Citrus Sinensis ID: 036188
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 210 | ||||||
| 145695037 | 353 | O-methyltransferase [Citrus sinensis x C | 1.0 | 0.594 | 0.919 | 1e-110 | |
| 224128073 | 358 | catechol o-methyltransferase related [Po | 0.971 | 0.569 | 0.631 | 4e-71 | |
| 255548061 | 359 | o-methyltransferase, putative [Ricinus c | 0.971 | 0.568 | 0.589 | 1e-66 | |
| 224068173 | 359 | catechol o-methyltransferase [Populus tr | 0.980 | 0.573 | 0.591 | 5e-66 | |
| 449461110 | 370 | PREDICTED: caffeic acid 3-O-methyltransf | 0.990 | 0.562 | 0.589 | 5e-63 | |
| 449524438 | 266 | PREDICTED: caffeic acid 3-O-methyltransf | 0.990 | 0.781 | 0.589 | 7e-63 | |
| 268528131 | 356 | caffeic acid O-methyltransferase 3 [Goss | 1.0 | 0.589 | 0.553 | 3e-62 | |
| 357512657 | 362 | Caffeic acid 3-O-methyltransferase [Medi | 0.966 | 0.560 | 0.557 | 7e-62 | |
| 388494808 | 362 | unknown [Medicago truncatula] | 0.966 | 0.560 | 0.557 | 7e-62 | |
| 449524436 | 361 | PREDICTED: caffeic acid 3-O-methyltransf | 0.966 | 0.562 | 0.623 | 7e-61 |
| >gi|145695037|gb|ABP94018.1| O-methyltransferase [Citrus sinensis x Citrus reticulata] | Back alignment and taxonomy information |
|---|
Score = 402 bits (1033), Expect = e-110, Method: Compositional matrix adjust.
Identities = 193/210 (91%), Positives = 201/210 (95%)
Query: 1 MDSIVDGERDQSFAYADQLATGVVLPMAIQAVYELGIFEILDKAGPGTKLSASDIAAQLL 60
MDSIVDGERDQSFAYA+QLA G +LPMAIQ VYELGIFEILDK GPG KL ASDIAAQLL
Sbjct: 1 MDSIVDGERDQSFAYANQLAMGTMLPMAIQTVYELGIFEILDKVGPGAKLCASDIAAQLL 60
Query: 61 TKNKDAPMMLDRILRLLASYSVVECSLDASGARRLYSLNSVSKYYVPNKDGVLLGPLIQI 120
TKNKDAPMMLDRILRLLASYSVVECSLDASGARRLYSLNSVSKYYVPNKDGVLLGPLIQI
Sbjct: 61 TKNKDAPMMLDRILRLLASYSVVECSLDASGARRLYSLNSVSKYYVPNKDGVLLGPLIQI 120
Query: 121 IQDKVILESWSQLKDAILEGGIPFNRAHGVHIFEYAGLNPRFNKHFNAAMYNYTSLVMSN 180
+QDKV L+SWSQLKDAILEGGIPFNRAHGVH+FEY GL+P+FNKHFN AMYNYTSLVMSN
Sbjct: 121 VQDKVFLKSWSQLKDAILEGGIPFNRAHGVHVFEYTGLDPKFNKHFNTAMYNYTSLVMSN 180
Query: 181 ILESYKGFDNIKQLVDVGGSLGVTLQAITT 210
ILESYKGFDNIKQLVDVGGSLG+TLQAITT
Sbjct: 181 ILESYKGFDNIKQLVDVGGSLGITLQAITT 210
|
Source: Citrus sinensis x Citrus reticulata Species: Citrus sinensis x Citrus reticulata Genus: Citrus Family: Rutaceae Order: Sapindales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|224128073|ref|XP_002320237.1| catechol o-methyltransferase related [Populus trichocarpa] gi|118481911|gb|ABK92890.1| unknown [Populus trichocarpa] gi|222861010|gb|EEE98552.1| catechol o-methyltransferase related [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|255548061|ref|XP_002515087.1| o-methyltransferase, putative [Ricinus communis] gi|223545567|gb|EEF47071.1| o-methyltransferase, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|224068173|ref|XP_002302676.1| catechol o-methyltransferase [Populus trichocarpa] gi|222844402|gb|EEE81949.1| catechol o-methyltransferase [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|449461110|ref|XP_004148286.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|449524438|ref|XP_004169230.1| PREDICTED: caffeic acid 3-O-methyltransferase-like, partial [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|268528131|gb|ACZ06242.1| caffeic acid O-methyltransferase 3 [Gossypium hirsutum] | Back alignment and taxonomy information |
|---|
| >gi|357512657|ref|XP_003626617.1| Caffeic acid 3-O-methyltransferase [Medicago truncatula] gi|87240860|gb|ABD32718.1| O-methyltransferase, family 2; Dimerisation [Medicago truncatula] gi|355501632|gb|AES82835.1| Caffeic acid 3-O-methyltransferase [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|388494808|gb|AFK35470.1| unknown [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|449524436|ref|XP_004169229.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 210 | ||||||
| TAIR|locus:2153423 | 363 | OMT1 "AT5G54160" [Arabidopsis | 0.947 | 0.548 | 0.514 | 1.7e-50 | |
| UNIPROTKB|Q84N28 | 360 | OMT1 "Flavone O-methyltransfer | 0.947 | 0.552 | 0.460 | 4.5e-43 | |
| UNIPROTKB|Q6ZD89 | 368 | ROMT-9 "Flavone 3'-O-methyltra | 0.957 | 0.546 | 0.436 | 6.8e-40 | |
| TAIR|locus:2204695 | 381 | AT1G77530 [Arabidopsis thalian | 0.928 | 0.511 | 0.390 | 4e-35 | |
| TAIR|locus:2199607 | 373 | IGMT1 "indole glucosinolate O- | 0.961 | 0.541 | 0.414 | 1.3e-34 | |
| TAIR|locus:2038026 | 352 | AT1G33030 [Arabidopsis thalian | 0.942 | 0.562 | 0.388 | 1.3e-34 | |
| TAIR|locus:2204680 | 381 | AT1G77520 [Arabidopsis thalian | 0.928 | 0.511 | 0.380 | 2.2e-34 | |
| TAIR|locus:2199582 | 373 | IGMT4 "indole glucosinolate O- | 0.961 | 0.541 | 0.396 | 1.5e-33 | |
| TAIR|locus:2199597 | 373 | IGMT3 "indole glucosinolate O- | 0.966 | 0.544 | 0.402 | 5.2e-33 | |
| TAIR|locus:2199587 | 373 | IGMT2 "indole glucosinolate O- | 0.966 | 0.544 | 0.402 | 5.2e-33 |
| TAIR|locus:2153423 OMT1 "AT5G54160" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 525 (189.9 bits), Expect = 1.7e-50, P = 1.7e-50
Identities = 105/204 (51%), Positives = 144/204 (70%)
Query: 10 DQSFAYADQLATGVVLPMAIQAVYELGIFEILDKAGPGTKLSASDIAAQLLTKNKDAPMM 69
D++ +A QLA+ VLPMA+++ EL + EI+ K G + +S ++IA++L TKN +AP+M
Sbjct: 17 DEAALFAMQLASASVLPMALKSALELDLLEIMAKNG--SPMSPTEIASKLPTKNPEAPVM 74
Query: 70 LDRILRLLASYSVVECS---LDASGARRLYSLNSVSKYYVPNKDGVLLGPLIQIIQDKVI 126
LDRILRLL SYSV+ CS L G R+Y L V KY N+DGV + L + QDKV+
Sbjct: 75 LDRILRLLTSYSVLTCSNRKLSGDGVERIYGLGPVCKYLTKNEDGVSIAALCLMNQDKVL 134
Query: 127 LESWSQLKDAILEGGIPFNRAHGVHIFEYAGLNPRFNKHFNAAMYNYTSLVMSNILESYK 186
+ESW LKDAIL+GGIPFN+A+G+ FEY G +PRFNK FN M N++++ M ILE+YK
Sbjct: 135 MESWYHLKDAILDGGIPFNKAYGMSAFEYHGTDPRFNKVFNNGMSNHSTITMKKILETYK 194
Query: 187 GFDNIKQLVDVGGSLGVTLQAITT 210
GF+ + LVDVGG +G TL+ I +
Sbjct: 195 GFEGLTSLVDVGGGIGATLKMIVS 218
|
|
| UNIPROTKB|Q84N28 OMT1 "Flavone O-methyltransferase 1" [Triticum aestivum (taxid:4565)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q6ZD89 ROMT-9 "Flavone 3'-O-methyltransferase 1" [Oryza sativa Japonica Group (taxid:39947)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2204695 AT1G77530 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2199607 IGMT1 "indole glucosinolate O-methyltransferase 1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2038026 AT1G33030 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2204680 AT1G77520 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2199582 IGMT4 "indole glucosinolate O-methyltransferase 4" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2199597 IGMT3 "indole glucosinolate O-methyltransferase 3" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2199587 IGMT2 "indole glucosinolate O-methyltransferase 2" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| COMT4 | SubName- Full=Putative uncharacterized protein; (358 aa) | |||||||
(Populus trichocarpa) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 210 | |||
| pfam00891 | 239 | pfam00891, Methyltransf_2, O-methyltransferase | 2e-36 | |
| pfam08100 | 50 | pfam08100, Dimerisation, Dimerisation domain | 3e-14 |
| >gnl|CDD|216177 pfam00891, Methyltransf_2, O-methyltransferase | Back alignment and domain information |
|---|
Score = 127 bits (321), Expect = 2e-36
Identities = 53/117 (45%), Positives = 66/117 (56%)
Query: 93 RRLYSLNSVSKYYVPNKDGVLLGPLIQIIQDKVILESWSQLKDAILEGGIPFNRAHGVHI 152
Y L SK V +D L PL+ + D +LESW+ LKDA+ EGG PF RA G+
Sbjct: 4 GEDYGLTPASKLLVKGEDSPSLAPLLLMYADPTLLESWAHLKDAVREGGPPFERAFGMPF 63
Query: 153 FEYAGLNPRFNKHFNAAMYNYTSLVMSNILESYKGFDNIKQLVDVGGSLGVTLQAIT 209
FEY G +P FN+ FN AM ++ LVM ILE+ F + LVDVGG G AI
Sbjct: 64 FEYLGADPEFNRVFNRAMAAHSRLVMKKILETAFDFSGLSSLVDVGGGTGALAAAIV 120
|
This family includes a range of O-methyltransferases. These enzymes utilise S-adenosyl methionine. Length = 239 |
| >gnl|CDD|219719 pfam08100, Dimerisation, Dimerisation domain | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 210 | |||
| KOG3178 | 342 | consensus Hydroxyindole-O-methyltransferase and re | 99.91 | |
| TIGR02716 | 306 | C20_methyl_CrtF C-20 methyltransferase BchU. Membe | 99.9 | |
| PF00891 | 241 | Methyltransf_2: O-methyltransferase; InterPro: IPR | 99.8 | |
| PF08100 | 51 | Dimerisation: Dimerisation domain; InterPro: IPR01 | 99.2 | |
| PF09339 | 52 | HTH_IclR: IclR helix-turn-helix domain; InterPro: | 97.7 | |
| smart00346 | 91 | HTH_ICLR helix_turn_helix isocitrate lyase regulat | 97.53 | |
| smart00550 | 68 | Zalpha Z-DNA-binding domain in adenosine deaminase | 97.34 | |
| COG1414 | 246 | IclR Transcriptional regulator [Transcription] | 97.24 | |
| PF02082 | 83 | Rrf2: Transcriptional regulator; InterPro: IPR0009 | 97.15 | |
| PF12840 | 61 | HTH_20: Helix-turn-helix domain; PDB: 1ULY_A 2CWE_ | 97.08 | |
| TIGR02431 | 248 | pcaR_pcaU beta-ketoadipate pathway transcriptional | 97.07 | |
| PRK11569 | 274 | transcriptional repressor IclR; Provisional | 97.05 | |
