positions 7-N, 3-N, and 1-N. The protein 7-methylxanthine methyltransferase (designated as CaMXMT) catalyzes the second step to produce theobromine. Length = 331
>gnl|CDD|178273 PLN02668, PLN02668, indole-3-acetate carboxyl methyltransferase Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 245
PLN02668386 indole-3-acetate carboxyl methyltransferase 100.0
PF03492334 Methyltransf_7: SAM dependent carboxyl methyltrans 100.0
TIGR02072240 BioC biotin biosynthesis protein BioC. This enzyme 98.3
TIGR00740239 methyltransferase, putative. A simple BLAST search 98.1
PRK01683258 trans-aconitate 2-methyltransferase; Provisional 98.0
PRK14103255 trans-aconitate 2-methyltransferase; Provisional 97.98
PRK15451247 tRNA cmo(5)U34 methyltransferase; Provisional 97.8
TIGR02752231 MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone me 97.71
PRK10258251 biotin biosynthesis protein BioC; Provisional 97.69
PLN02233261 ubiquinone biosynthesis methyltransferase 97.55
PTZ00098263 phosphoethanolamine N-methyltransferase; Provision 97.5
PRK15068322 tRNA mo(5)U34 methyltransferase; Provisional 97.48
PRK11036255 putative S-adenosyl-L-methionine-dependent methylt 97.46
PLN02244340 tocopherol O-methyltransferase 97.39
PF0824195 Methyltransf_11: Methyltransferase domain; InterPr 97.33
PF12847112 Methyltransf_18: Methyltransferase domain; PDB: 3G 97.32
COG2226238 UbiE Methylase involved in ubiquinone/menaquinone 97.31
smart00828224 PKS_MT Methyltransferase in polyketide synthase (P 97.08
TIGR00477195 tehB tellurite resistance protein TehB. Part of a 97.07
PF13847152 Methyltransf_31: Methyltransferase domain; PDB: 3T 97.01
TIGR01934223 MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis 96.97
PRK11207197 tellurite resistance protein TehB; Provisional 96.94
PRK00216239 ubiE ubiquinone/menaquinone biosynthesis methyltra 96.94
PRK06922677 hypothetical protein; Provisional 96.93
PRK12335287 tellurite resistance protein TehB; Provisional 96.89
PLN02396322 hexaprenyldihydroxybenzoate methyltransferase 96.88
TIGR02021219 BchM-ChlM magnesium protoporphyrin O-methyltransfe 96.85
PF0824299 Methyltransf_12: Methyltransferase domain; InterPr 96.82
PLN02490340 MPBQ/MSBQ methyltransferase 96.8
PRK06202232 hypothetical protein; Provisional 96.77
PRK00121202 trmB tRNA (guanine-N(7)-)-methyltransferase; Revie 96.7
TIGR00452314 methyltransferase, putative. Known examples to dat 96.56
PF13489161 Methyltransf_23: Methyltransferase domain; PDB: 3J 96.55
TIGR02716306 C20_methyl_CrtF C-20 methyltransferase BchU. Membe 96.5
PRK07580230 Mg-protoporphyrin IX methyl transferase; Validated 96.47
PLN02336475 phosphoethanolamine N-methyltransferase 96.45
smart00138264 MeTrc Methyltransferase, chemotaxis proteins. Meth 96.43
KOG2940325 consensus Predicted methyltransferase [General fun 96.41
PLN02336 475 phosphoethanolamine N-methyltransferase 96.33
PF03848192 TehB: Tellurite resistance protein TehB; InterPro: 96.1
TIGR00138181 gidB 16S rRNA methyltransferase GidB. GidB (glucos 95.95
PRK08317241 hypothetical protein; Provisional 95.87
PF01209233 Ubie_methyltran: ubiE/COQ5 methyltransferase famil 95.81
PF13649101 Methyltransf_25: Methyltransferase domain; PDB: 3B 95.79
TIGR03438301 probable methyltransferase. This model represents 95.61
COG4123248 Predicted O-methyltransferase [General function pr 95.42
PRK11188209 rrmJ 23S rRNA methyltransferase J; Provisional 95.36
TIGR01983224 UbiG ubiquinone biosynthesis O-methyltransferase. 95.09
cd02440107 AdoMet_MTases S-adenosylmethionine-dependent methy 95.03
TIGR00091194 tRNA (guanine-N(7)-)-methyltransferase. In E. coli 94.71
KOG2361264 consensus Predicted methyltransferase [General fun 94.67
PLN02232160 ubiquinone biosynthesis methyltransferase 94.64
PRK14121 390 tRNA (guanine-N(7)-)-methyltransferase; Provisiona 94.62
PTZ00146293 fibrillarin; Provisional 94.55
COG4106257 Tam Trans-aconitate methyltransferase [General fun 94.48
PLN02585315 magnesium protoporphyrin IX methyltransferase 94.42
PRK00107187 gidB 16S rRNA methyltransferase GidB; Reviewed 94.41
PRK11873272 arsM arsenite S-adenosylmethyltransferase; Reviewe 94.34
TIGR03587204 Pse_Me-ase pseudaminic acid biosynthesis-associate 94.24
KOG3010261 consensus Methyltransferase [General function pred 94.22
PF00891241 Methyltransf_2: O-methyltransferase; InterPro: IPR 94.16
PRK05134233 bifunctional 3-demethylubiquinone-9 3-methyltransf 93.86
TIGR03533284 L3_gln_methyl protein-(glutamine-N5) methyltransfe 93.63
PRK15001378 SAM-dependent 23S ribosomal RNA mG1835 methyltrans 93.6
PF05401201 NodS: Nodulation protein S (NodS); InterPro: IPR00 93.37
PRK00312212 pcm protein-L-isoaspartate O-methyltransferase; Re 93.37
PRK13942212 protein-L-isoaspartate O-methyltransferase; Provis 93.01
PF05148219 Methyltransf_8: Hypothetical methyltransferase; In 92.93
PRK11705383 cyclopropane fatty acyl phospholipid synthase; Pro 92.81
PRK05785226 hypothetical protein; Provisional 92.7
KOG1540296 consensus Ubiquinone biosynthesis methyltransferas 92.51
PRK09489342 rsmC 16S ribosomal RNA m2G1207 methyltransferase; 92.46
PRK14967223 putative methyltransferase; Provisional 92.34
TIGR00537179 hemK_rel_arch HemK-related putative methylase. The 92.25
PRK13944205 protein-L-isoaspartate O-methyltransferase; Provis 92.19
TIGR03534251 RF_mod_PrmC protein-(glutamine-N5) methyltransfera 92.14
PF02353273 CMAS: Mycolic acid cyclopropane synthetase; InterP 91.62
KOG3045325 consensus Predicted RNA methylase involved in rRNA 90.86
PRK11805307 N5-glutamine S-adenosyl-L-methionine-dependent met 90.7
PF08003315 Methyltransf_9: Protein of unknown function (DUF16 90.09
KOG1541270 consensus Predicted protein carboxyl methylase [Ge 89.85
TIGR02081194 metW methionine biosynthesis protein MetW. This pr 89.59
PRK14902444 16S rRNA methyltransferase B; Provisional 89.58
COG2518209 Pcm Protein-L-isoaspartate carboxylmethyltransfera 88.97
PRK09328275 N5-glutamine S-adenosyl-L-methionine-dependent met 88.33
PRK14903431 16S rRNA methyltransferase B; Provisional 88.15
PRK10901427 16S rRNA methyltransferase B; Provisional 87.94
PF05175170 MTS: Methyltransferase small domain; InterPro: IPR 87.64
PF03291331 Pox_MCEL: mRNA capping enzyme; InterPro: IPR004971 86.48
PF13659117 Methyltransf_26: Methyltransferase domain; PDB: 3G 86.16
COG2230283 Cfa Cyclopropane fatty acid synthase and related m 84.8
PRK14904445 16S rRNA methyltransferase B; Provisional 84.45
TIGR00563426 rsmB ribosomal RNA small subunit methyltransferase 80.5
>PLN02668 indole-3-acetate carboxyl methyltransferase Back     alignment and domain information 
Probab=100.00  E-value=9e-83  Score=595.79  Aligned_cols=238  Identities=37%  Similarity=0.664  Sum_probs=217.9

Q ss_pred             CHHHHHHHHHHHHHHHHHhhhhhcccCCCCCeEEEEeecCCCCcCcHHHHHHHHHHHHHHHhhcCCCCCCCeeEEEEeCC
Q 036170            1 QRRVLERAKELINEAIADKLDLKLLKIDTSSTFRVADLGCSTGPNTFIAMQNIIEAIELKLFQASHKNPATVEFQVFFND   80 (245)
Q Consensus         1 Q~~~~~~~~~~~~~ai~~~~~~~~~~~~~~~~~~IaD~GCS~G~Ns~~~~~~ii~~i~~~~~~~~~~~~~~p~~~v~~nD   80 (245)
                      ||+++..++|+|++||++++ .+.+   ..++++|||||||+|+||+.+|++||++|+++|.+.+.   .+|||||||||
T Consensus        37 Q~~~~~~~k~~leeai~~~~-~~~~---p~~~~~iaDlGcs~G~ntl~~vs~iI~~i~~~~~~~~~---~~pe~qv~~nD  109 (386)
T PLN02668         37 QALHARSMLHLLEETLDNVH-LNSS---PEVPFTAVDLGCSSGSNTIHIIDVIVKHMSKRYESAGL---DPPEFSAFFSD  109 (386)
T ss_pred             HHHHHHHHHHHHHHHHHHhc-cccC---CCcceeEEEecCCCCccHHHHHHHHHHHHHHHhhhcCC---CCCcceEEecC
Confidence            89999999999999998865 2321   13689999999999999999999999999999987543   47899999999


Q ss_pred             CCCCchHHHhhhCCCC----------------CceEEeecCcccccccCCCCceeEEEeccccccccCCCccccCCCCcc
Q 036170           81 HPENNFNTLFKTLPHS----------------RKYFAAGVPGFFQDRLFPNSTLHIVHSSFALHWISKIPEEIAGGKSLA  144 (245)
Q Consensus        81 lP~NDFntLF~~L~~~----------------~~~f~~~vpgSFy~rLfP~~Svh~~~Ss~alHWLS~~P~~~~d~~~~~  144 (245)
                      ||+||||+||++||++                ++||++|||||||+||||++||||+||+||||||||+|+++.|+.++.
T Consensus       110 LP~NDFNtlF~~L~~~~~~~~~~~~~~~~~~~~~~f~~gvpGSFY~RLfP~~Slh~~~Ss~slHWLS~vP~~l~d~~s~~  189 (386)
T PLN02668        110 LPSNDFNTLFQLLPPLANYGGSMEECLAASGHRSYFAAGVPGSFYRRLFPARSIDVFHSAFSLHWLSQVPESVTDKRSAA  189 (386)
T ss_pred             CCCCCHHHHHhhchhhhhhhcchhhhccccCCCceEEEecCccccccccCCCceEEEEeeccceecccCchhhccCCccc
Confidence            9999999999999852                249999999999999999999999999999999999999999999999


Q ss_pred             cCCCcccccCCcHHHHHHHHHHHHHhHHHHHHHHHHhhccCCcc-----cc-------c-ccchHHHH-HHHHHHHHHhc
Q 036170          145 WNKESIQGKRFVKEVAEAYSTQFKKDIESFLNARAQELVAGGLM-----SQ-------T-TFGIFFDV-FGSCLMDMAKM  210 (245)
Q Consensus       145 ~nkg~i~~~~~~~~v~~ay~~Q~~~D~~~FL~~Ra~EL~~GG~l-----~~-------~-~~~~~~~~-l~~~l~~mv~e  210 (245)
                      ||||+|||++++++|.+||++||++||+.||++||+||+|||+|     +.       . ..+.+|+. +.++|+|||.|
T Consensus       190 ~Nkg~iyi~~~s~~v~~aY~~Qf~~D~~~FL~~Ra~ELvpGG~mvl~~~Gr~~~~~~~~~~~~~~~~~~l~~al~dlv~e  269 (386)
T PLN02668        190 YNKGRVFIHGASESTANAYKRQFQADLAGFLRARAQEMKRGGAMFLVCLGRTSVDPTDQGGAGLLFGTHFQDAWDDLVQE  269 (386)
T ss_pred             ccCCceEecCCCHHHHHHHHHHHHHHHHHHHHHHHHHhccCcEEEEEEecCCCCCcccCCchhHHHHHHHHHHHHHHHHc
Confidence            99999999988899999999999999999999999999999999     11       1 13456776 99999999999


Q ss_pred             CCCChhhhccCccCcccCCHHHHHHHHhhCCceeC
Q 036170          211 GITSNEKIDSFNIPNHHPTPKELESIIKTNKYFTI  245 (245)
Q Consensus       211 G~i~~e~~d~fn~P~y~ps~eEv~~~ie~~G~f~i  245 (245)
                      |+|++||+|+||+|+|+||++|++++|+++|+|+|
T Consensus       270 GlI~eek~dsFniP~Y~ps~eEv~~~Ie~~gsF~I  304 (386)
T PLN02668        270 GLVTSEKRDSFNIPVYAPSLQDFKEVVEANGSFAI  304 (386)
T ss_pred             CCCCHHHHhcccCcccCCCHHHHHHHHhhcCCEEe
Confidence            99999999999999999999999999999999987