| PRK10163 | 271 | DNA-binding transcriptional repressor AllR; Provis | 97.04 | |
| PF01022 | 47 | HTH_5: Bacterial regulatory protein, arsR family; | 96.99 | |
| PRK09834 | 263 | DNA-binding transcriptional activator MhpR; Provis | 96.97 | |
| PF13412 | 48 | HTH_24: Winged helix-turn-helix DNA-binding; PDB: | 96.92 | |
| PRK15090 | 257 | DNA-binding transcriptional regulator KdgR; Provis | 96.91 | |
| PRK10857 | 164 | DNA-binding transcriptional regulator IscR; Provis | 96.71 | |
| PF04703 | 62 | FaeA: FaeA-like protein; PDB: 2JT1_A 2HTJ_A. | 96.68 | |
| cd00092 | 67 | HTH_CRP helix_turn_helix, cAMP Regulatory protein | 96.65 | |
| PRK10141 | 117 | DNA-binding transcriptional repressor ArsR; Provis | 96.63 | |
| smart00419 | 48 | HTH_CRP helix_turn_helix, cAMP Regulatory protein. | 96.61 | |
| PF01978 | 68 | TrmB: Sugar-specific transcriptional regulator Trm | 96.58 | |
| PRK06922 | 677 | hypothetical protein; Provisional | 96.5 | |
| COG1959 | 150 | Predicted transcriptional regulator [Transcription | 96.41 | |
| TIGR02010 | 135 | IscR iron-sulfur cluster assembly transcription fa | 96.41 | |
| PF09012 | 69 | FeoC: FeoC like transcriptional regulator; InterPr | 96.34 | |
| PF14947 | 77 | HTH_45: Winged helix-turn-helix; PDB: 1XSX_B 1R7J_ | 96.32 | |
| TIGR00738 | 132 | rrf2_super rrf2 family protein (putative transcrip | 96.22 | |
| PF13463 | 68 | HTH_27: Winged helix DNA-binding domain; PDB: 3GFL | 96.2 | |
| PF12802 | 62 | MarR_2: MarR family; PDB: 3ECO_B 2QWW_B 3KP6_B 3KP | 96.02 | |
| TIGR02021 | 219 | BchM-ChlM magnesium protoporphyrin O-methyltransfe | 95.99 | |
| TIGR02944 | 130 | suf_reg_Xantho FeS assembly SUF system regulator, | 95.99 | |
| smart00347 | 101 | HTH_MARR helix_turn_helix multiple antibiotic resi | 95.96 | |
| PRK11920 | 153 | rirA iron-responsive transcriptional regulator; Re | 95.76 | |
| smart00420 | 53 | HTH_DEOR helix_turn_helix, Deoxyribose operon repr | 95.74 | |
| PRK03902 | 142 | manganese transport transcriptional regulator; Pro | 95.71 | |
| PF08220 | 57 | HTH_DeoR: DeoR-like helix-turn-helix domain; Inter | 95.69 | |
| PF01047 | 59 | MarR: MarR family; InterPro: IPR000835 The MarR-ty | 95.64 | |
| PHA00738 | 108 | putative HTH transcription regulator | 95.64 | |
| TIGR00122 | 69 | birA_repr_reg BirA biotin operon repressor domain. | 95.61 | |
| COG4742 | 260 | Predicted transcriptional regulator [Transcription | 95.59 | |
| PRK11014 | 141 | transcriptional repressor NsrR; Provisional | 95.55 | |
| PF13601 | 80 | HTH_34: Winged helix DNA-binding domain; PDB: 1UB9 | 95.46 | |
| PF08461 | 66 | HTH_12: Ribonuclease R winged-helix domain; InterP | 95.44 | |
| TIGR02702 | 203 | SufR_cyano iron-sulfur cluster biosynthesis transc | 95.37 | |
| TIGR02337 | 118 | HpaR homoprotocatechuate degradation operon regula | 95.36 | |
| PRK06266 | 178 | transcription initiation factor E subunit alpha; V | 95.28 | |
| PRK11050 | 152 | manganese transport regulator MntR; Provisional | 95.22 | |
| smart00418 | 66 | HTH_ARSR helix_turn_helix, Arsenical Resistance Op | 95.15 | |
| PF01726 | 65 | LexA_DNA_bind: LexA DNA binding domain; InterPro: | 95.06 | |
| TIGR01884 | 203 | cas_HTH CRISPR locus-related DNA-binding protein. | 94.98 | |
| COG3355 | 126 | Predicted transcriptional regulator [Transcription | 94.9 | |
| cd00090 | 78 | HTH_ARSR Arsenical Resistance Operon Repressor and | 94.75 | |
| smart00344 | 108 | HTH_ASNC helix_turn_helix ASNC type. AsnC: an auto | 94.69 | |
| PF08279 | 55 | HTH_11: HTH domain; InterPro: IPR013196 Winged hel | 94.68 | |
| COG1321 | 154 | TroR Mn-dependent transcriptional regulator [Trans | 94.58 | |
| PF06163 | 127 | DUF977: Bacterial protein of unknown function (DUF | 94.57 | |
| smart00345 | 60 | HTH_GNTR helix_turn_helix gluconate operon transcr | 94.54 | |
| COG4190 | 144 | Predicted transcriptional regulator [Transcription | 94.34 | |
| PF01638 | 90 | HxlR: HxlR-like helix-turn-helix; InterPro: IPR002 | 94.24 | |
| COG2264 | 300 | PrmA Ribosomal protein L11 methylase [Translation, | 94.23 | |
| PRK10258 | 251 | biotin biosynthesis protein BioC; Provisional | 94.22 | |
| PF07381 | 90 | DUF1495: Winged helix DNA-binding domain (DUF1495) | 94.17 | |
| COG2345 | 218 | Predicted transcriptional regulator [Transcription | 94.05 | |
| TIGR00373 | 158 | conserved hypothetical protein TIGR00373. This fam | 94.0 | |
| COG4189 | 308 | Predicted transcriptional regulator [Transcription | 93.94 | |
| smart00529 | 96 | HTH_DTXR Helix-turn-helix diphteria tox regulatory | 93.91 | |
| PRK06474 | 178 | hypothetical protein; Provisional | 93.9 | |
| cd07377 | 66 | WHTH_GntR Winged helix-turn-helix (WHTH) DNA-bindi | 93.86 | |
| PF04967 | 53 | HTH_10: HTH DNA binding domain; InterPro: IPR00705 | 93.85 | |
| cd07153 | 116 | Fur_like Ferric uptake regulator(Fur) and related | 93.84 | |
| PF00325 | 32 | Crp: Bacterial regulatory proteins, crp family; In | 93.82 | |
| PRK06202 | 232 | hypothetical protein; Provisional | 93.75 | |
| PRK15431 | 78 | ferrous iron transport protein FeoC; Provisional | 93.67 | |
| PF07757 | 112 | AdoMet_MTase: Predicted AdoMet-dependent methyltra | 93.6 | |
| COG2230 | 283 | Cfa Cyclopropane fatty acid synthase and related m | 93.44 | |
| PF14394 | 171 | DUF4423: Domain of unknown function (DUF4423) | 93.35 | |
| PRK00274 | 272 | ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 | 93.31 | |
| PRK07580 | 230 | Mg-protoporphyrin IX methyl transferase; Validated | 93.26 | |
| PF04182 | 75 | B-block_TFIIIC: B-block binding subunit of TFIIIC; | 93.15 | |
| TIGR01610 | 95 | phage_O_Nterm phage replication protein O, N-termi | 93.1 | |
| PF01325 | 60 | Fe_dep_repress: Iron dependent repressor, N-termin | 93.09 | |
| PHA02943 | 165 | hypothetical protein; Provisional | 93.05 | |
| TIGR02752 | 231 | MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone me | 93.03 | |
| PF02353 | 273 | CMAS: Mycolic acid cyclopropane synthetase; InterP | 92.85 | |
| PRK15068 | 322 | tRNA mo(5)U34 methyltransferase; Provisional | 92.79 | |
| PRK11188 | 209 | rrmJ 23S rRNA methyltransferase J; Provisional | 92.66 | |
| PF06325 | 295 | PrmA: Ribosomal protein L11 methyltransferase (Prm | 92.64 | |
| PRK11512 | 144 | DNA-binding transcriptional repressor MarR; Provis | 92.55 | |
| PRK04214 | 412 | rbn ribonuclease BN/unknown domain fusion protein; | 92.5 | |
| PF00392 | 64 | GntR: Bacterial regulatory proteins, gntR family; | 92.45 | |
| PRK11036 | 255 | putative S-adenosyl-L-methionine-dependent methylt | 92.17 | |
| PF02002 | 105 | TFIIE_alpha: TFIIE alpha subunit; InterPro: IPR024 | 92.05 | |
| TIGR00080 | 215 | pimt protein-L-isoaspartate(D-aspartate) O-methylt | 91.94 | |
| COG2813 | 300 | RsmC 16S RNA G1207 methylase RsmC [Translation, ri | 91.88 | |
| COG4976 | 287 | Predicted methyltransferase (contains TPR repeat) | 91.88 | |
| PRK03573 | 144 | transcriptional regulator SlyA; Provisional | 91.86 | |
| PRK11179 | 153 | DNA-binding transcriptional regulator AsnC; Provis | 91.79 | |
| TIGR00452 | 314 | methyltransferase, putative. Known examples to dat | 91.78 | |
| PF08784 | 102 | RPA_C: Replication protein A C terminal; InterPro: | 91.75 | |
| PTZ00098 | 263 | phosphoethanolamine N-methyltransferase; Provision | 91.57 | |
| PF05148 | 219 | Methyltransf_8: Hypothetical methyltransferase; In | 91.52 | |
| PRK11169 | 164 | leucine-responsive transcriptional regulator; Prov | 91.5 | |
| PRK15001 | 378 | SAM-dependent 23S ribosomal RNA mG1835 methyltrans | 91.41 | |
| TIGR01889 | 109 | Staph_reg_Sar staphylococcal accessory regulator f | 91.4 | |
| COG1733 | 120 | Predicted transcriptional regulators [Transcriptio | 91.26 | |
| PRK07402 | 196 | precorrin-6B methylase; Provisional | 91.25 | |
| COG3432 | 95 | Predicted transcriptional regulator [Transcription | 91.2 | |
| PF13545 | 76 | HTH_Crp_2: Crp-like helix-turn-helix domain; PDB: | 91.13 | |
| PRK13944 | 205 | protein-L-isoaspartate O-methyltransferase; Provis | 91.12 | |
| PRK00107 | 187 | gidB 16S rRNA methyltransferase GidB; Reviewed | 91.07 | |
| PLN02244 | 340 | tocopherol O-methyltransferase | 91.06 | |
| PF07789 | 155 | DUF1627: Protein of unknown function (DUF1627); In | 91.02 | |
| PRK14165 | 217 | winged helix-turn-helix domain-containing protein/ | 90.98 | |
| PF10007 | 92 | DUF2250: Uncharacterized protein conserved in arch | 90.84 | |
| TIGR00498 | 199 | lexA SOS regulatory protein LexA. LexA acts as a h | 90.77 | |
| COG1522 | 154 | Lrp Transcriptional regulators [Transcription] | 90.72 | |
| PRK11705 | 383 | cyclopropane fatty acyl phospholipid synthase; Pro | 90.58 | |
| KOG1271 | 227 | consensus Methyltransferases [General function pre | 90.57 | |
| PRK13942 | 212 | protein-L-isoaspartate O-methyltransferase; Provis | 90.53 | |
| PRK12335 | 287 | tellurite resistance protein TehB; Provisional | 90.48 | |
| TIGR03587 | 204 | Pse_Me-ase pseudaminic acid biosynthesis-associate | 90.44 | |
| PRK00121 | 202 | trmB tRNA (guanine-N(7)-)-methyltransferase; Revie | 90.29 | |
| PF03444 | 78 | HrcA_DNA-bdg: Winged helix-turn-helix transcriptio | 90.16 | |
| PRK11639 | 169 | zinc uptake transcriptional repressor; Provisional | 90.0 | |
| COG2512 | 258 | Predicted membrane-associated trancriptional regul | 89.84 | |
| TIGR02147 | 271 | Fsuc_second hypothetical protein, TIGR02147. This | 89.63 | |
| PF09929 | 118 | DUF2161: Uncharacterized conserved protein (DUF216 | 89.63 | |
| PRK13509 | 251 | transcriptional repressor UlaR; Provisional | 89.57 | |
| TIGR00740 | 239 | methyltransferase, putative. A simple BLAST search | 89.57 | |
| COG1378 | 247 | Predicted transcriptional regulators [Transcriptio | 89.48 | |
| PF05732 | 165 | RepL: Firmicute plasmid replication protein (RepL) | 89.42 | |
| COG4565 | 224 | CitB Response regulator of citrate/malate metaboli | 89.33 | |
| PRK11088 | 272 | rrmA 23S rRNA methyltransferase A; Provisional | 89.31 | |
| COG2227 | 243 | UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4- | 89.31 | |
| PLN02336 | 475 | phosphoethanolamine N-methyltransferase | 89.22 | |
| PF12793 | 115 | SgrR_N: Sugar transport-related sRNA regulator N-t | 89.18 | |
| TIGR00406 | 288 | prmA ribosomal protein L11 methyltransferase. Ribo | 89.11 | |
| KOG1541 | 270 | consensus Predicted protein carboxyl methylase [Ge | 89.02 | |
| PF00165 | 42 | HTH_AraC: Bacterial regulatory helix-turn-helix pr | 88.91 | |
| PRK04172 | 489 | pheS phenylalanyl-tRNA synthetase subunit alpha; P | 88.91 | |
| TIGR00138 | 181 | gidB 16S rRNA methyltransferase GidB. GidB (glucos | 88.77 | |
| PRK05785 | 226 | hypothetical protein; Provisional | 88.64 | |
| PRK05638 | 442 | threonine synthase; Validated | 88.51 | |
| PRK09489 | 342 | rsmC 16S ribosomal RNA m2G1207 methyltransferase; | 88.43 | |
| KOG2899 | 288 | consensus Predicted methyltransferase [General fun | 88.37 | |
| PRK15451 | 247 | tRNA cmo(5)U34 methyltransferase; Provisional | 88.26 | |
| PLN02233 | 261 | ubiquinone biosynthesis methyltransferase | 88.22 | |
| smart00138 | 264 | MeTrc Methyltransferase, chemotaxis proteins. Meth | 88.2 | |
| PF08003 | 315 | Methyltransf_9: Protein of unknown function (DUF16 | 88.2 | |
| PF13404 | 42 | HTH_AsnC-type: AsnC-type helix-turn-helix domain; | 88.17 | |
| COG1497 | 260 | Predicted transcriptional regulator [Transcription | 88.16 | |
| PF13730 | 55 | HTH_36: Helix-turn-helix domain | 88.09 | |
| PRK00216 | 239 | ubiE ubiquinone/menaquinone biosynthesis methyltra | 88.08 | |
| COG5631 | 199 | Predicted transcription regulator, contains HTH do | 87.99 | |
| PF02796 | 45 | HTH_7: Helix-turn-helix domain of resolvase; Inter | 87.84 | |
| TIGR03438 | 301 | probable methyltransferase. This model represents | 87.75 | |
| TIGR00478 | 228 | tly hemolysin TlyA family protein. Hemolysins are | 87.71 | |
| PRK04266 | 226 | fibrillarin; Provisional | 87.62 | |
| PRK00377 | 198 | cbiT cobalt-precorrin-6Y C(15)-methyltransferase; | 87.59 | |
| TIGR03534 | 251 | RF_mod_PrmC protein-(glutamine-N5) methyltransfera | 87.58 | |
| PRK00517 | 250 | prmA ribosomal protein L11 methyltransferase; Revi | 87.37 | |
| COG2226 | 238 | UbiE Methylase involved in ubiquinone/menaquinone | 87.36 | |
| PRK05134 | 233 | bifunctional 3-demethylubiquinone-9 3-methyltransf | 87.01 | |
| PRK00312 | 212 | pcm protein-L-isoaspartate O-methyltransferase; Re | 86.96 | |
| PLN02396 | 322 | hexaprenyldihydroxybenzoate methyltransferase | 86.94 | |
| PRK14121 | 390 | tRNA (guanine-N(7)-)-methyltransferase; Provisiona | 86.86 | |
| PRK10411 | 240 | DNA-binding transcriptional activator FucR; Provis | 86.86 | |
| PF13384 | 50 | HTH_23: Homeodomain-like domain; PDB: 2X48_C. | 86.81 | |
| PRK09328 | 275 | N5-glutamine S-adenosyl-L-methionine-dependent met | 86.81 | |
| PRK00215 | 205 | LexA repressor; Validated | 86.32 | |
| PLN02585 | 315 | magnesium protoporphyrin IX methyltransferase | 86.15 | |
| COG2890 | 280 | HemK Methylase of polypeptide chain release factor | 86.07 | |
| PRK10906 | 252 | DNA-binding transcriptional repressor GlpR; Provis | 86.06 | |
| PRK09802 | 269 | DNA-binding transcriptional regulator AgaR; Provis | 85.99 | |
| TIGR03704 | 251 | PrmC_rel_meth putative protein-(glutamine-N5) meth | 85.97 | |
| COG4123 | 248 | Predicted O-methyltransferase [General function pr | 85.92 | |
| PRK11886 | 319 | bifunctional biotin--[acetyl-CoA-carboxylase] synt | 85.85 | |
| PRK10434 | 256 | srlR DNA-bindng transcriptional repressor SrlR; Pr | 85.69 | |
| PF12324 | 77 | HTH_15: Helix-turn-helix domain of alkylmercury ly | 85.67 | |
| PF05584 | 72 | Sulfolobus_pRN: Sulfolobus plasmid regulatory prot | 85.66 | |
| PRK10870 | 176 | transcriptional repressor MprA; Provisional | 85.59 | |
| PF01209 | 233 | Ubie_methyltran: ubiE/COQ5 methyltransferase famil | 85.42 | |
| PF08221 | 62 | HTH_9: RNA polymerase III subunit RPC82 helix-turn | 85.38 | |
| COG1846 | 126 | MarR Transcriptional regulators [Transcription] | 85.14 | |
| PF02319 | 71 | E2F_TDP: E2F/DP family winged-helix DNA-binding do | 85.09 | |
| PRK00811 | 283 | spermidine synthase; Provisional | 85.03 | |
| PF01475 | 120 | FUR: Ferric uptake regulator family; InterPro: IPR | 84.81 | |
| PRK10046 | 225 | dpiA two-component response regulator DpiA; Provis | 84.58 | |
| PLN02366 | 308 | spermidine synthase | 84.54 | |
| PF01135 | 209 | PCMT: Protein-L-isoaspartate(D-aspartate) O-methyl | 84.51 | |
| PLN02853 | 492 | Probable phenylalanyl-tRNA synthetase alpha chain | 84.32 | |
| PRK13943 | 322 | protein-L-isoaspartate O-methyltransferase; Provis | 83.97 | |
| PHA02701 | 183 | ORF020 dsRNA-binding PKR inhibitor; Provisional | 83.93 | |
| COG1349 | 253 | GlpR Transcriptional regulators of sugar metabolis | 83.91 | |
| PF05185 | 448 | PRMT5: PRMT5 arginine-N-methyltransferase; InterPr | 83.83 | |
| PF13518 | 52 | HTH_28: Helix-turn-helix domain | 83.67 | |
| PRK13168 | 443 | rumA 23S rRNA m(5)U1939 methyltransferase; Reviewe | 83.58 | |
| PRK11534 | 224 | DNA-binding transcriptional regulator CsiR; Provis | 83.48 | |
| KOG1270 | 282 | consensus Methyltransferases [Coenzyme transport a | 83.44 | |
| COG2263 | 198 | Predicted RNA methylase [Translation, ribosomal st | 83.22 | |
| KOG3115 | 249 | consensus Methyltransferase-like protein [General | 82.91 | |
| TIGR03533 | 284 | L3_gln_methyl protein-(glutamine-N5) methyltransfe | 82.8 | |
| TIGR02787 | 251 | codY_Gpos GTP-sensing transcriptional pleiotropic | 82.72 | |
| COG3413 | 215 | Predicted DNA binding protein [General function pr | 82.71 | |
| COG1802 | 230 | GntR Transcriptional regulators [Transcription] | 82.57 | |
| smart00531 | 147 | TFIIE Transcription initiation factor IIE. | 82.46 | |
| PF03141 | 506 | Methyltransf_29: Putative S-adenosyl-L-methionine- | 82.45 | |
| TIGR00536 | 284 | hemK_fam HemK family putative methylases. The gene | 82.35 | |
| PRK13777 | 185 | transcriptional regulator Hpr; Provisional | 82.12 | |
| PF08123 | 205 | DOT1: Histone methylation protein DOT1 ; InterPro: | 82.05 | |
| PRK09775 | 442 | putative DNA-binding transcriptional regulator; Pr | 81.84 | |
| PTZ00326 | 494 | phenylalanyl-tRNA synthetase alpha chain; Provisio | 81.82 | |
| PF09904 | 90 | HTH_43: Winged helix-turn helix; InterPro: IPR0171 | 81.71 | |
| COG1510 | 177 | Predicted transcriptional regulators [Transcriptio | 81.71 | |
| KOG2904 | 328 | consensus Predicted methyltransferase [General fun | 81.58 | |
| PF02295 | 66 | z-alpha: Adenosine deaminase z-alpha domain; Inter | 81.39 | |
| PHA02591 | 83 | hypothetical protein; Provisional | 81.25 | |
| TIGR03338 | 212 | phnR_burk phosphonate utilization associated trans | 81.23 | |
| PLN02490 | 340 | MPBQ/MSBQ methyltransferase | 81.19 | |
| COG2518 | 209 | Pcm Protein-L-isoaspartate carboxylmethyltransfera | 80.95 | |
| COG1675 | 176 | TFA1 Transcription initiation factor IIE, alpha su | 80.89 | |
| PRK12423 | 202 | LexA repressor; Provisional | 80.88 | |
| TIGR01321 | 94 | TrpR trp operon repressor, proteobacterial. This m | 80.7 | |
| PRK11642 | 813 | exoribonuclease R; Provisional | 80.37 | |
| PRK10909 | 199 | rsmD 16S rRNA m(2)G966-methyltransferase; Provisio | 80.18 |
| >KOG3178 consensus Hydroxyindole-O-methyltransferase and related SAM-dependent methyltransferases [General function prediction only] | Back alignment and domain information |
|---|
Probab=99.91 E-value=1.3e-23 Score=176.20 Aligned_cols=191 Identities=46% Similarity=0.792 Sum_probs=169.1
Q ss_pred chHHHHHHHHHhhchHHHHHHHHHhhChhhHHhhcCCCCCCCHHHHHHHhcC-CCCCCcccHHHHHHHHhcccceeeecc
Q 036188 10 DQSFAYADQLATGVVLPMAIQAVYELGIFEILDKAGPGTKLSASDIAAQLLT-KNKDAPMMLDRILRLLASYSVVECSLD 88 (210)