>PF03492 Methyltransf_7: SAM dependent carboxyl methyltransferase; InterPro: IPR005299 This family of plant methyltransferases contains enzymes that act on a variety of substrates including salicylic acid, jasmonic acid and 7-Methylxanthine Back     alignment and domain information
>TIGR02072 BioC biotin biosynthesis protein BioC Back     alignment and domain information
>TIGR00740 methyltransferase, putative Back     alignment and domain information
>PRK01683 trans-aconitate 2-methyltransferase; Provisional Back     alignment and domain information
>PRK14103 trans-aconitate 2-methyltransferase; Provisional Back     alignment and domain information
>PRK15451 tRNA cmo(5)U34 methyltransferase; Provisional Back     alignment and domain information
>TIGR02752 MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone methyltransferase Back     alignment and domain information
>PRK10258 biotin biosynthesis protein BioC; Provisional Back     alignment and domain information
>PLN02233 ubiquinone biosynthesis methyltransferase Back     alignment and domain information
>PTZ00098 phosphoethanolamine N-methyltransferase; Provisional Back     alignment and domain information
>PRK15068 tRNA mo(5)U34 methyltransferase; Provisional Back     alignment and domain information
>PRK11036 putative S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>PLN02244 tocopherol O-methyltransferase Back     alignment and domain information
>PF08241 Methyltransf_11: Methyltransferase domain; InterPro: IPR013216 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (SAM) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>PF12847 Methyltransf_18: Methyltransferase domain; PDB: 3G2Q_A 3G2O_A 3G2M_B 3G2P_B 3D2L_B 1IM8_B 3NJR_A 3E05_H 3EVZ_A 3HM2_A Back     alignment and domain information
>COG2226 UbiE Methylase involved in ubiquinone/menaquinone biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>smart00828 PKS_MT Methyltransferase in polyketide synthase (PKS) enzymes Back     alignment and domain information
>TIGR00477 tehB tellurite resistance protein TehB Back     alignment and domain information
>PF13847 Methyltransf_31: Methyltransferase domain; PDB: 3T0I_B 3SVZ_B 3SXJ_A 3F4K_A 3GU3_B 2GH1_A 1R8Y_E 1R8X_B 2B3T_A 1T43_A Back     alignment and domain information
>TIGR01934 MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis methyltransferases Back     alignment and domain information
>PRK11207 tellurite resistance protein TehB; Provisional Back     alignment and domain information
>PRK00216 ubiE ubiquinone/menaquinone biosynthesis methyltransferase; Reviewed Back     alignment and domain information
>PRK06922 hypothetical protein; Provisional Back     alignment and domain information
>PRK12335 tellurite resistance protein TehB; Provisional Back     alignment and domain information
>PLN02396 hexaprenyldihydroxybenzoate methyltransferase Back     alignment and domain information
>TIGR02021 BchM-ChlM magnesium protoporphyrin O-methyltransferase Back     alignment and domain information
>PF08242 Methyltransf_12: Methyltransferase domain; InterPro: IPR013217 Methyl transfer from the ubiquitous donor S-adenosyl-L-methionine (SAM) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>PLN02490 MPBQ/MSBQ methyltransferase Back     alignment and domain information
>PRK06202 hypothetical protein; Provisional Back     alignment and domain information
>PRK00121 trmB tRNA (guanine-N(7)-)-methyltransferase; Reviewed Back     alignment and domain information
>TIGR00452 methyltransferase, putative Back     alignment and domain information
>PF13489 Methyltransf_23: Methyltransferase domain; PDB: 3JWJ_A 3JWH_B 2AOV_B 2AOT_A 1JQD_B 2AOX_A 1JQE_A 2AOU_B 2AOW_A 3DLI_C Back     alignment and domain information
>TIGR02716 C20_methyl_CrtF C-20 methyltransferase BchU Back     alignment and domain information
>PRK07580 Mg-protoporphyrin IX methyl transferase; Validated Back     alignment and domain information
>PLN02336 phosphoethanolamine N-methyltransferase Back     alignment and domain information
>smart00138 MeTrc Methyltransferase, chemotaxis proteins Back     alignment and domain information
>KOG2940 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>PLN02336 phosphoethanolamine N-methyltransferase Back     alignment and domain information
>PF03848 TehB: Tellurite resistance protein TehB; InterPro: IPR015985 Tellurite resistance protein TehB is part of a tellurite-reducing operon tehA and tehB Back     alignment and domain information
>TIGR00138 gidB 16S rRNA methyltransferase GidB Back     alignment and domain information
>PRK08317 hypothetical protein; Provisional Back     alignment and domain information
>PF01209 Ubie_methyltran: ubiE/COQ5 methyltransferase family; InterPro: IPR004033 A number of methyltransferases have been shown to share regions of similarities [] Back     alignment and domain information
>PF13649 Methyltransf_25: Methyltransferase domain; PDB: 3BXO_B 3GGD_A 3PX2_A 3PX3_A 3PFH_D 3PFG_A 1Y8C_A Back     alignment and domain information
>TIGR03438 probable methyltransferase Back     alignment and domain information
>COG4123 Predicted O-methyltransferase [General function prediction only] Back     alignment and domain information
>PRK11188 rrmJ 23S rRNA methyltransferase J; Provisional Back     alignment and domain information
>TIGR01983 UbiG ubiquinone biosynthesis O-methyltransferase Back     alignment and domain information
>cd02440 AdoMet_MTases S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I; AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy) Back     alignment and domain information
>TIGR00091 tRNA (guanine-N(7)-)-methyltransferase Back     alignment and domain information
>KOG2361 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>PLN02232 ubiquinone biosynthesis methyltransferase Back     alignment and domain information
>PRK14121 tRNA (guanine-N(7)-)-methyltransferase; Provisional Back     alignment and domain information
>PTZ00146 fibrillarin; Provisional Back     alignment and domain information
>COG4106 Tam Trans-aconitate methyltransferase [General function prediction only] Back     alignment and domain information
>PLN02585 magnesium protoporphyrin IX methyltransferase Back     alignment and domain information
>PRK00107 gidB 16S rRNA methyltransferase GidB; Reviewed Back     alignment and domain information
>PRK11873 arsM arsenite S-adenosylmethyltransferase; Reviewed Back     alignment and domain information
>TIGR03587 Pse_Me-ase pseudaminic acid biosynthesis-associated methylase Back     alignment and domain information
>KOG3010 consensus Methyltransferase [General function prediction only] Back     alignment and domain information
>PF00891 Methyltransf_2: O-methyltransferase; InterPro: IPR001077 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>PRK05134 bifunctional 3-demethylubiquinone-9 3-methyltransferase/ 2-octaprenyl-6-hydroxy phenol methylase; Provisional Back     alignment and domain information
>TIGR03533 L3_gln_methyl protein-(glutamine-N5) methyltransferase, ribosomal protein L3-specific Back     alignment and domain information
>PRK15001 SAM-dependent 23S ribosomal RNA mG1835 methyltransferase; Provisional Back     alignment and domain information
>PF05401 NodS: Nodulation protein S (NodS); InterPro: IPR008715 This entry consists of nodulation S (NodS) proteins Back     alignment and domain information
>PRK00312 pcm protein-L-isoaspartate O-methyltransferase; Reviewed Back     alignment and domain information
>PRK13942 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>PF05148 Methyltransf_8: Hypothetical methyltransferase; InterPro: IPR007823 This family consists of uncharacterised eukaryotic proteins which are related to S-adenosyl-L-methionine-dependent methyltransferases Back     alignment and domain information
>PRK11705 cyclopropane fatty acyl phospholipid synthase; Provisional Back     alignment and domain information
>PRK05785 hypothetical protein; Provisional Back     alignment and domain information
>KOG1540 consensus Ubiquinone biosynthesis methyltransferase COQ5 [Coenzyme transport and metabolism] Back     alignment and domain information
>PRK09489 rsmC 16S ribosomal RNA m2G1207 methyltransferase; Provisional Back     alignment and domain information
>PRK14967 putative methyltransferase; Provisional Back     alignment and domain information
>TIGR00537 hemK_rel_arch HemK-related putative methylase Back     alignment and domain information
>PRK13944 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>TIGR03534 RF_mod_PrmC protein-(glutamine-N5) methyltransferase, release factor-specific Back     alignment and domain information
>PF02353 CMAS: Mycolic acid cyclopropane synthetase; InterPro: IPR003333 This entry represents mycolic acid cyclopropane synthases and related enzymes, including CmaA1, CmaA2 (cyclopropane mycolic acid synthase A1 and A2) and MmaA1-4 (methoxymycolic acid synthase A1-4) Back     alignment and domain information
>KOG3045 consensus Predicted RNA methylase involved in rRNA processing [RNA processing and modification] Back     alignment and domain information
>PRK11805 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>PF08003 Methyltransf_9: Protein of unknown function (DUF1698); InterPro: IPR010017 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>KOG1541 consensus Predicted protein carboxyl methylase [General function prediction only] Back     alignment and domain information
>TIGR02081 metW methionine biosynthesis protein MetW Back     alignment and domain information
>PRK14902 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>COG2518 Pcm Protein-L-isoaspartate carboxylmethyltransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK09328 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>PRK14903 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>PRK10901 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>PF05175 MTS: Methyltransferase small domain; InterPro: IPR007848 This domain is found in ribosomal RNA small subunit methyltransferase C and in other methyltransferases Back     alignment and domain information
>PF03291 Pox_MCEL: mRNA capping enzyme; InterPro: IPR004971 This is a family of viral mRNA capping enzymes Back     alignment and domain information
>PF13659 Methyltransf_26: Methyltransferase domain; PDB: 3GJY_A 3LPM_B 2NP6_D 1AQI_B 2ADM_B 2IH2_A 2JG3_A 2IBS_D 2NP7_A 2IBT_A Back     alignment and domain information
>COG2230 Cfa Cyclopropane fatty acid synthase and related methyltransferases [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK14904 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>TIGR00563 rsmB ribosomal RNA small subunit methyltransferase RsmB Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query245
3b5i_A374 Crystal Structure Of Indole-3-Acetic Acid Methyltra 2e-36
1m6e_X359 Crystal Structure Of Salicylic Acid Carboxyl Methyl 3e-36
2efj_A384 The Structure Of 1,7 Dimethylxanthine Methyltransfe 1e-30
2eg5_A372 The Structure Of Xanthosine Methyltransferase Lengt 3e-30
>pdb|3B5I|A Chain A, Crystal Structure Of Indole-3-Acetic Acid Methyltransferase Length = 374 Back     alignment and structure 
Iteration: 1

 Score =  149 bits (375), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 89/246 (36%), Positives = 126/246 (51%), Gaps = 40/246 (16%)
Query: 33  FRVADLGCSTGPNTFIAMQNIIEAIELKLFQASHKNPATVEFQVFFNDHPENNFNTLFKT 92
           F   DLGCS+G NT   +  I++ I  K F A+  +P   EF  FF+D P N+FNTLF+ 
Sbjct: 54  FTAVDLGCSSGANTVHIIDFIVKHIS-KRFDAAGIDPP--EFTAFFSDLPSNDFNTLFQL 110
Query: 93  LP---------------HSRKYFAAGVPGFFQDRLFPNSTLHIVHSSFALHWISKIPEEI 137
           LP                +R YF AGVPG F  RLFP  T+   HS+F+LHW+S++PE +
Sbjct: 111 LPPLVSNTCMEECLAADGNRSYFVAGVPGSFYRRLFPARTIDFFHSAFSLHWLSQVPESV 170
Query: 138 AGGKSLAWNKESIQGKRFVKEVAE----AYSTQFKKDIESFLNARAQELVAGGLM----- 188
              +S A+N+    G+ F+    E    AY  QF+ D+  FL ARA E+  GG M     
Sbjct: 171 TDRRSAAYNR----GRVFIHGAGEKTTTAYKRQFQADLAEFLRARAAEVKRGGAMFLVCL 226
Query: 189 --------SQTTFGIFFDV-FGSCLMDMAKMGITSNEKIDSFNIPNHHPTPKELESIIKT 239
                    Q   G+ F   F     D+ + G+ + EK D FNIP + P+ ++ + ++  
Sbjct: 227 GRTSVDPTDQGGAGLLFGTHFQDAWDDLVREGLVAAEKRDGFNIPVYAPSLQDFKEVVDA 286
Query: 240 NKYFTI 245
           N  F I
Sbjct: 287 NGSFAI 292
>pdb|1M6E|X Chain X, Crystal Structure Of Salicylic Acid Carboxyl Methyltransferase (Samt) Length = 359 Back     alignment and structure
>pdb|2EFJ|A Chain A, The Structure Of 1,7 Dimethylxanthine Methyltransferase Length = 384 Back     alignment and structure
>pdb|2EG5|A Chain A, The Structure Of Xanthosine Methyltransferase Length = 372 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query245
3b5i_A374 S-adenosyl-L-methionine:salicylic acid carboxyl me 2e-66
2efj_A384 3,7-dimethylxanthine methyltransferase; SAM-depend 8e-66
1m6e_X359 S-adenosyl-L-methionnine:salicylic acid carboxyl m 1e-64
>3b5i_A S-adenosyl-L-methionine:salicylic acid carboxyl methyltransferase-like protein; sabath family, indole-3-acetic acid, S-AD methionine; HET: SAH; 2.75A {Arabidopsis thaliana} Length = 374 Back     alignment and structure
 Score =  209 bits (532), Expect = 2e-66
 Identities = 87/274 (31%), Positives = 128/274 (46%), Gaps = 35/274 (12%)