Q Consensus 10 ~~~~~~l~~~~~~~~~~~al~~a~~lglfd~L~~~g~~~~~t~~eLA~~~~~-~~~~~~~~l~rlLr~L~~~gl~~~~~~ 88 (210)
.++..++++++.++..++++.+|+||||||+|+.++ + ..|||..+-. +++.+|..++|+||.|++.+++++..
T Consensus 4 ~~~~l~~~~l~~~~~~~~~lk~A~eL~v~d~l~~~~---~--p~~ia~~l~~~~~~~~p~ll~r~lr~L~s~~i~k~~~- 77 (342)
T KOG3178|consen 4 NEASLRAMRLANGFALPMVLKAACELGVFDILANAG---S--PSEIASLLPTPKNPEAPVLLDRILRLLVSYSILKCRL- 77 (342)
T ss_pred hHHHHHHHHHHhhhhhHHHHHHHHHcChHHHHHhCC---C--HHHHHHhccCCCCCCChhHHHHHHHHHHHhhhceeee-
Confidence 456678999999999999999999999999999964 2 8888888773 46668999999999999999999873
Q ss_pred CCCccc--ceeccccccccccCCCCCChHHHHHHhcChhHHHHHhhHHHHHhcCCchhhhhhCCchhHhhccCchHHHHH
Q 036188 89 ASGARR--LYSLNSVSKYYVPNKDGVLLGPLIQIIQDKVILESWSQLKDAILEGGIPFNRAHGVHIFEYAGLNPRFNKHF 166 (210)
Q Consensus 89 ~~~~~~--~y~~t~~s~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~L~~~l~~g~~~f~~~~g~~~fe~l~~~p~~~~~f 166 (210)
.+ .|.++|.++++.++....++.+++...+.+..++.|.++.++++.+..+|..++|...|+|...++.....|
T Consensus 78 ----~~~~~Y~~~~~~~~~l~~~~~~S~a~~~~~~~~~v~~~~w~~l~dai~eg~~~~~~~~G~~l~~~~~~~~~~~~~~ 153 (342)
T KOG3178|consen 78 ----VGGEVYSATPVCKYFLKDSGGGSLAPLVLLNTSKVIMNTWQFLKDAILEGGDAFATAHGMMLGGYGGADERFSKDF 153 (342)
T ss_pred ----ecceeeeccchhhhheecCCCCchhHHHHHhcccchhhhHHHHHHHHHhcccCCccccchhhhhhcccccccHHHH
Confidence 33 899999999776444346899999888888899999999999999999999999988999999999999999
Q ss_pred HHHHhhhhhhhHHHHHHhCCCCCCCCeEEEecCCccHHHHhhhC
Q 036188 167 NAAMYNYTSLVMSNILESYKGFDNIKQLVDVGGSLGVTLQAITT 210 (210)
Q Consensus 167 ~~~M~~~~~~~~~~~l~~~~~~~~~~~vvDiGGg~G~~~~~l~~ 210 (210)
+++|...+....+.+++.|.+|++...+||||||.|..+..+++
T Consensus 154 ~~sm~~l~~~~~~~il~~~~Gf~~v~~avDvGgGiG~v~k~ll~ 197 (342)
T KOG3178|consen 154 NGSMSFLSTLVMKKILEVYTGFKGVNVAVDVGGGIGRVLKNLLS 197 (342)
T ss_pred HHHHHHHHHHHHHhhhhhhcccccCceEEEcCCcHhHHHHHHHH
Confidence 99999999998889999998899999999999999999988763
|
|
| >TIGR02716 C20_methyl_CrtF C-20 methyltransferase BchU | Back alignment and domain information |
|---|
| >PF00891 Methyltransf_2: O-methyltransferase; InterPro: IPR001077 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals | Back alignment and domain information |
|---|
| >PF08100 Dimerisation: Dimerisation domain; InterPro: IPR012967 This domain is found at the N terminus of a variety of plant O-methyltransferases | Back alignment and domain information |
|---|
| >PF09339 HTH_IclR: IclR helix-turn-helix domain; InterPro: IPR005471 The many bacterial transcription regulation proteins which bind DNA through a 'helix-turn-helix' motif can be classified into subfamilies on the basis of sequence similarities | Back alignment and domain information |
|---|
| >smart00346 HTH_ICLR helix_turn_helix isocitrate lyase regulation | Back alignment and domain information |
|---|
| >smart00550 Zalpha Z-DNA-binding domain in adenosine deaminases | Back alignment and domain information |
|---|
| >COG1414 IclR Transcriptional regulator [Transcription] | Back alignment and domain information |
|---|
| >PF02082 Rrf2: Transcriptional regulator; InterPro: IPR000944 The following uncharacterised bacterial proteins have been shown to be evolutionary related, Desulfovibrio vulgaris protein Rrf2; Escherichia coli hypothetical proteins yfhP and yjeB; Bacillus subtilis hypothetical proteins yhdE, yrzC and ywgB; Mycobacterium tuberculosis hypothetical protein Rv1287; and Synechocystis sp | Back alignment and domain information |
|---|
| >PF12840 HTH_20: Helix-turn-helix domain; PDB: 1ULY_A 2CWE_A 1Y0U_B 2QUF_B 2QLZ_C 2OQG_B 2ZKZ_C 3PQK_A 3PQJ_D 3F6O_B | Back alignment and domain information |
|---|
| >TIGR02431 pcaR_pcaU beta-ketoadipate pathway transcriptional regulators, PcaR/PcaU/PobR family | Back alignment and domain information |
|---|
| >PRK11569 transcriptional repressor IclR; Provisional | Back alignment and domain information |
|---|
| >PRK10163 DNA-binding transcriptional repressor AllR; Provisional | Back alignment and domain information |
|---|
| >PF01022 HTH_5: Bacterial regulatory protein, arsR family; InterPro: IPR001845 Bacterial transcription regulatory proteins that bind DNA via a helix-turn-helix (HTH) motif can be grouped into families on the basis of sequence similarities | Back alignment and domain information |
|---|
| >PRK09834 DNA-binding transcriptional activator MhpR; Provisional | Back alignment and domain information |
|---|
| >PF13412 HTH_24: Winged helix-turn-helix DNA-binding; PDB: 1I1G_B 2IA0_B 3I4P_A 2GQQ_A 2L4A_A 2CFX_B 2DBB_B 2EFO_A 2EFQ_A 2PN6_A | Back alignment and domain information |
|---|
| >PRK15090 DNA-binding transcriptional regulator KdgR; Provisional | Back alignment and domain information |
|---|
| >PRK10857 DNA-binding transcriptional regulator IscR; Provisional | Back alignment and domain information |
|---|
| >PF04703 FaeA: FaeA-like protein; PDB: 2JT1_A 2HTJ_A | Back alignment and domain information |
|---|
| >cd00092 HTH_CRP helix_turn_helix, cAMP Regulatory protein C-terminus; DNA binding domain of prokaryotic regulatory proteins belonging to the catabolite activator protein family | Back alignment and domain information |
|---|
| >PRK10141 DNA-binding transcriptional repressor ArsR; Provisional | Back alignment and domain information |
|---|
| >smart00419 HTH_CRP helix_turn_helix, cAMP Regulatory protein | Back alignment and domain information |
|---|
| >PF01978 TrmB: Sugar-specific transcriptional regulator TrmB; InterPro: IPR002831 TrmB, is a protein of 38,800 apparent molecular weight, that is involved in the maltose-specific regulation of the trehalose/maltose ABC transport operon in Thermococcus litoralis | Back alignment and domain information |
|---|
| >PRK06922 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >COG1959 Predicted transcriptional regulator [Transcription] | Back alignment and domain information |
|---|
| >TIGR02010 IscR iron-sulfur cluster assembly transcription factor IscR | Back alignment and domain information |
|---|
| >PF09012 FeoC: FeoC like transcriptional regulator; InterPro: IPR015102 This entry contains several transcriptional regulators, including FeoC, which contain a HTH motif | Back alignment and domain information |
|---|
| >PF14947 HTH_45: Winged helix-turn-helix; PDB: 1XSX_B 1R7J_A | Back alignment and domain information |
|---|
| >TIGR00738 rrf2_super rrf2 family protein (putative transcriptional regulator) | Back alignment and domain information |
|---|
| >PF13463 HTH_27: Winged helix DNA-binding domain; PDB: 3GFL_A 2YR2_B 3GFM_A 3GFJ_A 3GF2_A 3GEZ_A 2GXG_A 3GFI_A 2EB7_A | Back alignment and domain information |
|---|
| >PF12802 MarR_2: MarR family; PDB: 3ECO_B 2QWW_B 3KP6_B 3KP4_B 3KP2_A 3KP5_A 3KP3_B 3KP7_A 3NQO_B 3K0L_B | Back alignment and domain information |
|---|
| >TIGR02021 BchM-ChlM magnesium protoporphyrin O-methyltransferase | Back alignment and domain information |
|---|
| >TIGR02944 suf_reg_Xantho FeS assembly SUF system regulator, gammaproteobacterial | Back alignment and domain information |
|---|
| >smart00347 HTH_MARR helix_turn_helix multiple antibiotic resistance protein | Back alignment and domain information |
|---|
| >PRK11920 rirA iron-responsive transcriptional regulator; Reviewed | Back alignment and domain information |
|---|
| >smart00420 HTH_DEOR helix_turn_helix, Deoxyribose operon repressor | Back alignment and domain information |
|---|
| >PRK03902 manganese transport transcriptional regulator; Provisional | Back alignment and domain information |
|---|
| >PF08220 HTH_DeoR: DeoR-like helix-turn-helix domain; InterPro: IPR001034 The deoR-type HTH domain is a DNA-binding, helix-turn-helix (HTH) domain of about 50-60 amino acids present in transcription regulators of the deoR family, involved in sugar catabolism | Back alignment and domain information |
|---|
| >PF01047 MarR: MarR family; InterPro: IPR000835 The MarR-type HTH domain is a DNA-binding, winged helix-turn-helix (wHTH) domain of about 135 amino acids present in transcription regulators of the MarR/SlyA family, involved in the development of antibiotic resistance | Back alignment and domain information |
|---|
| >PHA00738 putative HTH transcription regulator | Back alignment and domain information |
|---|
| >TIGR00122 birA_repr_reg BirA biotin operon repressor domain | Back alignment and domain information |
|---|
| >COG4742 Predicted transcriptional regulator [Transcription] | Back alignment and domain information |
|---|
| >PRK11014 transcriptional repressor NsrR; Provisional | Back alignment and domain information |
|---|
| >PF13601 HTH_34: Winged helix DNA-binding domain; PDB: 1UB9_A | Back alignment and domain information |
|---|