Query: 1   QRRVLERAKELINEAIADKLDLKLLKIDTSSTFRVADLGCSTGPNTFIAMQNIIEAIELK 60
           Q         L+ E + +   + L    +   F   DLGCS+G NT   +  I++ I  +
Sbjct: 25  QAMHARSMLHLLEETLEN---VHLNSSASPPPFTAVDLGCSSGANTVHIIDFIVKHISKR 81

Query: 61  LFQASHKNPATVEFQVFFNDHPENNFNTLFKTLPH---------------SRKYFAAGVP 105
              A    P   EF  FF+D P N+FNTLF+ LP                +R YF AGVP
Sbjct: 82  FDAAGIDPP---EFTAFFSDLPSNDFNTLFQLLPPLVSNTCMEECLAADGNRSYFVAGVP 138

Query: 106 GFFQDRLFPNSTLHIVHSSFALHWISKIPEEIAGGKSLAWNKESIQGKRFVKEVAEAYST 165
           G F  RLFP  T+   HS+F+LHW+S++PE +   +S A+N+  +      ++   AY  
Sbjct: 139 GSFYRRLFPARTIDFFHSAFSLHWLSQVPESVTDRRSAAYNRGRVFIHGAGEKTTTAYKR 198

Query: 166 QFKKDIESFLNARAQELVAGGLMSQTTFGI--------------FFDVFGSCLMDMAKMG 211
           QF+ D+  FL ARA E+  GG M     G               F   F     D+ + G
Sbjct: 199 QFQADLAEFLRARAAEVKRGGAMFLVCLGRTSVDPTDQGGAGLLFGTHFQDAWDDLVREG 258

Query: 212 ITSNEKIDSFNIPNHHPTPKELESIIKTNKYFTI 245
           + + EK D FNIP + P+ ++ + ++  N  F I
Sbjct: 259 LVAAEKRDGFNIPVYAPSLQDFKEVVDANGSFAI 292
>2efj_A 3,7-dimethylxanthine methyltransferase; SAM-dependant methyltransferase, SAH, theobromine; HET: SAH 37T; 2.00A {Coffea canephora} PDB: 2eg5_A* Length = 384 Back     alignment and structure
>1m6e_X S-adenosyl-L-methionnine:salicylic acid carboxyl methyltransferase; rossmann fold, protein-small molecule complex; HET: SAH SAL; 3.00A {Clarkia breweri} SCOP: c.66.1.35 Length = 359 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query245
1m6e_X359 S-adenosyl-L-methionnine:salicylic acid carboxyl m 100.0
2efj_A384 3,7-dimethylxanthine methyltransferase; SAM-depend 100.0
3b5i_A374 S-adenosyl-L-methionine:salicylic acid carboxyl me 100.0
3dtn_A234 Putative methyltransferase MM_2633; structural gen 98.28
4gek_A261 TRNA (CMO5U34)-methyltransferase; structural genom 98.16
2p35_A259 Trans-aconitate 2-methyltransferase; SAM dependent 98.08
3ccf_A279 Cyclopropane-fatty-acyl-phospholipid synthase; YP_ 98.04
3bus_A273 REBM, methyltransferase; rebeccamycin synthesis; H 98.0
4htf_A285 S-adenosylmethionine-dependent methyltransferase; 97.97
1vl5_A260 Unknown conserved protein BH2331; putative methylt 97.9
3sm3_A235 SAM-dependent methyltransferases; NESG, structural 97.89
1xxl_A239 YCGJ protein; structural genomics, protein structu 97.87
2yqz_A263 Hypothetical protein TTHA0223; RNA methyltransfera 97.85
3hnr_A220 Probable methyltransferase BT9727_4108; structural 97.79
2aot_A292 HMT, histamine N-methyltransferase; classic methyl 97.78
3bgv_A313 MRNA CAP guanine-N7 methyltransferase; alternative 97.77
3dlc_A219 Putative S-adenosyl-L-methionine-dependent methylt 97.77
3lst_A348 CALO1 methyltransferase; calicheamicin, enediyne, 97.7
1kpg_A287 CFA synthase;, cyclopropane-fatty-acyl-phospholipi 97.7
3reo_A368 (ISO)eugenol O-methyltransferase; directed evoluti 97.63
1ri5_A298 MRNA capping enzyme; methyltransferase, M7G, messe 97.59
3p9c_A364 Caffeic acid O-methyltransferase; S-adenosylmethio 97.59
3hem_A302 Cyclopropane-fatty-acyl-phospholipid synthase 2; p 97.58
2p7i_A250 Hypothetical protein; putative methyltransferase, 97.57
3ujc_A266 Phosphoethanolamine N-methyltransferase; parasite; 97.55
3h2b_A203 SAM-dependent methyltransferase; alpha-beta protei 97.48
4a6d_A353 Hydroxyindole O-methyltransferase; melatonin, circ 97.48
3gwz_A369 MMCR; methyltransferase, mitomycin, S-adenosyl met 97.43
2fk8_A318 Methoxy mycolic acid synthase 4; S-adenosylmethion 97.43
3ou2_A218 SAM-dependent methyltransferase; O-methyltransfera 97.42
3lcc_A235 Putative methyl chloride transferase; halide methy 97.41
2o57_A297 Putative sarcosine dimethylglycine methyltransfera 97.4
4hg2_A257 Methyltransferase type 11; structural genomics, PS 97.39
3dh0_A219 SAM dependent methyltransferase; cystal structure, 97.39
2a14_A263 Indolethylamine N-methyltransferase; SGC,INMT, str 97.37
3i53_A332 O-methyltransferase; CO-complex, rossmann-like fol 97.37
3vc1_A312 Geranyl diphosphate 2-C-methyltransferase; rossman 97.37
1xtp_A254 LMAJ004091AAA; SGPP, structural genomics, PSI, pro 97.36
3dp7_A363 SAM-dependent methyltransferase; structural genomi 97.34
2qe6_A274 Uncharacterized protein TFU_2867; putative methylt 97.32
3f4k_A257 Putative methyltransferase; structural genomics, P 97.3
3bkx_A275 SAM-dependent methyltransferase; YP_807781.1, cycl 97.3
3kkz_A267 Uncharacterized protein Q5LES9; putative methyltra 97.29
3mcz_A352 O-methyltransferase; adomet_mtases, S-adenosylmeth 97.27
3dli_A240 Methyltransferase; PSI-II, NYSGXRC, structural gen 97.26
3e23_A211 Uncharacterized protein RPA2492; alpha-beta protei 97.22
3mgg_A276 Methyltransferase; NYSGXRC, PSI-II, protein struct 97.2
2r3s_A335 Uncharacterized protein; methyltransferase domain, 97.18
3ofk_A216 Nodulation protein S; NODS, N-methyltransferase, S 97.17
2ex4_A241 Adrenal gland protein AD-003; methyltransferase, s 97.17
3g5t_A299 Trans-aconitate 3-methyltransferase; structural ge 97.14
2vdw_A302 Vaccinia virus capping enzyme D1 subunit; nucleoti 97.13
1vlm_A219 SAM-dependent methyltransferase; possible histamin 97.12
2ld4_A176 Anamorsin; methyltransferase-like fold, alpha/beta 97.1
1qzz_A374 RDMB, aclacinomycin-10-hydroxylase; anthracycline, 97.1
2xvm_A199 Tellurite resistance protein TEHB; antibiotic resi 97.09
2ip2_A334 Probable phenazine-specific methyltransferase; pyo 97.08
4df3_A233 Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; 97.06
3ocj_A305 Putative exported protein; structural genomics, PS 97.06
1fp1_D372 Isoliquiritigenin 2'-O-methyltransferase; protein- 96.98
3jwh_A217 HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena 96.93
3jwg_A219 HEN1, methyltransferase type 12; 1.90A {Clostridiu 96.89
4fsd_A383 Arsenic methyltransferase; rossmann fold; 1.75A {C 96.85
3m70_A286 Tellurite resistance protein TEHB homolog; structu 96.8
1yzh_A214 TRNA (guanine-N(7)-)-methyltransferase; alpha-beta 96.8
3cc8_A230 Putative methyltransferase; structural genomics, j 96.79
1zg3_A358 Isoflavanone 4'-O-methyltransferase; rossman fold, 96.79
2gs9_A211 Hypothetical protein TT1324; methyl transferase, s 96.77
3l8d_A242 Methyltransferase; structural genomics, PSI, nysgr 96.74
3q7e_A 349 Protein arginine N-methyltransferase 1; HET: SAH; 96.73
2gb4_A252 Thiopurine S-methyltransferase; 18204406, thiopuri 96.73
2p8j_A209 S-adenosylmethionine-dependent methyltransferase; 96.71
1y8c_A246 S-adenosylmethionine-dependent methyltransferase; 96.67
3ege_A261 Putative methyltransferase from antibiotic biosyn 96.66
1x19_A359 CRTF-related protein; methyltransferase, bacterioc 96.62
3giw_A277 Protein of unknown function DUF574; rossmann-fold 96.62
3thr_A293 Glycine N-methyltransferase; GNMT, folate, methylt 96.61
3g5l_A253 Putative S-adenosylmethionine dependent methyltran 96.61
3r0q_C 376 Probable protein arginine N-methyltransferase 4.2; 96.6
3e8s_A227 Putative SAM dependent methyltransferase; NP_74470 96.6
3gu3_A284 Methyltransferase; alpha-beta protein, structural 96.58
3g2m_A299 PCZA361.24; SAM-dependent methyltransferase, glyco 96.56
1nkv_A256 Hypothetical protein YJHP; structural genomics, PS 96.53
1dus_A194 MJ0882; hypothetical protein, methanococcus jannas 96.52
3pfg_A263 N-methyltransferase; N,N-dimethyltransferase, SAM 96.49
1tw3_A360 COMT, carminomycin 4-O-methyltransferase; anthracy 96.45
3d2l_A243 SAM-dependent methyltransferase; ZP_00538691.1, st 96.42
2g72_A289 Phenylethanolamine N-methyltransferase; HET: SAM F 96.38
3ggd_A245 SAM-dependent methyltransferase; YP_325210.1, stru 96.36
1ve3_A227 Hypothetical protein PH0226; dimer, riken structur 96.27
2fyt_A 340 Protein arginine N-methyltransferase 3; structural 96.26
2zfu_A215 Nucleomethylin, cerebral protein 1; nucleolar prot 96.25
3dmg_A381 Probable ribosomal RNA small subunit methyltransf; 96.23
3bkw_A243 MLL3908 protein, S-adenosylmethionine dependent me 96.2
1pjz_A203 Thiopurine S-methyltransferase; polymorphism, S-ad 96.19
3bxo_A239 N,N-dimethyltransferase; desosamine, sugar, carboh 96.18
1g6q_1 328 HnRNP arginine N-methyltransferase; SAM-binding do 96.12
1zx0_A236 Guanidinoacetate N-methyltransferase; structural g 96.08
3cgg_A195 SAM-dependent methyltransferase; NP_600671.1, meth 96.05
2kw5_A202 SLR1183 protein; structural genomics, northeast st 96.03
1wzn_A252 SAM-dependent methyltransferase; structural genomi 96.03
2i62_A265 Nicotinamide N-methyltransferase; structural genom 95.96
3g07_A292 7SK snRNA methylphosphate capping enzyme; structur 95.89
4e2x_A 416 TCAB9; kijanose, tetronitrose, tetradeoxy sugar, s 95.85
3dxy_A218 TRNA (guanine-N(7)-)-methyltransferase; rossmann f 95.8
2fca_A213 TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bac 95.64
3i9f_A170 Putative type 11 methyltransferase; structural gen 95.6
3mti_A185 RRNA methylase; SAM-dependent, PSI, MCSG, structur 95.58
3iv6_A261 Putative Zn-dependent alcohol dehydrogenase; alpha 95.27
3p9n_A189 Possible methyltransferase (methylase); RV2966C, a 95.24
1fp2_A352 Isoflavone O-methyltransferase; protein-product co 95.14
2plw_A201 Ribosomal RNA methyltransferase, putative; malaria 95.12
2pxx_A215 Uncharacterized protein MGC2408; structural genomi 95.06
3eey_A197 Putative rRNA methylase; rRNA methylation, S-adeno 94.98
3uwp_A438 Histone-lysine N-methyltransferase, H3 lysine-79; 94.69
4hc4_A 376 Protein arginine N-methyltransferase 6; HRMT1L6, S 94.64
1l3i_A192 Precorrin-6Y methyltransferase/putative decarboxyl 94.4
1jsx_A207 Glucose-inhibited division protein B; methyltransf 94.3
2b3t_A276 Protein methyltransferase HEMK; translation termin 94.26
2pjd_A343 Ribosomal RNA small subunit methyltransferase C; g 94.14
4dcm_A375 Ribosomal RNA large subunit methyltransferase G; 2 94.09
3orh_A236 Guanidinoacetate N-methyltransferase; structura ge 94.02
1af7_A274 Chemotaxis receptor methyltransferase CHER; chemot 94.0
3lbf_A210 Protein-L-isoaspartate O-methyltransferase; modifi 93.96
2y1w_A348 Histone-arginine methyltransferase CARM1; histone 93.92
3hm2_A178 Precorrin-6Y C5,15-methyltransferase; alpha-beta-s 93.8
1ej0_A180 FTSJ; methyltransferase, adoMet, adenosyl methioni 93.75
3e05_A204 Precorrin-6Y C5,15-methyltransferase (decarboxyla; 93.67
2avn_A260 Ubiquinone/menaquinone biosynthesis methyltransfe 93.54
3q87_B170 N6 adenine specific DNA methylase; SAM-methyltrans 93.5
3ckk_A235 TRNA (guanine-N(7)-)-methyltransferase; mettl1, S- 93.45
2yxd_A183 Probable cobalt-precorrin-6Y C(15)-methyltransfer 93.34
1xdz_A240 Methyltransferase GIDB; MCSG, protein structure in 93.25
2h00_A254 Methyltransferase 10 domain containing protein; st 93.16
2ozv_A260 Hypothetical protein ATU0636; structural genomics, 93.08
3njr_A204 Precorrin-6Y methylase; methyltransferase, decarbo 92.91
3u81_A221 Catechol O-methyltransferase; neurotransmitter deg 92.86
3mb5_A255 SAM-dependent methyltransferase; RNA methyltransfe 92.65
3lpm_A259 Putative methyltransferase; structural genomics, p 92.45
3evz_A230 Methyltransferase; NYSGXRC, NEW YORK SGX research 92.09
2gpy_A233 O-methyltransferase; structural genomics, PSI, pro 92.07
3ntv_A232 MW1564 protein; rossmann fold, putative methyltran 91.61
3gdh_A241 Trimethylguanosine synthase homolog; M7G, CAP, dim 91.36
1u2z_A433 Histone-lysine N-methyltransferase, H3 lysine-79 s 91.09
3b3j_A 480 Histone-arginine methyltransferase CARM1; protein 91.04
3bwc_A304 Spermidine synthase; SAM, SGPP, structura genomics 91.04
3gjy_A317 Spermidine synthase; APC62791, structural genomics 90.88
2yxe_A215 Protein-L-isoaspartate O-methyltransferase; rossma 90.48
3fpf_A298 Mtnas, putative uncharacterized protein; thermonic 90.45
3lcv_B281 Sisomicin-gentamicin resistance methylase SGM; ant 90.39
3fzg_A200 16S rRNA methylase; methyltransferase, plasmid, tr 90.08
2nxc_A254 L11 mtase, ribosomal protein L11 methyltransferase 89.98
3frh_A253 16S rRNA methylase; methyltransferase domain, heli 89.63
2yxl_A450 PH0851 protein, 450AA long hypothetical FMU protei 89.63
1ixk_A315 Methyltransferase; open beta sheet; 1.90A {Pyrococ 89.47
1o54_A277 SAM-dependent O-methyltransferase; TM0748, structu 89.26
3sso_A419 Methyltransferase; macrolide, natural product, ros 89.09
1sqg_A429 SUN protein, FMU protein; rossmann-fold, mixed bet 88.89
1yb2_A275 Hypothetical protein TA0852; structural genomics, 88.82
1vbf_A231 231AA long hypothetical protein-L-isoaspartate O- 88.14
2frx_A 479 Hypothetical protein YEBU; rossmann-type S-adenosy 86.56
1dl5_A317 Protein-L-isoaspartate O-methyltransferase; isoasp 86.39
1jg1_A235 PIMT;, protein-L-isoaspartate O-methyltransferase; 86.37
3tma_A354 Methyltransferase; thump domain; 2.05A {Thermus th 85.7
3opn_A232 Putative hemolysin; structural genomics, PSI-2, pr 83.53
1wxx_A382 TT1595, hypothetical protein TTHA1280; thermus the 83.48
3htx_A950 HEN1; HEN1, small RNA methyltransferase, protein-R 82.61
3tqs_A255 Ribosomal RNA small subunit methyltransferase A; p 81.94
3kr9_A225 SAM-dependent methyltransferase; class I rossmann- 81.48
>1m6e_X S-adenosyl-L-methionnine:salicylic acid carboxyl methyltransferase; rossmann fold, protein-small molecule complex; HET: SAH SAL; 3.00A {Clarkia breweri} SCOP: c.66.1.35 Back     alignment and structure
Probab=100.00  E-value=6.8e-78  Score=559.47  Aligned_cols=233  Identities=38%  Similarity=0.662  Sum_probs=212.9

Q ss_pred             CHHHHHHHHHHHHHHHHHhhhhhcccCCCCCeEEEEeecCCCCcCcHHHHHHHHHHHHHHHhhcCCCCCCCeeEEEEeCC
Q 036170            1 QRRVLERAKELINEAIADKLDLKLLKIDTSSTFRVADLGCSTGPNTFIAMQNIIEAIELKLFQASHKNPATVEFQVFFND   80 (245)
Q Consensus         1 Q~~~~~~~~~~~~~ai~~~~~~~~~~~~~~~~~~IaD~GCS~G~Ns~~~~~~ii~~i~~~~~~~~~~~~~~p~~~v~~nD   80 (245)
                      |++++..+||++++||++++. ...   .+++++|||||||+|+||+.+++.||++|+++|.+.++  .++|||||||||
T Consensus        25 Q~~~~~~~~~~l~~ai~~~~~-~~~---~~~~~~IaDlGCs~G~Nt~~~v~~ii~~i~~~~~~~~~--~~~pe~~v~~nD   98 (359)
T 1m6e_X           25 QRQVISITKPITEAAITALYS-GDT---VTTRLAIADLGCSSGPNALFAVTELIKTVEELRKKMGR--ENSPEYQIFLND   98 (359)
T ss_dssp             HHHHHHHTHHHHHHHHHHHHS-SSS---SSSEECCEEESCCSSTTTTTGGGTTHHHHHHHHHSSSC--SSCCEEEEEEEE
T ss_pred             HHHHHHHHHHHHHHHHHHHhh-ccC---CCCceEEEecCCCCCcchHHHHHHHHHHHHHHHHhcCC--CCCCceEEEecC
Confidence            899999999999999998763 321   36799999999999999999999999999999976542  147899999999


Q ss_pred             CCCCchHHHhhhCCCC----CceEEeecCcccccccCCCCceeEEEeccccccccCCCccccCCCCcccCCCcccccC-C
Q 036170           81 HPENNFNTLFKTLPHS----RKYFAAGVPGFFQDRLFPNSTLHIVHSSFALHWISKIPEEIAGGKSLAWNKESIQGKR-F  155 (245)
Q Consensus        81 lP~NDFntLF~~L~~~----~~~f~~~vpgSFy~rLfP~~Svh~~~Ss~alHWLS~~P~~~~d~~~~~~nkg~i~~~~-~  155 (245)
                      ||+||||+||++|+.+    ++||++|||||||+||||++|+|++||++||||||++|+.+.+      |||+||++. +
T Consensus        99 Lp~NDFntlF~~L~~~~~~~~~~f~~gvpgSFy~rlfp~~S~d~v~Ss~aLHWls~~p~~l~~------nkg~i~~~~~~  172 (359)
T 1m6e_X           99 LPGNDFNAIFRSLPIENDVDGVCFINGVPGSFYGRLFPRNTLHFIHSSYSLMWLSQVPIGIES------NKGNIYMANTC  172 (359)
T ss_dssp             CTTSCHHHHHTTTTTSCSCTTCEEEEEEESCSSSCCSCTTCBSCEEEESCTTBCSSCCSCCCC------CTTTTSSCSSS
T ss_pred             CCchHHHHHHHhcchhcccCCCEEEEecchhhhhccCCCCceEEEEehhhhhhcccCchhhhc------cCCceEecCCC
Confidence            9999999999999862    5799999999999999999999999999999999999999976      999999984 5


Q ss_pred             cHHHHHHHHHHHHHhHHHHHHHHHHhhccCCcc-----cc-------cccchHHHHHHHHHHHHHhcCCCChhhhccCcc
Q 036170          156 VKEVAEAYSTQFKKDIESFLNARAQELVAGGLM-----SQ-------TTFGIFFDVFGSCLMDMAKMGITSNEKIDSFNI  223 (245)
Q Consensus       156 ~~~v~~ay~~Q~~~D~~~FL~~Ra~EL~~GG~l-----~~-------~~~~~~~~~l~~~l~~mv~eG~i~~e~~d~fn~  223 (245)
                      |++|.+||++||++||+.||++|++||||||+|     +.       ++.+.+|+.|.++|++||.||+|++||+|+||+
T Consensus       173 p~~v~~ay~~Qf~~D~~~FL~~Ra~EL~pGG~mvl~~~gr~~~~~~~~~~~~~~~~l~~al~~mv~eGli~~ek~d~f~~  252 (359)
T 1m6e_X          173 PQSVLNAYYKQFQEDHALFLRCRAQEVVPGGRMVLTILGRRSEDRASTECCLIWQLLAMALNQMVSEGLIEEEKMDKFNI  252 (359)
T ss_dssp             CCTTSCCSHHHHHHHHHHHHHHHHHHBCTTCEEEEEEEECSSSSSSSTTTSTTTHHHHHHHHHHHHTTCSCCSTTGGGCC
T ss_pred             CHHHHHHHHHHHHHHHHHHHHHHHHHhcCCceEEEEEecCCCCCccccchHHHHHHHHHHHHHHHHccccchhhhhccCC
Confidence            788999999999999999999999999999999     11       123467999999999999999999999999999