| >PF08461 HTH_12: Ribonuclease R winged-helix domain; InterPro: IPR013668 This domain is found at the amino terminus of Ribonuclease R and a number of presumed transcriptional regulatory proteins from archaea | Back alignment and domain information |
|---|
| >TIGR02702 SufR_cyano iron-sulfur cluster biosynthesis transcriptional regulator SufR | Back alignment and domain information |
|---|
| >TIGR02337 HpaR homoprotocatechuate degradation operon regulator, HpaR | Back alignment and domain information |
|---|
| >PRK06266 transcription initiation factor E subunit alpha; Validated | Back alignment and domain information |
|---|
| >PRK11050 manganese transport regulator MntR; Provisional | Back alignment and domain information |
|---|
| >smart00418 HTH_ARSR helix_turn_helix, Arsenical Resistance Operon Repressor | Back alignment and domain information |
|---|
| >PF01726 LexA_DNA_bind: LexA DNA binding domain; InterPro: IPR006199 This is the DNA binding domain of the LexA SOS regulon repressor which prevents expression of DNA repair proteins in bacteria | Back alignment and domain information |
|---|
| >TIGR01884 cas_HTH CRISPR locus-related DNA-binding protein | Back alignment and domain information |
|---|
| >COG3355 Predicted transcriptional regulator [Transcription] | Back alignment and domain information |
|---|
| >cd00090 HTH_ARSR Arsenical Resistance Operon Repressor and similar prokaryotic, metal regulated homodimeric repressors | Back alignment and domain information |
|---|
| >smart00344 HTH_ASNC helix_turn_helix ASNC type | Back alignment and domain information |
|---|
| >PF08279 HTH_11: HTH domain; InterPro: IPR013196 Winged helix DNA-binding proteins share a related winged helix-turn-helix DNA-binding motif, where the "wings", or loops, are small beta-sheets | Back alignment and domain information |
|---|
| >COG1321 TroR Mn-dependent transcriptional regulator [Transcription] | Back alignment and domain information |
|---|
| >PF06163 DUF977: Bacterial protein of unknown function (DUF977); InterPro: IPR010382 This entry consists of several hypothetical bacterial proteins of unknown function | Back alignment and domain information |
|---|
| >smart00345 HTH_GNTR helix_turn_helix gluconate operon transcriptional repressor | Back alignment and domain information |
|---|
| >COG4190 Predicted transcriptional regulator [Transcription] | Back alignment and domain information |
|---|
| >PF01638 HxlR: HxlR-like helix-turn-helix; InterPro: IPR002577 The hxlR-type HTH domain is a domain of ~90-100 amino acids present in putative transcription regulators with a winged helix-turn-helix (wHTH) structure | Back alignment and domain information |
|---|
| >COG2264 PrmA Ribosomal protein L11 methylase [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PRK10258 biotin biosynthesis protein BioC; Provisional | Back alignment and domain information |
|---|
| >PF07381 DUF1495: Winged helix DNA-binding domain (DUF1495); InterPro: IPR010863 This family consists of several hypothetical archaeal proteins of around 110 residues in length | Back alignment and domain information |
|---|
| >COG2345 Predicted transcriptional regulator [Transcription] | Back alignment and domain information |
|---|
| >TIGR00373 conserved hypothetical protein TIGR00373 | Back alignment and domain information |
|---|
| >COG4189 Predicted transcriptional regulator [Transcription] | Back alignment and domain information |
|---|
| >smart00529 HTH_DTXR Helix-turn-helix diphteria tox regulatory element | Back alignment and domain information |
|---|
| >PRK06474 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd07377 WHTH_GntR Winged helix-turn-helix (WHTH) DNA-binding domain of the GntR family of transcriptional regulators | Back alignment and domain information |
|---|
| >PF04967 HTH_10: HTH DNA binding domain; InterPro: IPR007050 Numerous bacterial transcription regulatory proteins bind DNA via a helix-turn-helix (HTH) motif | Back alignment and domain information |
|---|
| >cd07153 Fur_like Ferric uptake regulator(Fur) and related metalloregulatory proteins; typically iron-dependent, DNA-binding repressors and activators | Back alignment and domain information |
|---|
| >PF00325 Crp: Bacterial regulatory proteins, crp family; InterPro: IPR001808 Numerous bacterial transcription regulatory proteins bind DNA via a helix-turn-helix (HTH) motif | Back alignment and domain information |
|---|
| >PRK06202 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK15431 ferrous iron transport protein FeoC; Provisional | Back alignment and domain information |
|---|
| >PF07757 AdoMet_MTase: Predicted AdoMet-dependent methyltransferase; InterPro: IPR011671 tRNA (uracil-O(2)-)-methyltransferase catalyses the formation of O(2)-methyl-uracil at position 44 (m2U44) in tRNA(Ser) [] | Back alignment and domain information |
|---|
| >COG2230 Cfa Cyclopropane fatty acid synthase and related methyltransferases [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >PF14394 DUF4423: Domain of unknown function (DUF4423) | Back alignment and domain information |
|---|
| >PRK00274 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 family protein; Reviewed | Back alignment and domain information |
|---|
| >PRK07580 Mg-protoporphyrin IX methyl transferase; Validated | Back alignment and domain information |
|---|
| >PF04182 B-block_TFIIIC: B-block binding subunit of TFIIIC; InterPro: IPR007309 Yeast transcription factor IIIC (TFIIIC) is a multisubunit protein complex that interacts with two control elements of class III promoters called the A and B blocks | Back alignment and domain information |
|---|
| >TIGR01610 phage_O_Nterm phage replication protein O, N-terminal domain | Back alignment and domain information |
|---|
| >PF01325 Fe_dep_repress: Iron dependent repressor, N-terminal DNA binding domain; InterPro: IPR022687 The DtxR-type HTH domain is a DNA-binding, winged helix-turn-helix (wHTH) domain of about 65 residues present in metalloregulators of the DtxR/MntR family | Back alignment and domain information |
|---|
| >PHA02943 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02752 MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone methyltransferase | Back alignment and domain information |
|---|
| >PF02353 CMAS: Mycolic acid cyclopropane synthetase; InterPro: IPR003333 This entry represents mycolic acid cyclopropane synthases and related enzymes, including CmaA1, CmaA2 (cyclopropane mycolic acid synthase A1 and A2) and MmaA1-4 (methoxymycolic acid synthase A1-4) | Back alignment and domain information |
|---|
| >PRK15068 tRNA mo(5)U34 methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK11188 rrmJ 23S rRNA methyltransferase J; Provisional | Back alignment and domain information |
|---|
| >PF06325 PrmA: Ribosomal protein L11 methyltransferase (PrmA); InterPro: IPR010456 This family consists of several Ribosomal protein L11 methyltransferase sequences | Back alignment and domain information |
|---|
| >PRK11512 DNA-binding transcriptional repressor MarR; Provisional | Back alignment and domain information |
|---|
| >PRK04214 rbn ribonuclease BN/unknown domain fusion protein; Reviewed | Back alignment and domain information |
|---|
| >PF00392 GntR: Bacterial regulatory proteins, gntR family; InterPro: IPR000524 Many bacterial transcription regulation proteins bind DNA through a helix-turn-helix (HTH) motif, which can be classified into subfamilies on the basis of sequence similarities | Back alignment and domain information |
|---|
| >PRK11036 putative S-adenosyl-L-methionine-dependent methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PF02002 TFIIE_alpha: TFIIE alpha subunit; InterPro: IPR024550 The general transcription factor TFIIE has an essential role in eukaryotic transcription initiation, together with RNA polymerase II and other general factors | Back alignment and domain information |
|---|
| >TIGR00080 pimt protein-L-isoaspartate(D-aspartate) O-methyltransferase | Back alignment and domain information |
|---|
| >COG2813 RsmC 16S RNA G1207 methylase RsmC [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only] | Back alignment and domain information |
|---|
| >PRK03573 transcriptional regulator SlyA; Provisional | Back alignment and domain information |
|---|
| >PRK11179 DNA-binding transcriptional regulator AsnC; Provisional | Back alignment and domain information |
|---|
| >TIGR00452 methyltransferase, putative | Back alignment and domain information |
|---|
| >PF08784 RPA_C: Replication protein A C terminal; InterPro: IPR014892 This protein corresponds to the C-terminal of the single stranded DNA binding protein RPA (replication protein A) | Back alignment and domain information |
|---|