Q ss_pred             CcccCCHHHHHHHHhhCCceeC
Q 036170          224 PNHHPTPKELESIIKTNKYFTI  245 (245)
Q Consensus       224 P~y~ps~eEv~~~ie~~G~f~i  245 (245)
                      |+|+||++|++++|+++|+|+|
T Consensus       253 P~y~ps~~E~~~~ie~~G~F~i  274 (359)
T 1m6e_X          253 PQYTPSPTEVEAEILKEGSFLI  274 (359)
T ss_dssp             CCBCCCSHHHHHHHHHTTTBCC
T ss_pred             CccCCCHHHHHHHHHHcCCceE
Confidence            9999999999999999999987
>2efj_A 3,7-dimethylxanthine methyltransferase; SAM-dependant methyltransferase, SAH, theobromine; HET: SAH 37T; 2.00A {Coffea canephora} PDB: 2eg5_A* Back     alignment and structure
>3b5i_A S-adenosyl-L-methionine:salicylic acid carboxyl methyltransferase-like protein; sabath family, indole-3-acetic acid, S-AD methionine; HET: SAH; 2.75A {Arabidopsis thaliana} Back     alignment and structure
>3dtn_A Putative methyltransferase MM_2633; structural genomics, unknown function, PSI-2, protein structure initiative; 2.09A {Methanosarcina mazei} Back     alignment and structure
>4gek_A TRNA (CMO5U34)-methyltransferase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, rossmann fold; HET: GEK; 1.50A {Escherichia coli} PDB: 1im8_A* Back     alignment and structure
>2p35_A Trans-aconitate 2-methyltransferase; SAM dependent methyltrans agrobacterium tumefaciens, structural genomics, PSI-2; HET: SAH; 1.95A {Agrobacterium tumefaciens str} Back     alignment and structure
>3ccf_A Cyclopropane-fatty-acyl-phospholipid synthase; YP_321342.1, putative methyltransferase; 1.90A {Anabaena variabilis atcc 29413} Back     alignment and structure
>3bus_A REBM, methyltransferase; rebeccamycin synthesis; HET: SAH; 2.65A {Lechevalieria aerocolonigenes} Back     alignment and structure
>4htf_A S-adenosylmethionine-dependent methyltransferase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE SAM; 1.60A {Escherichia coli} Back     alignment and structure
>1vl5_A Unknown conserved protein BH2331; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; HET: MSE; 1.95A {Bacillus halodurans} SCOP: c.66.1.41 Back     alignment and structure
>3sm3_A SAM-dependent methyltransferases; NESG, structural genomics, PSI-biology, protein structure in northeast structural genomics; 2.20A {Methanosarcina mazei} Back     alignment and structure
>1xxl_A YCGJ protein; structural genomics, protein structure initiative, PSI, NEW YORK SGX research center for structural genomics, nysgxrc; 2.10A {Bacillus subtilis} SCOP: c.66.1.41 PDB: 2glu_A* Back     alignment and structure
>2yqz_A Hypothetical protein TTHA0223; RNA methyltransferase, SAM, structural genomics, NPPSFA; HET: SAM; 1.80A {Thermus thermophilus} PDB: 2yr0_A Back     alignment and structure
>3hnr_A Probable methyltransferase BT9727_4108; structural genomics, PSI-2, protein structure initiative; 2.80A {Bacillus thuringiensis serovarkonkukian} Back     alignment and structure
>2aot_A HMT, histamine N-methyltransferase; classic methyltransferase fold, protein-drug complex; HET: CSO 2PM SAH; 1.90A {Homo sapiens} SCOP: c.66.1.19 PDB: 1jqd_A* 2aou_A* 2aov_A* 2aox_A* 1jqe_A* 2aow_A* Back     alignment and structure
>3bgv_A MRNA CAP guanine-N7 methyltransferase; alternative splicing, mRNA capping, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: SAH; 2.30A {Homo sapiens} PDB: 3epp_A* Back     alignment and structure
>3dlc_A Putative S-adenosyl-L-methionine-dependent methyltransferase; structural genomics, joint center for structural genomics; HET: MSE SAM; 1.15A {Methanococcus maripaludis} Back     alignment and structure
>3lst_A CALO1 methyltransferase; calicheamicin, enediyne, SAH, STRU genomics, PSI-2, protein structure initiative; HET: SAH; 2.40A {Micromonospora echinospora} Back     alignment and structure
>1kpg_A CFA synthase;, cyclopropane-fatty-acyl-phospholipid synthase 1; mixed alpha beta fold, structural genomics, PSI; HET: SAH 16A; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kp9_A* 1kph_A* 1tpy_A* 1l1e_A* Back     alignment and structure
>3reo_A (ISO)eugenol O-methyltransferase; directed evolution, saturation mutagenesis, regioselectivity transferase; HET: SAH EUG; 1.90A {Clarkia breweri} PDB: 3tky_A* 1kyz_A* 1kyw_A* Back     alignment and structure
>1ri5_A MRNA capping enzyme; methyltransferase, M7G, messenger RNA CAP, structural genomics, PSI, protein structure initiative; 2.10A {Encephalitozoon cuniculi} SCOP: c.66.1.34 PDB: 1ri2_A* 1ri3_A* 1ri1_A* 1ri4_A 1z3c_A* 2hv9_A* Back     alignment and structure
>3p9c_A Caffeic acid O-methyltransferase; S-adenosylmethionine dependent O-methyltransferase; HET: SAH; 1.80A {Lolium perenne} PDB: 3p9i_A* 3p9k_A* Back     alignment and structure
>3hem_A Cyclopropane-fatty-acyl-phospholipid synthase 2; protein-ligand complex, cytoplasm, lipid synthesis, methyltransferase; HET: D22; 2.39A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kpi_A* Back     alignment and structure
>2p7i_A Hypothetical protein; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; 1.74A {Pectobacterium atrosepticum SCRI1043} SCOP: c.66.1.41 PDB: 2p7h_A Back     alignment and structure
>3ujc_A Phosphoethanolamine N-methyltransferase; parasite; HET: PC; 1.19A {Plasmodium falciparum} PDB: 3uj9_A* 3uj6_A* 3uj7_A* 3uj8_A* 3uja_A 3ujb_A* 4fgz_A* 3ujd_A* Back     alignment and structure
>3h2b_A SAM-dependent methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAH; 2.00A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>4a6d_A Hydroxyindole O-methyltransferase; melatonin, circadian clock; HET: SAM; 2.40A {Homo sapiens} PDB: 4a6e_A* Back     alignment and structure
>3gwz_A MMCR; methyltransferase, mitomycin, S-adenosyl methionine, transferase; HET: MSE SAH; 1.91A {Streptomyces lavendulae} PDB: 3gxo_A* Back     alignment and structure
>2fk8_A Methoxy mycolic acid synthase 4; S-adenosylmethionine-dependent methyltransferase fold, trans; HET: SAM; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 2fk7_A* 3ha3_A* 3ha5_A* 3ha7_A* Back     alignment and structure
>3ou2_A SAM-dependent methyltransferase; O-methyltransferase, SAH; HET: SAH; 1.50A {Streptomyces luridus} PDB: 3ou6_A* 3ou7_A* Back     alignment and structure
>3lcc_A Putative methyl chloride transferase; halide methyltransferase; HET: SAH; 1.80A {Arabidopsis thaliana} Back     alignment and structure
>2o57_A Putative sarcosine dimethylglycine methyltransferase; structural genomics, protein structure initiative, PSI-2; 1.95A {Galdieria sulphuraria} SCOP: c.66.1.18 Back     alignment and structure
>4hg2_A Methyltransferase type 11; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MES; 1.60A {Anaeromyxobacter dehalogenans} Back     alignment and structure
>3dh0_A SAM dependent methyltransferase; cystal structure, PSI-2, NYSGXRC, structural genomics, protein structure initiative; HET: SAM; 2.72A {Aquifex aeolicus} Back     alignment and structure
>2a14_A Indolethylamine N-methyltransferase; SGC,INMT, structural genomics, structural genomics consortium; HET: SAH; 1.70A {Homo sapiens} SCOP: c.66.1.15 Back     alignment and structure
>3i53_A O-methyltransferase; CO-complex, rossmann-like fold; HET: SAH; 2.08A {Streptomyces carzinostaticus subsp} PDB: 3i58_A* 3i5u_A* 3i64_A* Back     alignment and structure
>3vc1_A Geranyl diphosphate 2-C-methyltransferase; rossmann fold, methyltransferase fold, SAM-dependent methyltransferase; HET: SAH GST GOL; 1.82A {Streptomyces coelicolor} PDB: 3vc2_A* 4f84_A* 4f85_A 4f86_A* Back     alignment and structure
>1xtp_A LMAJ004091AAA; SGPP, structural genomics, PSI, protein structure initiative dependent methyltransferase; HET: SAI; 1.94A {Leishmania major} SCOP: c.66.1.42 Back     alignment and structure
>3dp7_A SAM-dependent methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research; 2.33A {Bacteroides vulgatus} Back     alignment and structure
>2qe6_A Uncharacterized protein TFU_2867; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; HET: NEP SAM; 1.95A {Thermobifida fusca} Back     alignment and structure
>3f4k_A Putative methyltransferase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacteroides thetaiotaomicron} PDB: 3t0i_A* 3svz_A* 3sxj_A* Back     alignment and structure
>3bkx_A SAM-dependent methyltransferase; YP_807781.1, cyclopropane-fatty-acyl-phospholipid synthase-L protein, methyltransferase domain; 1.85A {Lactobacillus casei} Back     alignment and structure
>3kkz_A Uncharacterized protein Q5LES9; putative methyltransferase, BFR250, NESG, structural genomics, PSI-2; HET: SAM; 1.68A {Bacteroides fragilis nctc 9343} PDB: 3e7p_A 3t7s_A* 3t7r_A* 3t7t_A* Back     alignment and structure
>3mcz_A O-methyltransferase; adomet_mtases, S-adenosylmethionine-dependent methyltransfer structural genomics, PSI-2; HET: MSE; 1.90A {Burkholderia thailandensis} Back     alignment and structure
>3dli_A Methyltransferase; PSI-II, NYSGXRC, structural genomics, protein structure initiative; 2.46A {Archaeoglobus fulgidus} Back     alignment and structure
>3e23_A Uncharacterized protein RPA2492; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAM; 1.60A {Rhodopseudomonas palustris} Back     alignment and structure
>3mgg_A Methyltransferase; NYSGXRC, PSI-II, protein structure initiative, structural genomics, NEW YORK SGX research center for structural genomics; 1.86A {Methanosarcina mazei} Back     alignment and structure
>2r3s_A Uncharacterized protein; methyltransferase domain, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE; 2.15A {Nostoc punctiforme} Back     alignment and structure
>3ofk_A Nodulation protein S; NODS, N-methyltransferase, SAH, SAM, NOD factor, fixation, symbiosis, alpha/beta structure; HET: SAH; 1.85A {Bradyrhizobium SP} PDB: 3ofj_A* Back     alignment and structure
>2ex4_A Adrenal gland protein AD-003; methyltransferase, structural genomics, SGC, structural genomics consortium; HET: SAH; 1.75A {Homo sapiens} SCOP: c.66.1.42 Back     alignment and structure
>3g5t_A Trans-aconitate 3-methyltransferase; structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; HET: MSE SAH T8N; 1.12A {Saccharomyces cerevisiae} Back     alignment and structure
>2vdw_A Vaccinia virus capping enzyme D1 subunit; nucleotidyltransferase, S-adenosyl-L-methionine, RNA metabolism, mRNA processing, methyltransferase, poxvirus; HET: SAH; 2.70A {Vaccinia virus} Back     alignment and structure
>1vlm_A SAM-dependent methyltransferase; possible histamine methyltransferase, structural genomics, JCSG, protein struc initiative, PSI; 2.20A {Thermotoga maritima} SCOP: c.66.1.41 Back     alignment and structure
>2ld4_A Anamorsin; methyltransferase-like fold, alpha/beta fold, iron-sulfur PR biogenesis, apoptosis; NMR {Homo sapiens} PDB: 2yui_A Back     alignment and structure
>1qzz_A RDMB, aclacinomycin-10-hydroxylase; anthracycline, methyltransferase, polyketide, tailoring enzymes, structural proteomics in E spine; HET: SAM; 2.10A {Streptomyces purpurascens} SCOP: a.4.5.29 c.66.1.12 PDB: 1r00_A* 1xds_A* 1xdu_A* Back     alignment and structure
>2xvm_A Tellurite resistance protein TEHB; antibiotic resistance, transferase; HET: SAH; 1.48A {Escherichia coli} PDB: 2xva_A* 4dq0_A* 2i6g_A* Back     alignment and structure
>2ip2_A Probable phenazine-specific methyltransferase; pyocyanin, phenazine-1-carboxy PHZM; 1.80A {Pseudomonas aeruginosa} Back     alignment and structure
>4df3_A Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; NADP rossmann superfamily, S-adenosyl-L-M (SAM) binding, nucleolus; HET: SAM; 1.73A {Aeropyrum pernix} Back     alignment and structure
>3ocj_A Putative exported protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: PLM; 1.39A {Bordetella parapertussis} Back     alignment and structure
>1fp1_D Isoliquiritigenin 2'-O-methyltransferase; protein-substrate, protein-product complex; HET: SAH HCC; 1.82A {Medicago sativa} SCOP: a.4.5.29 c.66.1.12 PDB: 1fpq_A* Back     alignment and structure
>3jwh_A HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena variabilis} PDB: 3jwj_A Back     alignment and structure
>3jwg_A HEN1, methyltransferase type 12; 1.90A {Clostridium thermocellum} PDB: 3jwi_A Back     alignment and structure
>4fsd_A Arsenic methyltransferase; rossmann fold; 1.75A {Cyanidioschyzon SP} PDB: 4fr0_A* 4fs8_A 3p7e_A 3qnh_A 3qhu_A Back     alignment and structure
>3m70_A Tellurite resistance protein TEHB homolog; structural genomics, PSI-2, protein ST initiative; 1.95A {Haemophilus influenzae} Back     alignment and structure
>1yzh_A TRNA (guanine-N(7)-)-methyltransferase; alpha-beta-alpha sandwich, S-adenosylmeth dependent, structural genomics, PSI; 2.02A {Streptococcus pneumoniae} SCOP: c.66.1.53 Back     alignment and structure
>3cc8_A Putative methyltransferase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS transferase; 1.64A {Bacillus cereus} Back     alignment and structure
>1zg3_A Isoflavanone 4'-O-methyltransferase; rossman fold, plant Pro transferase; HET: 2HI SAH; 2.35A {Medicago truncatula} PDB: 1zga_A* 1zhf_A* 1zgj_A* Back     alignment and structure
>2gs9_A Hypothetical protein TT1324; methyl transferase, structural genomics, NPPSFA, national PR protein structural and functional analyses; HET: SAH; 2.60A {Thermus thermophilus} Back     alignment and structure
>3l8d_A Methyltransferase; structural genomics, PSI, nysgrc, protein structure initiative, NEW YORK SGX research center for STRU genomics; 1.70A {Bacillus thuringiensis} Back     alignment and structure
>3q7e_A Protein arginine N-methyltransferase 1; HET: SAH; 2.20A {Rattus norvegicus} PDB: 1orh_A* 1ori_A* 1or8_A* Back     alignment and structure
>2gb4_A Thiopurine S-methyltransferase; 18204406, thiopurine methyltransferase, structural genomics, PSI, protein structure initiative; HET: SAH; 1.25A {Mus musculus} PDB: 3bgi_A* 3bgd_A* 2bzg_A* 2h11_A* Back     alignment and structure
>2p8j_A S-adenosylmethionine-dependent methyltransferase; NP_349143.1; HET: PGE GOL; 2.00A {Clostridium acetobutylicum} Back     alignment and structure
>1y8c_A S-adenosylmethionine-dependent methyltransferase; structural genomics, protein structure initiative, PSI; 2.50A {Clostridium acetobutylicum} SCOP: c.66.1.43 Back     alignment and structure
>3ege_A Putative methyltransferase from antibiotic biosyn pathway; YP_324569.1, putative methyltransferase from antibiotic BIOS pathway; 2.40A {Anabaena variabilis atcc 29413} Back     alignment and structure
>1x19_A CRTF-related protein; methyltransferase, bacteriochllochlorophyll, BCHU, SAM, SAH, adenosylmethyonine, S-adenosylhomocysteine, ADO-Met; 2.27A {Chlorobium tepidum} PDB: 1x1a_A* 1x1b_A* 1x1c_A* 1x1d_A* Back     alignment and structure
>3giw_A Protein of unknown function DUF574; rossmann-fold protein, structural genomics, joint center for structural genomics, JCSG; HET: MSE UNL; 1.45A {Streptomyces avermitilis} PDB: 3go4_A* Back     alignment and structure
>3thr_A Glycine N-methyltransferase; GNMT, folate, methyltransferase binding, liver cytosol, transferase-transferase inhibitor C; HET: C2F TAM; 2.00A {Rattus norvegicus} SCOP: c.66.1.5 PDB: 3ths_A* 1xva_A* 1d2c_A 1kia_A* 1nbh_A* 1bhj_A* 2idj_A 2idk_A* 1d2g_A 1d2h_A* 1nbi_A* 1r8x_A 1r8y_A 1r74_A* 2azt_A* Back     alignment and structure
>3g5l_A Putative S-adenosylmethionine dependent methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.35A {Listeria monocytogenes str} Back     alignment and structure
>3r0q_C Probable protein arginine N-methyltransferase 4.2; arginine methyltransferase, methylation; HET: SAH; 2.61A {Arabidopsis thaliana} Back     alignment and structure
>3e8s_A Putative SAM dependent methyltransferase; NP_744700.1, structural genomics, joint center for structural genom JCSG; HET: SAH; 2.10A {Pseudomonas putida KT2440} Back     alignment and structure
>3gu3_A Methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; HET: SAH; 2.30A {Bacillus cereus} SCOP: c.66.1.49 PDB: 2gh1_A Back     alignment and structure
>3g2m_A PCZA361.24; SAM-dependent methyltransferase, glycopeptide antibiotics biosynthesis, structural genomics; 2.00A {Amycolatopsis orientalis} PDB: 3g2o_A* 3g2p_A* 3g2q_A* Back     alignment and structure
>1nkv_A Hypothetical protein YJHP; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.90A {Escherichia coli} SCOP: c.66.1.21 Back     alignment and structure
>1dus_A MJ0882; hypothetical protein, methanococcus jannaschii, structural genomics, BSGC structure funded by NIH; 1.80A {Methanocaldococcus jannaschii} SCOP: c.66.1.4 Back     alignment and structure
>3pfg_A N-methyltransferase; N,N-dimethyltransferase, SAM binding, DTDP-linked sugar BIND transferase; HET: SAM TLO; 1.35A {Streptomyces fradiae} PDB: 3pfh_A* 3px3_A* 3px2_A* Back     alignment and structure
>1tw3_A COMT, carminomycin 4-O-methyltransferase; anthracycline, methylate, tailoring enzyme, polyketide, S-adenosyl-L-homocystein; HET: SAH ERT; 2.35A {Streptomyces peucetius} SCOP: a.4.5.29 c.66.1.12 PDB: 1tw2_A* Back     alignment and structure
>3d2l_A SAM-dependent methyltransferase; ZP_00538691.1, structural G joint center for structural genomics, JCSG; HET: MSE; 1.90A {Exiguobacterium sibiricum 255-15} Back     alignment and structure
>2g72_A Phenylethanolamine N-methyltransferase; HET: SAM F21; 2.00A {Homo sapiens} SCOP: c.66.1.15 PDB: 1yz3_A* 2an4_A* 2an5_A* 2g70_A* 2g71_A* 2an3_A* 2g8n_A* 2ony_A* 3hcb_A* 3hcc_A* 3hcd_A* 3hcf_A* 3kpj_A* 3kpu_A* 3kpv_A* 3kpw_A* 3kpy_A* 3kqm_A* 3kqo_A* 3kqp_A* ... Back     alignment and structure
>3ggd_A SAM-dependent methyltransferase; YP_325210.1, structural GEN joint center for structural genomics, JCSG; HET: SAH; 2.11A {Anabaena variabilis atcc 29413} Back     alignment and structure
>1ve3_A Hypothetical protein PH0226; dimer, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function, NPPSFA; HET: SAM; 2.10A {Pyrococcus horikoshii} SCOP: c.66.1.43 Back     alignment and structure
>2fyt_A Protein arginine N-methyltransferase 3; structural genomics, structural genomics consortium, SGC; HET: SAH; 2.00A {Homo sapiens} SCOP: c.66.1.6 PDB: 3smq_A* 1f3l_A* Back     alignment and structure
>2zfu_A Nucleomethylin, cerebral protein 1; nucleolar protein, SAM-binding protein, protein structure, N phosphoprotein, nuclear protein; HET: SAH; 2.00A {Homo sapiens} Back     alignment and structure
>3dmg_A Probable ribosomal RNA small subunit methyltransf; monomethyltranserase, 16S rRNA methyltransferase, N2 G1207 methyltransferase; HET: SAH; 1.55A {Thermus thermophilus} PDB: 3dmf_A* 3dmh_A* 2zul_A* 2zwv_A* Back     alignment and structure
>3bkw_A MLL3908 protein, S-adenosylmethionine dependent methyltransferase; NP_104914.1; HET: MSE; 1.60A {Mesorhizobium loti} Back     alignment and structure
>1pjz_A Thiopurine S-methyltransferase; polymorphism, S-adenosylmethionine, drug metabolism; NMR {Pseudomonas syringae PV} SCOP: c.66.1.36 Back     alignment and structure
>3bxo_A N,N-dimethyltransferase; desosamine, sugar, carbohydrate, antibiotic, SAM, adoMet; HET: SAM UPP; 2.00A {Streptomyces venezuelae} Back     alignment and structure
>1g6q_1 HnRNP arginine N-methyltransferase; SAM-binding domain, beta-barrel, mixed alpha-beta, hexamer; 2.90A {Saccharomyces cerevisiae} SCOP: c.66.1.6 Back     alignment and structure
>1zx0_A Guanidinoacetate N-methyltransferase; structural genomics, structural genomics consortium; HET: SAH; 1.86A {Homo sapiens} PDB: 3orh_A* 1xcj_A* 1xcl_A* 1p1c_A* 1p1b_A* 1khh_A* Back     alignment and structure
>3cgg_A SAM-dependent methyltransferase; NP_600671.1, methyltransferase domain, structural genomics; HET: NHE CIT; 2.00A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>2kw5_A SLR1183 protein; structural genomics, northeast structural genomics consortium (NESG), PSI-2, protein structure initiative, unknown function; NMR {Synechocystis} PDB: 3mer_A Back     alignment and structure
>1wzn_A SAM-dependent methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: SAH; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.43 Back     alignment and structure
>2i62_A Nicotinamide N-methyltransferase; structural genomics, structural genomics consortium, SGC; HET: SAH; 1.80A {Mus musculus} PDB: 2iip_A* 3rod_A* Back     alignment and structure
>3g07_A 7SK snRNA methylphosphate capping enzyme; structural genomics consortium (SGC), methyltransferase, phosphoprotein, S-adenosyl-L-methionine; HET: SAM; 2.65A {Homo sapiens} Back     alignment and structure
>4e2x_A TCAB9; kijanose, tetronitrose, tetradeoxy sugar, sugar methylation, transferase; HET: SAH TYD; 1.40A {Micromonospora chalcea} PDB: 3ndi_A* 3ndj_A* 4e32_A* 4e33_A* 4e2y_A* 4e31_A* 4e2w_A* 4e2z_A* 4e30_A* Back     alignment and structure
>3dxy_A TRNA (guanine-N(7)-)-methyltransferase; rossmann fold methyltransferase, tRNA modification, S-adenosyl-L-methionine, TR processing; HET: SAM; 1.50A {Escherichia coli} PDB: 3dxx_A* 3dxz_A* Back     alignment and structure
>2fca_A TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bacillus subtilis} SCOP: c.66.1.53 Back     alignment and structure
>3i9f_A Putative type 11 methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.50A {Sulfolobus solfataricus} Back     alignment and structure
>3mti_A RRNA methylase; SAM-dependent, PSI, MCSG, structural genomics, midwest cente structural genomics, protein structure initiative; 1.95A {Streptococcus thermophilus} PDB: 3lby_A* Back     alignment and structure
>3iv6_A Putative Zn-dependent alcohol dehydrogenase; alpha/beta fold, rossmann-fold, structural genomics, PSI-2, structure initiative; HET: SAM; 2.70A {Rhodobacter sphaeroides} Back     alignment and structure
>3p9n_A Possible methyltransferase (methylase); RV2966C, adoMet binding, RNA methylase, RSMD, SAM-fold, RNA methyltransferase; 1.90A {Mycobacterium tuberculosis} Back     alignment and structure
>1fp2_A Isoflavone O-methyltransferase; protein-product complex; HET: SAH HMO; 1.40A {Medicago sativa} SCOP: a.4.5.29 c.66.1.12 PDB: 1fpx_A* 2qyo_A* Back     alignment and structure
>2plw_A Ribosomal RNA methyltransferase, putative; malaria, SAM, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.70A {Plasmodium falciparum} Back     alignment and structure
>2pxx_A Uncharacterized protein MGC2408; structural genomics consortium, SGC, methyltransferase, LOC84291, transferase; HET: SAH; 1.30A {Homo sapiens} Back     alignment and structure
>3eey_A Putative rRNA methylase; rRNA methylation, S-adenosyl-methionine, structural genomics structure initiative, PSI; HET: SAM; 2.20A {Clostridium thermocellum atcc 27405} Back     alignment and structure
>3uwp_A Histone-lysine N-methyltransferase, H3 lysine-79; epigenetics, tubercidin, structu genomics, structural genomics consortium, SGC; HET: 5ID; 2.05A {Homo sapiens} PDB: 4eqz_A* 3sx0_A* 4er0_A* 4er7_A* 1nw3_A* 4er6_A* 4er5_A* 3qow_A* 3qox_A* 4ek9_A* 4ekg_A* 4eki_A* 4er3_A* 3sr4_A* Back     alignment and structure
>4hc4_A Protein arginine N-methyltransferase 6; HRMT1L6, S-adenosyl-L-homocysteine, struc genomics, structural genomics consortium, SGC; HET: SAH; 1.97A {Homo sapiens} Back     alignment and structure
>1l3i_A Precorrin-6Y methyltransferase/putative decarboxylase; structural genomics, beta barrel, rossmann fold, tetramer; HET: SAH; 1.95A {Methanothermobacterthermautotrophicus} SCOP: c.66.1.22 PDB: 1kxz_A 1l3b_A 1f38_A 1l3c_A* Back     alignment and structure
>1jsx_A Glucose-inhibited division protein B; methyltransferase fold, structural genomics, PSI, protein structure initiative; 2.40A {Escherichia coli} SCOP: c.66.1.20 Back     alignment and structure
>2b3t_A Protein methyltransferase HEMK; translation termination, methylation, conformational changes; HET: SAH; 3.10A {Escherichia coli} SCOP: c.66.1.30 PDB: 1t43_A* Back     alignment and structure
>2pjd_A Ribosomal RNA small subunit methyltransferase C; gene duplication, RNA modification, SAM binding; 2.10A {Escherichia coli} Back     alignment and structure
>4dcm_A Ribosomal RNA large subunit methyltransferase G; 23S rRNA (guanine1835-N2)-methyltransferase; HET: SAM; 2.30A {Escherichia coli} Back     alignment and structure
>3orh_A Guanidinoacetate N-methyltransferase; structura genomics, structural genomics consortium, SGC; HET: SAH; 1.86A {Homo sapiens} PDB: 1xcj_A* 1xcl_A* 1p1c_A* 1p1b_A* 1khh_A* Back     alignment and structure
>1af7_A Chemotaxis receptor methyltransferase CHER; chemotaxis receptor methylation; HET: SAH; 2.00A {Salmonella typhimurium} SCOP: a.58.1.1 c.66.1.8 PDB: 1bc5_A* Back     alignment and structure
>3lbf_A Protein-L-isoaspartate O-methyltransferase; modified rossman-type fold, S-adenosyl-L- methionine; HET: SAH; 1.80A {Escherichia coli} Back     alignment and structure
>2y1w_A Histone-arginine methyltransferase CARM1; histone modification; HET: SFG 849; 2.10A {Homo sapiens} PDB: 2y1x_A* 3b3f_A* 3b3g_A 2v74_B* 2v7e_A Back     alignment and structure
>3hm2_A Precorrin-6Y C5,15-methyltransferase; alpha-beta-sandwich, structural genomics, PSI-2, protein structure initiative; 2.21A {Corynebacterium diphtheriae} Back     alignment and structure
>1ej0_A FTSJ; methyltransferase, adoMet, adenosyl methionine, heat shock proteins, 23S ribosomal RNA; HET: SAM; 1.50A {Escherichia coli} SCOP: c.66.1.2 PDB: 1eiz_A* Back     alignment and structure
>3e05_A Precorrin-6Y C5,15-methyltransferase (decarboxyla; porphyrin metabolism, S-adenosyl-methionine; 1.80A {Geobacter metallireducens} SCOP: c.66.1.0 Back     alignment and structure
>2avn_A Ubiquinone/menaquinone biosynthesis methyltransfe related protein; ubiquinone/menaquinone biosynthesis methyltransferase-relate protein; HET: SAI; 2.35A {Thermotoga maritima} SCOP: c.66.1.41 Back     alignment and structure
>3q87_B N6 adenine specific DNA methylase; SAM-methyltransferase, methyltransferase, methylation, trans activator-transferase complex; HET: SAM; 2.00A {Encephalitozoon cuniculi} Back     alignment and structure
>3ckk_A TRNA (guanine-N(7)-)-methyltransferase; mettl1, S-adenosyl-L-methionine, tRNA Pro structural genomics, structural genomics consortium, SGC; HET: SAM; 1.55A {Homo sapiens} Back     alignment and structure
>2yxd_A Probable cobalt-precorrin-6Y C(15)-methyltransfer [decarboxylating]; alpha and beta protein (A/B) class; HET: MES; 2.30A {Methanocaldococcus jannaschii} Back     alignment and structure
>1xdz_A Methyltransferase GIDB; MCSG, protein structure initiative, structural genomics, methyltransferase fold, PSI; 1.60A {Bacillus subtilis} SCOP: c.66.1.20 Back     alignment and structure
>2h00_A Methyltransferase 10 domain containing protein; structural genomics, structural genomics consortium, SGC; HET: SAH; 2.00A {Homo sapiens} SCOP: c.66.1.54 Back     alignment and structure
>2ozv_A Hypothetical protein ATU0636; structural genomics, predicted transferase, predicted O-methyltransferase, PFAM PF05175; HET: MSE; 1.70A {Agrobacterium tumefaciens str} Back     alignment and structure
>3njr_A Precorrin-6Y methylase; methyltransferase, decarboxylase, transferase; HET: SAH PG4; 2.70A {Rhodobacter capsulatus} Back     alignment and structure
>3u81_A Catechol O-methyltransferase; neurotransmitter degradation, transferase transferase inhibitor complex; HET: SAH; 1.13A {Rattus norvegicus} SCOP: c.66.1.1 PDB: 3nwe_A* 3oe5_A* 3ozr_A* 3oe4_A* 3ozt_A* 3ozs_A* 3r6t_A* 3hvi_A* 1jr4_A* 1vid_A* 1h1d_A* 2cl5_A* 3hvh_A* 3hvj_A* 3hvk_A* 3nw9_A* 3nwb_A* 3s68_A* 2zlb_A 2zth_A* ... Back     alignment and structure
>3mb5_A SAM-dependent methyltransferase; RNA methyltransferase, M1A, TRMI, intermolecular contacts, R specificity, tetramer, disulfide bond; HET: SAM; 1.60A {Pyrococcus abyssi} PDB: 3lga_A* 3lhd_C* Back     alignment and structure
>3lpm_A Putative methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium, nysgxrc; 2.40A {Listeria monocytogenes} Back     alignment and structure
>3evz_A Methyltransferase; NYSGXRC, NEW YORK SGX research CE structural genomics, protein structure initiative, pyrococc furiosus, PSI-2; 2.20A {Pyrococcus furiosus} Back     alignment and structure
>2gpy_A O-methyltransferase; structural genomics, PSI, protein structure initiative, NEW research center for structural genomics, nysgxrc; HET: MSE; 1.90A {Bacillus halodurans} Back     alignment and structure
>3ntv_A MW1564 protein; rossmann fold, putative methyltransferase, transferase; HET: MSE; 1.55A {Staphylococcus aureus} Back     alignment and structure
>3gdh_A Trimethylguanosine synthase homolog; M7G, CAP, dimethyltransferase, usnRNA, snoRNA, telomerase, cytoplasm, methyltransferase, nucleus; HET: MGP SAH; 2.00A {Homo sapiens} PDB: 3egi_A* Back     alignment and structure
>1u2z_A Histone-lysine N-methyltransferase, H3 lysine-79 specific; histone methyltransferase, nucleosome; HET: SAH; 2.20A {Saccharomyces cerevisiae} SCOP: c.66.1.31 Back     alignment and structure
>3b3j_A Histone-arginine methyltransferase CARM1; protein arginine methyltransferase 4, APO catalytic domain, regulator, mRNA processing; 2.55A {Rattus norvegicus} Back     alignment and structure
>3bwc_A Spermidine synthase; SAM, SGPP, structura genomics, PSI, protein structure initiative, structural GEN pathogenic protozoa consortium; HET: MSE SAM; 2.30A {Trypanosoma cruzi} PDB: 3bwb_A* Back     alignment and structure
>3gjy_A Spermidine synthase; APC62791, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.47A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>2yxe_A Protein-L-isoaspartate O-methyltransferase; rossman-type fold, alpha/beta/alpha sandwich structure, STRU genomics, NPPSFA; 2.00A {Methanocaldococcus jannaschii} Back     alignment and structure
>3fpf_A Mtnas, putative uncharacterized protein; thermonicotianamine, nicotianamine, biosynthetic protein; HET: TNA MTA; 1.66A {Methanothermobacter thermautotrophicusorganism_taxid} PDB: 3fpe_A* 3fph_A* 3fpg_A* 3fpj_A* 3o31_A* Back     alignment and structure
>3lcv_B Sisomicin-gentamicin resistance methylase SGM; antibiotic resistance, methyltransferase, transferase; HET: SAM; 2.00A {Micromonospora zionensis} PDB: 3lcu_A* Back     alignment and structure
>3fzg_A 16S rRNA methylase; methyltransferase, plasmid, transferase; HET: SAM; 2.00A {Escherichia coli} Back     alignment and structure
>2nxc_A L11 mtase, ribosomal protein L11 methyltransferase; transferase S-adenosly-L-methionine dependent methyltransfer posttranslational modification; 1.59A {Thermus thermophilus} SCOP: c.66.1.39 PDB: 1ufk_A 2nxe_A* 2nxj_A 2nxn_A 2zbp_A* 2zbq_A* 2zbr_A* 3cjq_A* 3cjr_A* 3cju_A* 3egv_A* 3cjt_A* Back     alignment and structure
>3frh_A 16S rRNA methylase; methyltransferase domain, helical N-terminal domain, methyltransferase, plasmid, transferase; HET: SAH; 1.20A {Escherichia coli} PDB: 3fri_A* 3b89_A* Back     alignment and structure
>2yxl_A PH0851 protein, 450AA long hypothetical FMU protein; FMU-homolog, methyltransferase, structural genomics, NPPSFA; HET: SFG; 2.55A {Pyrococcus horikoshii} Back     alignment and structure
>1ixk_A Methyltransferase; open beta sheet; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.38 Back     alignment and structure
>1o54_A SAM-dependent O-methyltransferase; TM0748, structural genomi PSI, protein structure initiative, joint center for structu genomics; 1.65A {Thermotoga maritima} SCOP: c.66.1.13 Back     alignment and structure
>3sso_A Methyltransferase; macrolide, natural product, rossman fold; HET: SAH; 1.90A {Micromonospora griseorubida} PDB: 3ssn_A* 3ssm_A* Back     alignment and structure
>1sqg_A SUN protein, FMU protein; rossmann-fold, mixed beta sheet, methyltransferase-fold, RNA-binding domain; 1.65A {Escherichia coli} SCOP: a.79.1.3 c.66.1.38 PDB: 1sqf_A Back     alignment and structure
>1yb2_A Hypothetical protein TA0852; structural genomics, methyltransferase, thermoplasma acidoph midwest center for structural genomics, MCSG; 2.01A {Thermoplasma acidophilum} SCOP: c.66.1.13 Back     alignment and structure
>1vbf_A 231AA long hypothetical protein-L-isoaspartate O- methyltransferase; trimeric coiled coil assembly; 2.80A {Sulfolobus tokodaii} SCOP: c.66.1.7 Back     alignment and structure
>2frx_A Hypothetical protein YEBU; rossmann-type S-adenosylmethionine-dependent methyltransfera domain; 2.90A {Escherichia coli} Back     alignment and structure
>1dl5_A Protein-L-isoaspartate O-methyltransferase; isoaspartyl residues, protein repair, deamidation, post-translational modification; HET: SAH; 1.80A {Thermotoga maritima} SCOP: c.66.1.7 d.197.1.1 Back     alignment and structure
>1jg1_A PIMT;, protein-L-isoaspartate O-methyltransferase; rossmann methyltransferase, protein repair isomerization; HET: SAH; 1.20A {Pyrococcus furiosus} SCOP: c.66.1.7 PDB: 1jg2_A* 1jg3_A* 1jg4_A* Back     alignment and structure
>3tma_A Methyltransferase; thump domain; 2.05A {Thermus thermophilus} Back     alignment and structure
>3opn_A Putative hemolysin; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics, nysgxrc; 2.05A {Lactococcus lactis subsp} Back     alignment and structure
>1wxx_A TT1595, hypothetical protein TTHA1280; thermus thermophillus, methyltransferase, adoMet, structural genomics; 1.80A {Thermus thermophilus} SCOP: b.122.1.9 c.66.1.51 PDB: 1wxw_A 2cww_A* Back     alignment and structure
>3htx_A HEN1; HEN1, small RNA methyltransferase, protein-RNA complex; HET: SAH; 3.10A {Arabidopsis thaliana} Back     alignment and structure
>3tqs_A Ribosomal RNA small subunit methyltransferase A; protein synthesis; 1.98A {Coxiella burnetii} SCOP: c.66.1.0 Back     alignment and structure
>3kr9_A SAM-dependent methyltransferase; class I rossmann-like methyltransferase fold; 2.00A {Streptococcus pneumoniae} PDB: 3ku1_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 245
d1m6ex_359 c.66.1.35 (X:) Salicylic acid carboxyl methyltrans 7e-79
>d1m6ex_ c.66.1.35 (X:) Salicylic acid carboxyl methyltransferase (SAMT) {Clarkia breweri [TaxId: 36903]} Length = 359 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: S-adenosyl-L-methionine-dependent methyltransferases
superfamily: S-adenosyl-L-methionine-dependent methyltransferases
family: Salicylic acid carboxyl methyltransferase (SAMT)
domain: Salicylic acid carboxyl methyltransferase (SAMT)
species: Clarkia breweri [TaxId: 36903]