| >PTZ00098 phosphoethanolamine N-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PF05148 Methyltransf_8: Hypothetical methyltransferase; InterPro: IPR007823 This family consists of uncharacterised eukaryotic proteins which are related to S-adenosyl-L-methionine-dependent methyltransferases | Back alignment and domain information |
|---|
| >PRK11169 leucine-responsive transcriptional regulator; Provisional | Back alignment and domain information |
|---|
| >PRK15001 SAM-dependent 23S ribosomal RNA mG1835 methyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR01889 Staph_reg_Sar staphylococcal accessory regulator family | Back alignment and domain information |
|---|
| >COG1733 Predicted transcriptional regulators [Transcription] | Back alignment and domain information |
|---|
| >PRK07402 precorrin-6B methylase; Provisional | Back alignment and domain information |
|---|
| >COG3432 Predicted transcriptional regulator [Transcription] | Back alignment and domain information |
|---|
| >PF13545 HTH_Crp_2: Crp-like helix-turn-helix domain; PDB: 3LA2_A 3LA3_B 3LA7_A 3B02_A 3E97_A 2H6C_B 1OMI_A 2BGC_H 2BEO_A 2GAU_A | Back alignment and domain information |
|---|
| >PRK13944 protein-L-isoaspartate O-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK00107 gidB 16S rRNA methyltransferase GidB; Reviewed | Back alignment and domain information |
|---|
| >PLN02244 tocopherol O-methyltransferase | Back alignment and domain information |
|---|
| >PF07789 DUF1627: Protein of unknown function (DUF1627); InterPro: IPR012432 This is a group of sequences found in hypothetical proteins predicted to be expressed in a number of bacterial species | Back alignment and domain information |
|---|
| >PRK14165 winged helix-turn-helix domain-containing protein/riboflavin kinase; Provisional | Back alignment and domain information |
|---|
| >PF10007 DUF2250: Uncharacterized protein conserved in archaea (DUF2250); InterPro: IPR019254 Members of this family of hypothetical archaeal proteins have no known function | Back alignment and domain information |
|---|
| >TIGR00498 lexA SOS regulatory protein LexA | Back alignment and domain information |
|---|
| >COG1522 Lrp Transcriptional regulators [Transcription] | Back alignment and domain information |
|---|
| >PRK11705 cyclopropane fatty acyl phospholipid synthase; Provisional | Back alignment and domain information |
|---|
| >KOG1271 consensus Methyltransferases [General function prediction only] | Back alignment and domain information |
|---|
| >PRK13942 protein-L-isoaspartate O-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK12335 tellurite resistance protein TehB; Provisional | Back alignment and domain information |
|---|
| >TIGR03587 Pse_Me-ase pseudaminic acid biosynthesis-associated methylase | Back alignment and domain information |
|---|
| >PRK00121 trmB tRNA (guanine-N(7)-)-methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >PF03444 HrcA_DNA-bdg: Winged helix-turn-helix transcription repressor, HrcA DNA-binding; InterPro: IPR005104 Prokaryotic cells have a defence mechanism against a sudden heat-shock stress | Back alignment and domain information |
|---|
| >PRK11639 zinc uptake transcriptional repressor; Provisional | Back alignment and domain information |
|---|
| >COG2512 Predicted membrane-associated trancriptional regulator [Transcription] | Back alignment and domain information |
|---|
| >TIGR02147 Fsuc_second hypothetical protein, TIGR02147 | Back alignment and domain information |
|---|
| >PF09929 DUF2161: Uncharacterized conserved protein (DUF2161); InterPro: IPR018679 This family of various hypothetical prokaryotic proteins has no known function | Back alignment and domain information |
|---|
| >PRK13509 transcriptional repressor UlaR; Provisional | Back alignment and domain information |
|---|
| >TIGR00740 methyltransferase, putative | Back alignment and domain information |
|---|
| >COG1378 Predicted transcriptional regulators [Transcription] | Back alignment and domain information |
|---|
| >PF05732 RepL: Firmicute plasmid replication protein (RepL); InterPro: IPR008813 This entry consists of proteins thought to be involved in plasmid replication | Back alignment and domain information |
|---|
| >COG4565 CitB Response regulator of citrate/malate metabolism [Transcription / Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK11088 rrmA 23S rRNA methyltransferase A; Provisional | Back alignment and domain information |
|---|
| >COG2227 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PLN02336 phosphoethanolamine N-methyltransferase | Back alignment and domain information |
|---|
| >PF12793 SgrR_N: Sugar transport-related sRNA regulator N-term | Back alignment and domain information |
|---|
| >TIGR00406 prmA ribosomal protein L11 methyltransferase | Back alignment and domain information |
|---|
| >KOG1541 consensus Predicted protein carboxyl methylase [General function prediction only] | Back alignment and domain information |
|---|
| >PF00165 HTH_AraC: Bacterial regulatory helix-turn-helix proteins, AraC family; PDB: 1WPK_A 1ZGW_A 1U8B_A | Back alignment and domain information |
|---|
| >PRK04172 pheS phenylalanyl-tRNA synthetase subunit alpha; Provisional | Back alignment and domain information |
|---|
| >TIGR00138 gidB 16S rRNA methyltransferase GidB | Back alignment and domain information |
|---|
| >PRK05785 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK05638 threonine synthase; Validated | Back alignment and domain information |
|---|
| >PRK09489 rsmC 16S ribosomal RNA m2G1207 methyltransferase; Provisional | Back alignment and domain information |
|---|
| >KOG2899 consensus Predicted methyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK15451 tRNA cmo(5)U34 methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PLN02233 ubiquinone biosynthesis methyltransferase | Back alignment and domain information |
|---|
| >smart00138 MeTrc Methyltransferase, chemotaxis proteins | Back alignment and domain information |
|---|
| >PF08003 Methyltransf_9: Protein of unknown function (DUF1698); InterPro: IPR010017 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals | Back alignment and domain information |
|---|
| >PF13404 HTH_AsnC-type: AsnC-type helix-turn-helix domain; PDB: 2ZNY_E 2ZNZ_G 1RI7_A 2CYY_A 2E1C_A 2VC1_B 2QZ8_A 2W29_C 2IVM_B 2VBX_B | Back alignment and domain information |
|---|
| >COG1497 Predicted transcriptional regulator [Transcription] | Back alignment and domain information |
|---|
| >PF13730 HTH_36: Helix-turn-helix domain | Back alignment and domain information |
|---|
| >PRK00216 ubiE ubiquinone/menaquinone biosynthesis methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >COG5631 Predicted transcription regulator, contains HTH domain (MarR family) [Transcription] | Back alignment and domain information |
|---|
| >PF02796 HTH_7: Helix-turn-helix domain of resolvase; InterPro: IPR006120 Site-specific recombination plays an important role in DNA rearrangement in prokaryotic organisms | Back alignment and domain information |
|---|
| >TIGR03438 probable methyltransferase | Back alignment and domain information |
|---|
| >TIGR00478 tly hemolysin TlyA family protein | Back alignment and domain information |
|---|
| >PRK04266 fibrillarin; Provisional | Back alignment and domain information |
|---|
| >PRK00377 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR03534 RF_mod_PrmC protein-(glutamine-N5) methyltransferase, release factor-specific | Back alignment and domain information |
|---|
| >PRK00517 prmA ribosomal protein L11 methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >COG2226 UbiE Methylase involved in ubiquinone/menaquinone biosynthesis [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PRK05134 bifunctional 3-demethylubiquinone-9 3-methyltransferase/ 2-octaprenyl-6-hydroxy phenol methylase; Provisional | Back alignment and domain information |
|---|
| >PRK00312 pcm protein-L-isoaspartate O-methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >PLN02396 hexaprenyldihydroxybenzoate methyltransferase | Back alignment and domain information |
|---|
| >PRK14121 tRNA (guanine-N(7)-)-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK10411 DNA-binding transcriptional activator FucR; Provisional | Back alignment and domain information |
|---|
| >PF13384 HTH_23: Homeodomain-like domain; PDB: 2X48_C | Back alignment and domain information |
|---|
| >PRK09328 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK00215 LexA repressor; Validated | Back alignment and domain information |
|---|
| >PLN02585 magnesium protoporphyrin IX methyltransferase | Back alignment and domain information |
|---|
| >COG2890 HemK Methylase of polypeptide chain release factors [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PRK10906 DNA-binding transcriptional repressor GlpR; Provisional | Back alignment and domain information |
|---|
| >PRK09802 DNA-binding transcriptional regulator AgaR; Provisional | Back alignment and domain information |
|---|
| >TIGR03704 PrmC_rel_meth putative protein-(glutamine-N5) methyltransferase, unknown substrate-specific | Back alignment and domain information |
|---|
| >COG4123 Predicted O-methyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK11886 bifunctional biotin--[acetyl-CoA-carboxylase] synthetase/biotin operon repressor; Provisional | Back alignment and domain information |
|---|
| >PRK10434 srlR DNA-bindng transcriptional repressor SrlR; Provisional | Back alignment and domain information |
|---|
| >PF12324 HTH_15: Helix-turn-helix domain of alkylmercury lyase; InterPro: IPR024259 Alkylmercury lyase (EC:4 | Back alignment and domain information |
|---|
| >PF05584 Sulfolobus_pRN: Sulfolobus plasmid regulatory protein; InterPro: IPR008848 This family consists of several plasmid regulatory proteins from the extreme thermophilic and acidophilic archaea Sulfolobus | Back alignment and domain information |
|---|
| >PRK10870 transcriptional repressor MprA; Provisional | Back alignment and domain information |
|---|
| >PF01209 Ubie_methyltran: ubiE/COQ5 methyltransferase family; InterPro: IPR004033 A number of methyltransferases have been shown to share regions of similarities [] | Back alignment and domain information |
|---|
| >PF08221 HTH_9: RNA polymerase III subunit RPC82 helix-turn-helix domain; InterPro: IPR013197 DNA-directed RNA polymerases 2 | Back alignment and domain information |
|---|
| >COG1846 MarR Transcriptional regulators [Transcription] | Back alignment and domain information |
|---|
| >PF02319 E2F_TDP: E2F/DP family winged-helix DNA-binding domain; InterPro: IPR003316 The mammalian transcription factor E2F plays an important role in regulating the expression of genes that are required for passage through the cell cycle | Back alignment and domain information |
|---|
| >PRK00811 spermidine synthase; Provisional | Back alignment and domain information |
|---|
| >PF01475 FUR: Ferric uptake regulator family; InterPro: IPR002481 The Ferric uptake regulator (FUR) family includes metal ion uptake regulator proteins | Back alignment and domain information |
|---|
| >PRK10046 dpiA two-component response regulator DpiA; Provisional | Back alignment and domain information |
|---|
| >PLN02366 spermidine synthase | Back alignment and domain information |
|---|
| >PF01135 PCMT: Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT); InterPro: IPR000682 Protein-L-isoaspartate(D-aspartate) O-methyltransferase (2 | Back alignment and domain information |
|---|
| >PLN02853 Probable phenylalanyl-tRNA synthetase alpha chain | Back alignment and domain information |
|---|
| >PRK13943 protein-L-isoaspartate O-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PHA02701 ORF020 dsRNA-binding PKR inhibitor; Provisional | Back alignment and domain information |
|---|
| >COG1349 GlpR Transcriptional regulators of sugar metabolism [Transcription / Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PF05185 PRMT5: PRMT5 arginine-N-methyltransferase; InterPro: IPR007857 The human homologue of Saccharomyces cerevisiae Skb1 (Shk1 kinase-binding protein 1) is a protein methyltransferase [] | Back alignment and domain information |
|---|
| >PF13518 HTH_28: Helix-turn-helix domain | Back alignment and domain information |
|---|
| >PRK13168 rumA 23S rRNA m(5)U1939 methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >PRK11534 DNA-binding transcriptional regulator CsiR; Provisional | Back alignment and domain information |
|---|
| >KOG1270 consensus Methyltransferases [Coenzyme transport and metabolism] | Back alignment and domain information |
|---|
| >COG2263 Predicted RNA methylase [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >KOG3115 consensus Methyltransferase-like protein [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR03533 L3_gln_methyl protein-(glutamine-N5) methyltransferase, ribosomal protein L3-specific | Back alignment and domain information |
|---|
| >TIGR02787 codY_Gpos GTP-sensing transcriptional pleiotropic repressor CodY | Back alignment and domain information |
|---|
| >COG3413 Predicted DNA binding protein [General function prediction only] | Back alignment and domain information |
|---|
| >COG1802 GntR Transcriptional regulators [Transcription] | Back alignment and domain information |
|---|
| >smart00531 TFIIE Transcription initiation factor IIE | Back alignment and domain information |
|---|
| >PF03141 Methyltransf_29: Putative S-adenosyl-L-methionine-dependent methyltransferase; InterPro: IPR004159 Members of this family of hypothetical plant proteins are putative methyltransferases | Back alignment and domain information |
|---|
| >TIGR00536 hemK_fam HemK family putative methylases | Back alignment and domain information |
|---|
| >PRK13777 transcriptional regulator Hpr; Provisional | Back alignment and domain information |
|---|
| >PF08123 DOT1: Histone methylation protein DOT1 ; InterPro: IPR013110 The DOT1 domain regulates gene expression by methylating histone H3 [] | Back alignment and domain information |
|---|
| >PRK09775 putative DNA-binding transcriptional regulator; Provisional | Back alignment and domain information |
|---|
| >PTZ00326 phenylalanyl-tRNA synthetase alpha chain; Provisional | Back alignment and domain information |
|---|
| >PF09904 HTH_43: Winged helix-turn helix; InterPro: IPR017162 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function | Back alignment and domain information |
|---|
| >COG1510 Predicted transcriptional regulators [Transcription] | Back alignment and domain information |
|---|
| >KOG2904 consensus Predicted methyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >PF02295 z-alpha: Adenosine deaminase z-alpha domain; InterPro: IPR000607 Double-stranded RNA-specific adenosine deaminase (3 | Back alignment and domain information |
|---|
| >PHA02591 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03338 phnR_burk phosphonate utilization associated transcriptional regulator | Back alignment and domain information |
|---|
| >PLN02490 MPBQ/MSBQ methyltransferase | Back alignment and domain information |
|---|
| >COG2518 Pcm Protein-L-isoaspartate carboxylmethyltransferase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG1675 TFA1 Transcription initiation factor IIE, alpha subunit [Transcription] | Back alignment and domain information |
|---|
| >PRK12423 LexA repressor; Provisional | Back alignment and domain information |
|---|
| >TIGR01321 TrpR trp operon repressor, proteobacterial | Back alignment and domain information |
|---|
| >PRK11642 exoribonuclease R; Provisional | Back alignment and domain information |
|---|
| >PRK10909 rsmD 16S rRNA m(2)G966-methyltransferase; Provisional | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 210 | ||||
| 1kyw_A | 365 | Crystal Structure Analysis Of Caffeic Acid5-Hydroxy | 2e-54 | ||
| 3reo_A | 368 | Monolignol O-Methyltransferase (Momt) Length = 368 | 1e-48 | ||
| 3p9c_A | 364 | Crystal Structure Of Perennial Ryegrass Lpomt1 Boun | 2e-47 | ||
| 1fp1_D | 372 | Crystal Structure Analysis Of Chalcone O-Methyltran | 5e-30 | ||
| 1fpq_A | 372 | Crystal Structure Analysis Of Selenomethionine Subs | 4e-23 | ||
| 1fp2_A | 352 | Crystal Structure Analysis Of Isoflavone O-Methyltr | 2e-07 | ||
| 1fpx_A | 352 | Crystal Structure Analysis Of Selenomethionine Subs | 5e-06 | ||
| 2qyo_A | 357 | Crystal Structure Of Isoflavone O-Methyltransferase | 6e-06 |
| >pdb|1KYW|A Chain A, Crystal Structure Analysis Of Caffeic Acid5-Hydroxyferulic Acid 35-O-Methyltransferase In Complex With 5- Hydroxyconiferaldehyde Length = 365 | Back alignment and structure |
|
| >pdb|3REO|A Chain A, Monolignol O-Methyltransferase (Momt) Length = 368 | Back alignment and structure |
| >pdb|3P9C|A Chain A, Crystal Structure Of Perennial Ryegrass Lpomt1 Bound To Sah Length = 364 | Back alignment and structure |
| >pdb|1FP1|D Chain D, Crystal Structure Analysis Of Chalcone O-Methyltransferase Length = 372 | Back alignment and structure |
| >pdb|1FPQ|A Chain A, Crystal Structure Analysis Of Selenomethionine Substituted Chalcone O- Methyltransferase Length = 372 | Back alignment and structure |
| >pdb|1FP2|A Chain A, Crystal Structure Analysis Of Isoflavone O-Methyltransferase Length = 352 | Back alignment and structure |
| >pdb|1FPX|A Chain A, Crystal Structure Analysis Of Selenomethionine Substituted Isoflavone O-Methyltransferase Length = 352 | Back alignment and structure |
| >pdb|2QYO|A Chain A, Crystal Structure Of Isoflavone O-Methyltransferase Homolog In Complex With Biochanin A And Sah Length = 357 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 210 | |||
| 3reo_A | 368 | (ISO)eugenol O-methyltransferase; directed evoluti | 2e-67 | |
| 1fp1_D | 372 | Isoliquiritigenin 2'-O-methyltransferase; protein- | 6e-64 | |
| 3p9c_A | 364 | Caffeic acid O-methyltransferase; S-adenosylmethio | 1e-62 | |
| 1fp2_A | 352 | Isoflavone O-methyltransferase; protein-product co | 5e-57 | |
| 1zg3_A | 358 | Isoflavanone 4'-O-methyltransferase; rossman fold, | 5e-55 | |
| 1qzz_A | 374 | RDMB, aclacinomycin-10-hydroxylase; anthracycline, | 5e-53 | |
| 3lst_A | 348 | CALO1 methyltransferase; calicheamicin, enediyne, | 1e-52 | |
| 3gwz_A | 369 | MMCR; methyltransferase, mitomycin, S-adenosyl met | 2e-52 | |
| 3i53_A | 332 | O-methyltransferase; CO-complex, rossmann-like fol | 4e-51 | |
| 1tw3_A | 360 | COMT, carminomycin 4-O-methyltransferase; anthracy | 1e-50 | |
| 2ip2_A | 334 | Probable phenazine-specific methyltransferase; pyo | 1e-44 | |
| 2r3s_A | 335 | Uncharacterized protein; methyltransferase domain, | 5e-35 | |
| 1x19_A | 359 | CRTF-related protein; methyltransferase, bacterioc | 5e-33 | |
| 3dp7_A | 363 | SAM-dependent methyltransferase; structural genomi | 2e-32 | |
| 3mcz_A | 352 | O-methyltransferase; adomet_mtases, S-adenosylmeth | 4e-31 |
| >3reo_A (ISO)eugenol O-methyltransferase; directed evolution, saturation mutagenesis, regioselectivity transferase; HET: SAH EUG; 1.90A {Clarkia breweri} PDB: 1kyz_A* 1kyw_A* Length = 368 | Back alignment and structure |
|---|
Score = 210 bits (536), Expect = 2e-67
Identities = 98/207 (47%), Positives = 134/207 (64%), Gaps = 4/207 (1%)
Query: 6 DGERDQSFAYADQLATGVVLPMAIQAVYELGIFEILDKAG-PGTKLSASDIAAQLLTKNK 64
+++ +A QLA+ VLPMA++A EL + EI+ K+ P +S ++IAAQL T N
Sbjct: 15 HSSDEEANLFAMQLASAAVLPMALKAAIELDVLEIMAKSVPPSGYISPAEIAAQLPTTNP 74
Query: 65 DAPMMLDRILRLLASYSVVECSL---DASGARRLYSLNSVSKYYVPNKDGVLLGPLIQII 121
+AP+MLDR+LRLLASYSVV +L + RLY L V K+ N+DGV L P + +
Sbjct: 75 EAPVMLDRVLRLLASYSVVTYTLRELPSGKVERLYGLAPVCKFLTKNEDGVSLAPFLLLA 134
Query: 122 QDKVILESWSQLKDAILEGGIPFNRAHGVHIFEYAGLNPRFNKHFNAAMYNYTSLVMSNI 181
DKV+LE W LKDAILEGGIPFN+A+G++IF+Y G + R NK FN M + +++ M I
Sbjct: 135 TDKVLLEPWFYLKDAILEGGIPFNKAYGMNIFDYHGTDHRINKVFNKGMSSNSTITMKKI 194
Query: 182 LESYKGFDNIKQLVDVGGSLGVTLQAI 208
LE Y GF+ + +VDVGG G I
Sbjct: 195 LEMYNGFEGLTTIVDVGGGTGAVASMI 221
|
| >1fp1_D Isoliquiritigenin 2'-O-methyltransferase; protein-substrate, protein-product complex; HET: SAH HCC; 1.82A {Medicago sativa} SCOP: a.4.5.29 c.66.1.12 PDB: 1fpq_A* Length = 372 | Back alignment and structure |
|---|
| >3p9c_A Caffeic acid O-methyltransferase; S-adenosylmethionine dependent O-methyltransferase; HET: SAH; 1.80A {Lolium perenne} PDB: 3p9i_A* 3p9k_A* Length = 364 | Back alignment and structure |
|---|
| >1fp2_A Isoflavone O-methyltransferase; protein-product complex; HET: SAH HMO; 1.40A {Medicago sativa} SCOP: a.4.5.29 c.66.1.12 PDB: 1fpx_A* 2qyo_A* Length = 352 | Back alignment and structure |
|---|
| >1zg3_A Isoflavanone 4'-O-methyltransferase; rossman fold, plant Pro transferase; HET: 2HI SAH; 2.35A {Medicago truncatula} PDB: 1zga_A* 1zhf_A* 1zgj_A* Length = 358 | Back alignment and structure |
|---|
| >1qzz_A RDMB, aclacinomycin-10-hydroxylase; anthracycline, methyltransferase, polyketide, tailoring enzymes, structural proteomics in E spine; HET: SAM; 2.10A {Streptomyces purpurascens} SCOP: a.4.5.29 c.66.1.12 PDB: 1r00_A* 1xds_A* 1xdu_A* Length = 374 | Back alignment and structure |
|---|
| >3lst_A CALO1 methyltransferase; calicheamicin, enediyne, SAH, STRU genomics, PSI-2, protein structure initiative; HET: SAH; 2.40A {Micromonospora echinospora} Length = 348 | Back alignment and structure |
|---|
| >3gwz_A MMCR; methyltransferase, mitomycin, S-adenosyl methionine, transferase; HET: MSE SAH; 1.91A {Streptomyces lavendulae} PDB: 3gxo_A* Length = 369 | Back alignment and structure |
|---|
| >3i53_A O-methyltransferase; CO-complex, rossmann-like fold; HET: SAH; 2.08A {Streptomyces carzinostaticus subsp} PDB: 3i58_A* 3i5u_A* 3i64_A* Length = 332 | Back alignment and structure |
|---|
| >1tw3_A COMT, carminomycin 4-O-methyltransferase; anthracycline, methylate, tailoring enzyme, polyketide, S-adenosyl-L-homocystein; HET: SAH ERT; 2.35A {Streptomyces peucetius} SCOP: a.4.5.29 c.66.1.12 PDB: 1tw2_A* Length = 360 | Back alignment and structure |
|---|
| >2ip2_A Probable phenazine-specific methyltransferase; pyocyanin, phenazine-1-carboxy PHZM; 1.80A {Pseudomonas aeruginosa} Length = 334 | Back alignment and structure |
|---|
| >2r3s_A Uncharacterized protein; methyltransferase domain, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE; 2.15A {Nostoc punctiforme} Length = 335 | Back alignment and structure |
|---|
| >1x19_A CRTF-related protein; methyltransferase, bacteriochllochlorophyll, BCHU, SAM, SAH, adenosylmethyonine, S-adenosylhomocysteine, ADO-Met; 2.27A {Chlorobium tepidum} PDB: 1x1a_A* 1x1b_A* 1x1c_A* 1x1d_A* Length = 359 | Back alignment and structure |
|---|
| >3dp7_A SAM-dependent methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research; 2.33A {Bacteroides vulgatus} Length = 363 | Back alignment and structure |
|---|
| >3mcz_A O-methyltransferase; adomet_mtases, S-adenosylmethionine-dependent methyltransfer structural genomics, PSI-2; HET: MSE; 1.90A {Burkholderia thailandensis} Length = 352 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 210 | |||
| 3p9c_A | 364 | Caffeic acid O-methyltransferase; S-adenosylmethio | 100.0 | |
| 3reo_A | 368 | (ISO)eugenol O-methyltransferase; directed evoluti | 100.0 | |
| 3lst_A | 348 | CALO1 methyltransferase; calicheamicin, enediyne, | 100.0 | |
| 4a6d_A | 353 | Hydroxyindole O-methyltransferase; melatonin, circ | 100.0 | |
| 3gwz_A | 369 | MMCR; methyltransferase, mitomycin, S-adenosyl met | 99.98 | |
| 1zg3_A | 358 | Isoflavanone 4'-O-methyltransferase; rossman fold, | 99.97 | |
| 1fp2_A | 352 | Isoflavone O-methyltransferase; protein-product co | 99.97 | |
| 2ip2_A | 334 | Probable phenazine-specific methyltransferase; pyo | 99.97 | |
| 3i53_A | 332 | O-methyltransferase; CO-complex, rossmann-like fol | 99.97 | |
| 1fp1_D | 372 | Isoliquiritigenin 2'-O-methyltransferase; protein- | 99.97 | |
| 1qzz_A | 374 | RDMB, aclacinomycin-10-hydroxylase; anthracycline, | 99.96 | |
| 3dp7_A | 363 | SAM-dependent methyltransferase; structural genomi | 99.96 | |
| 1tw3_A | 360 | COMT, carminomycin 4-O-methyltransferase; anthracy | 99.96 | |
| 1x19_A | 359 | CRTF-related protein; methyltransferase, bacterioc | 99.95 | |
| 2r3s_A | 335 | Uncharacterized protein; methyltransferase domain, | 99.95 | |
| 3mcz_A | 352 | O-methyltransferase; adomet_mtases, S-adenosylmeth | 99.94 | |
| 2qm3_A | 373 | Predicted methyltransferase; putative methyltransf | 98.21 | |
| 2heo_A | 67 | Z-DNA binding protein 1; protein DLM1-Z-DNA comple | 97.78 | |
| 1qbj_A | 81 | Protein (double-stranded RNA specific adenosine D | 97.68 | |
| 1y0u_A | 96 | Arsenical resistance operon repressor, putative; s | 97.6 | |
| 1qgp_A | 77 | Protein (double stranded RNA adenosine deaminase); | 97.49 | |
| 3b73_A | 111 | PHIH1 repressor-like protein; winged-helix-turn-he | 97.43 | |
| 3mq0_A | 275 | Transcriptional repressor of the blcabc operon; he | 97.3 | |
| 1xmk_A | 79 | Double-stranded RNA-specific adenosine deaminase; | 97.28 | |
| 3pqk_A | 102 | Biofilm growth-associated repressor; helix-turn-he | 97.02 | |
| 2y75_A | 129 | HTH-type transcriptional regulator CYMR; DNA bindi | 96.99 | |
| 3jth_A | 98 | Transcription activator HLYU; transcription factor | 96.95 | |
| 2oqg_A | 114 | Possible transcriptional regulator, ARSR family P; | 96.94 | |
| 1mkm_A | 249 | ICLR transcriptional regulator; structural genomic | 96.94 | |
| 2xrn_A | 241 | HTH-type transcriptional regulator TTGV; DNA-bindi | 96.92 | |
| 2htj_A | 81 | P fimbrial regulatory protein KS71A; winged helix- | 96.91 | |
| 1u2w_A | 122 | CADC repressor, cadmium efflux system accessory pr | 96.91 | |
| 3r4k_A | 260 | Transcriptional regulator, ICLR family; DNA/RNA-bi | 96.9 | |
| 1r1u_A | 106 | CZRA, repressor protein; zinc, DNA binding, transc | 96.82 | |
| 3cuo_A | 99 | Uncharacterized HTH-type transcriptional regulato; | 96.73 | |
| 3ech_A | 142 | MEXR, multidrug resistance operon repressor; winge | 96.73 | |
| 3f6o_A | 118 | Probable transcriptional regulator, ARSR family pr | 96.7 | |
| 2kko_A | 108 | Possible transcriptional regulatory protein (possi | 96.68 | |
| 2jsc_A | 118 | Transcriptional regulator RV1994C/MT2050; cadmium, | 96.67 | |
| 2o0y_A | 260 | Transcriptional regulator; ICLR-family, structural | 96.67 | |
| 2g7u_A | 257 | Transcriptional regulator; ICLR family, structural | 96.66 | |
| 2jt1_A | 77 | PEFI protein; solution structure, winged helix-tur | 96.65 | |
| 4a5n_