 Score =  239 bits (611), Expect = 7e-79
 Identities = 88/261 (33%), Positives = 129/261 (49%), Gaps = 27/261 (10%)

Query: 1   QRRVLERAKELINEAIADKLDLKLLKIDTSSTFRVADLGCSTGPNTFIAMQNIIEAIELK 60
           QR+V+   K +   AI        +    ++   +ADLGCS+GPN   A+  +I+ +E  
Sbjct: 25  QRQVISITKPITEAAITALYSGDTV----TTRLAIADLGCSSGPNALFAVTELIKTVEEL 80

Query: 61  LFQASHKNPATVEFQVFFNDHPENNFNTLFKTLPHSRK----YFAAGVPGFFQDRLFPNS 116
             +   +N    E+Q+F ND P N+FN +F++LP         F  GVPG F  RLFP +
Sbjct: 81  RKKMGRENSP--EYQIFLNDLPGNDFNAIFRSLPIENDVDGVCFINGVPGSFYGRLFPRN 138

Query: 117 TLHIVHSSFALHWISKIPEEIAGGKSLAWNKESIQGKRFVKEVAEAYSTQFKKDIESFLN 176
           TLH +HSS++L W+S++P  I   K   +   +       + V  AY  QF++D   FL 
Sbjct: 139 TLHFIHSSYSLMWLSQVPIGIESNKGNIYMANT-----CPQSVLNAYYKQFQEDHALFLR 193

Query: 177 ARAQELVAGGLMSQTTFGI------------FFDVFGSCLMDMAKMGITSNEKIDSFNIP 224
            RAQE+V GG M  T  G              + +    L  M   G+   EK+D FNIP
Sbjct: 194 CRAQEVVPGGRMVLTILGRRSEDRASTECCLIWQLLAMALNQMVSEGLIEEEKMDKFNIP 253

Query: 225 NHHPTPKELESIIKTNKYFTI 245
            + P+P E+E+ I     F I
Sbjct: 254 QYTPSPTEVEAEILKEGSFLI 274

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query245
d1m6ex_359 Salicylic acid carboxyl methyltransferase (SAMT) { 100.0
d1vl5a_231 Hypothetical protein BH2331 {Bacillus halodurans [ 98.42
d1im8a_225 Hypothetical protein HI0319 (YecO) {Haemophilus in 98.39
d1jqea_280 Histamine methyltransferase {Human (Homo sapiens) 98.23
d2a14a1257 Indolethylamine N-methyltransferase, INMT {Human ( 98.19
d1xxla_234 Hypothetical protein YcgJ {Bacillus subtilis [TaxI 98.14
d2g72a1263 Phenylethanolamine N-methyltransferase, PNMTase {H 97.9
d2ex4a1222 Adrenal gland protein AD-003 (C9orf32) {Human (Hom 97.84
d1ve3a1226 Hypothetical protein PH0226 {Archaeon Pyrococcus h 97.79
d1tw3a2253 Carminomycin 4-O-methyltransferase {Streptomyces p 97.77
d1qzza2256 Aclacinomycin-10-hydroxylase RdmB {Streptomyces pu 97.69
d1fp1d2244 Chalcone O-methyltransferase {Alfalfa (Medicago sa 97.65
d1vlma_208 Possible histamine N-methyltransferase TM1293 {The 97.64
d2i6ga1198 Putative methyltransferase TehB {Salmonella typhim 97.58
d1ri5a_252 mRNA cap (Guanine N-7) methyltransferase {Fungus ( 97.58
d1xtpa_254 Hypothetical protein Lmaj004091aaa (LmjF30.0810) { 97.49
d2o57a1282 Putative sarcosine dimethylglycine methyltransfera 97.45
d1nkva_245 Hypothetical Protein YjhP {Escherichia coli [TaxId 97.45
d1wzna1251 Hypothetical methyltransferase PH1305 {Archaeon Py 97.43
d2fk8a1280 Methoxy mycolic acid synthase 4, Mma4 {Mycobacteri 97.39
d1p91a_268 rRNA methyltransferase RlmA {Escherichia coli [Tax 97.25
d2p7ia1225 Hypothetical protein ECA1738 {Erwinia carotovora [ 97.19
d2gh1a1281 Methyltransferase BC2162 {Bacillus cereus [TaxId: 97.14
d1y8ca_246 Putative methyltransferase CAC2371 {Clostridium ac 97.09
d1fp2a2244 Isoflavone O-methyltransferase {Alfalfa (Medicago 97.03
d1kyza2243 Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltra 96.85
d1kpga_285 CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]} 96.65
d1g6q1_ 328 Arginine methyltransferase, HMT1 {Baker's yeast (S 96.62
d1pjza_201 Thiopurine S-methyltransferase {Pseudomonas syring 96.57
d2fcaa1204 tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacil 96.55
d1g8sa_230 Fibrillarin homologue {Archaeon Methanococcus jann 96.3
d2avna1246 Hypothetical methyltransferase TM1389 {Thermotoga 96.3
d1oria_ 316 Protein arginine N-methyltransferase 1, PRMT1 {Rat 95.8
d2bzga1229 Thiopurine S-methyltransferase {Human (Homo sapien 95.71
d1dl5a1213 Protein-L-isoaspartyl O-methyltransferase {Thermot 95.64
d2fyta1 311 Protein arginine N-methyltransferase 3, PRMT3 {Hum 95.46
d1dusa_194 Hypothetical protein MJ0882 {Archaeon Methanococcu 95.45
d1yzha1204 tRNA (guanine-N(7)-)-methyltransferase TrmB {Strep 95.44
d1nt2a_209 Fibrillarin homologue {Archaeon Archaeoglobus fulg 94.32
d1kpia_291 CmaA2 {Mycobacterium tuberculosis [TaxId: 1773]} 94.32
d1xvaa_292 Glycine N-methyltransferase {Rat (Rattus norvegicu 94.07
d1yb2a1250 Hypothetical protein Ta0852 {Thermoplasma acidophi 94.06
d1zx0a1229 Guanidinoacetate methyltransferase {Human (Homo sa 93.96
d1nw3a_328 Catalytic, N-terminal domain of histone methyltran 92.97
d1i1na_224 Protein-L-isoaspartyl O-methyltransferase {Human ( 92.7
d1g8aa_227 Fibrillarin homologue {Archaeon Pyrococcus horikos 91.73
d1i9ga_264 Probable methyltransferase Rv2118c {Mycobacterium 91.23
d2h00a1250 Methyltransferase 10 domain containing protein MET 87.29
d1l3ia_186 Precorrin-6Y methyltransferase (CbiT) {Archaeon Me 84.09
>d1m6ex_ c.66.1.35 (X:) Salicylic acid carboxyl methyltransferase (SAMT) {Clarkia breweri [TaxId: 36903]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: S-adenosyl-L-methionine-dependent methyltransferases
superfamily: S-adenosyl-L-methionine-dependent methyltransferases
family: Salicylic acid carboxyl methyltransferase (SAMT)
domain: Salicylic acid carboxyl methyltransferase (SAMT)
species: Clarkia breweri [TaxId: 36903]

Probab=100.00  E-value=3.5e-85  Score=605.61  Aligned_cols=233  Identities=38%  Similarity=0.661  Sum_probs=214.8

Q ss_pred             CHHHHHHHHHHHHHHHHHhhhhhcccCCCCCeEEEEeecCCCCcCcHHHHHHHHHHHHHHHhhcCCCCCCCeeEEEEeCC
Q 036170            1 QRRVLERAKELINEAIADKLDLKLLKIDTSSTFRVADLGCSTGPNTFIAMQNIIEAIELKLFQASHKNPATVEFQVFFND   80 (245)
Q Consensus         1 Q~~~~~~~~~~~~~ai~~~~~~~~~~~~~~~~~~IaD~GCS~G~Ns~~~~~~ii~~i~~~~~~~~~~~~~~p~~~v~~nD   80 (245)
                      |+++|+++||+|++||++++....    .+++|+|||||||+||||+.+|+.||++|+++|++.+.  .++|||||||||
T Consensus        25 Q~~~i~~~kp~leeai~~~~~~~~----~~~~~~IADlGCS~G~Ntl~~v~~iI~~i~~~~~~~~~--~~~pe~qvf~nD   98 (359)
T d1m6ex_          25 QRQVISITKPITEAAITALYSGDT----VTTRLAIADLGCSSGPNALFAVTELIKTVEELRKKMGR--ENSPEYQIFLND   98 (359)
T ss_dssp             HHHHHHHTHHHHHHHHHHHHSSSS----SSSEECCEEESCCSSTTTTTGGGTTHHHHHHHHHSSSC--SSCCEEEEEEEE
T ss_pred             HHHHHHHHHHHHHHHHHhcccCCC----CCCceEEEEeCCCCCccHHHHHHHHHHHHHHHHHhcCC--CCCCeEEEEeCC
Confidence            899999999999999999874332    46899999999999999999999999999999987654  247899999999


Q ss_pred             CCCCchHHHhhhCCCC----CceEEeecCcccccccCCCCceeEEEeccccccccCCCccccCCCCcccCCCccccc-CC
Q 036170           81 HPENNFNTLFKTLPHS----RKYFAAGVPGFFQDRLFPNSTLHIVHSSFALHWISKIPEEIAGGKSLAWNKESIQGK-RF  155 (245)
Q Consensus        81 lP~NDFntLF~~L~~~----~~~f~~~vpgSFy~rLfP~~Svh~~~Ss~alHWLS~~P~~~~d~~~~~~nkg~i~~~-~~  155 (245)
                      ||+||||+||++||..    ++||++|||||||+||||++||||+||+||||||||+|+++.+      |||+||++ ++
T Consensus        99 LP~NDFNtLF~~L~~~~~~~~~~f~~gvpGSFY~rLfP~~Slh~~~Ss~alHWLS~vP~~l~~------n~~~i~~~~~~  172 (359)
T d1m6ex_          99 LPGNDFNAIFRSLPIENDVDGVCFINGVPGSFYGRLFPRNTLHFIHSSYSLMWLSQVPIGIES------NKGNIYMANTC  172 (359)
T ss_dssp             CTTSCHHHHHTTTTTSCSCTTCEEEEEEESCSSSCCSCTTCBSCEEEESCTTBCSSCCSCCCC------CTTTTSSCSSS
T ss_pred             CCcchHHHHHHhccccccCCCCeEEEecCCchhhhcCCCCceEEeeehhhhhhhhcCCccccC------CCCcEEEcCCC
Confidence            9999999999999864    4699999999999999999999999999999999999998864      88899987 56


Q ss_pred             cHHHHHHHHHHHHHhHHHHHHHHHHhhccCCcc-----c-------ccccchHHHHHHHHHHHHHhcCCCChhhhccCcc
Q 036170          156 VKEVAEAYSTQFKKDIESFLNARAQELVAGGLM-----S-------QTTFGIFFDVFGSCLMDMAKMGITSNEKIDSFNI  223 (245)
Q Consensus       156 ~~~v~~ay~~Q~~~D~~~FL~~Ra~EL~~GG~l-----~-------~~~~~~~~~~l~~~l~~mv~eG~i~~e~~d~fn~  223 (245)
                      +++|.+||++||++||.+||++||+||+|||+|     +       +++.+.+|++|.++|+|||+||+|++||+|+||+
T Consensus       173 ~~~v~~ay~~Qf~~D~~~FL~~Ra~ELv~GG~mvl~~~gr~~~~~~~~~~~~~~~~l~~al~dmv~eGlI~eek~dsfn~  252 (359)
T d1m6ex_         173 PQSVLNAYYKQFQEDHALFLRCRAQEVVPGGRMVLTILGRRSEDRASTECCLIWQLLAMALNQMVSEGLIEEEKMDKFNI  252 (359)
T ss_dssp             CCTTSCCSHHHHHHHHHHHHHHHHHHBCTTCEEEEEEEECSSSSSSSTTTSTTTHHHHHHHHHHHHTTCSCCSTTGGGCC
T ss_pred             CHHHHHHHHHHHHHHHHHHHHHHHHHhcCCcEEEEEEeccCCCCCCCCccchHHHHHHHHHHHHHHcCCCCHHHHHhccC
Confidence            899999999999999999999999999999999     1       2345678999999999999999999999999999


Q ss_pred             CcccCCHHHHHHHHhhCCceeC
Q 036170          224 PNHHPTPKELESIIKTNKYFTI  245 (245)
Q Consensus       224 P~y~ps~eEv~~~ie~~G~f~i  245 (245)
                      |+|+||+||++++|+++|+|+|
T Consensus       253 P~Y~ps~eEv~~~ie~~gsF~i  274 (359)
T d1m6ex_         253 PQYTPSPTEVEAEILKEGSFLI  274 (359)
T ss_dssp             CCBCCCSHHHHHHHHHTTTBCC
T ss_pred             ccccCCHHHHHHHhccCCCeee
Confidence            9999999999999999999987
>d1vl5a_ c.66.1.41 (A:) Hypothetical protein BH2331 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1im8a_ c.66.1.14 (A:) Hypothetical protein HI0319 (YecO) {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1jqea_ c.66.1.19 (A:) Histamine methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2a14a1 c.66.1.15 (A:5-261) Indolethylamine N-methyltransferase, INMT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xxla_ c.66.1.41 (A:) Hypothetical protein YcgJ {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2g72a1 c.66.1.15 (A:18-280) Phenylethanolamine N-methyltransferase, PNMTase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ex4a1 c.66.1.42 (A:2-224) Adrenal gland protein AD-003 (C9orf32) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ve3a1 c.66.1.43 (A:2-227) Hypothetical protein PH0226 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1tw3a2 c.66.1.12 (A:99-351) Carminomycin 4-O-methyltransferase {Streptomyces peucetius [TaxId: 1950]} Back     information, alignment and structure
>d1qzza2 c.66.1.12 (A:102-357) Aclacinomycin-10-hydroxylase RdmB {Streptomyces purpurascens [TaxId: 1924]} Back     information, alignment and structure
>d1fp1d2 c.66.1.12 (D:129-372) Chalcone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d1vlma_ c.66.1.41 (A:) Possible histamine N-methyltransferase TM1293 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2i6ga1 c.66.1.44 (A:1-198) Putative methyltransferase TehB {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1ri5a_ c.66.1.34 (A:) mRNA cap (Guanine N-7) methyltransferase {Fungus (Encephalitozoon cuniculi) [TaxId: 6035]} Back     information, alignment and structure
>d1xtpa_ c.66.1.42 (A:) Hypothetical protein Lmaj004091aaa (LmjF30.0810) {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d2o57a1 c.66.1.18 (A:16-297) Putative sarcosine dimethylglycine methyltransferase {Red algae (Galdieria sulphuraria) [TaxId: 130081]} Back     information, alignment and structure
>d1nkva_ c.66.1.21 (A:) Hypothetical Protein YjhP {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wzna1 c.66.1.43 (A:1-251) Hypothetical methyltransferase PH1305 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2fk8a1 c.66.1.18 (A:22-301) Methoxy mycolic acid synthase 4, Mma4 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1p91a_ c.66.1.33 (A:) rRNA methyltransferase RlmA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2p7ia1 c.66.1.41 (A:22-246) Hypothetical protein ECA1738 {Erwinia carotovora [TaxId: 554]} Back     information, alignment and structure
>d2gh1a1 c.66.1.49 (A:13-293) Methyltransferase BC2162 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1y8ca_ c.66.1.43 (A:) Putative methyltransferase CAC2371 {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d1fp2a2 c.66.1.12 (A:109-352) Isoflavone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d1kyza2 c.66.1.12 (A:120-362) Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d1kpga_ c.66.1.18 (A:) CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1g6q1_ c.66.1.6 (1:) Arginine methyltransferase, HMT1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pjza_ c.66.1.36 (A:) Thiopurine S-methyltransferase {Pseudomonas syringae [TaxId: 317]} Back     information, alignment and structure
>d2fcaa1 c.66.1.53 (A:10-213) tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1g8sa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2avna1 c.66.1.41 (A:1-246) Hypothetical methyltransferase TM1389 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1oria_ c.66.1.6 (A:) Protein arginine N-methyltransferase 1, PRMT1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2bzga1 c.66.1.36 (A:17-245) Thiopurine S-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dl5a1 c.66.1.7 (A:1-213) Protein-L-isoaspartyl O-methyltransferase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2fyta1 c.66.1.6 (A:238-548) Protein arginine N-methyltransferase 3, PRMT3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dusa_ c.66.1.4 (A:) Hypothetical protein MJ0882 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1yzha1 c.66.1.53 (A:8-211) tRNA (guanine-N(7)-)-methyltransferase TrmB {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1nt2a_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1kpia_ c.66.1.18 (A:) CmaA2 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1xvaa_ c.66.1.5 (A:) Glycine N-methyltransferase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1yb2a1 c.66.1.13 (A:6-255) Hypothetical protein Ta0852 {Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1zx0a1 c.66.1.16 (A:8-236) Guanidinoacetate methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nw3a_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i1na_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g8aa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1i9ga_ c.66.1.13 (A:) Probable methyltransferase Rv2118c {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2h00a1 c.66.1.54 (A:5-254) Methyltransferase 10 domain containing protein METT10D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l3ia_ c.66.1.22 (A:) Precorrin-6Y methyltransferase (CbiT) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure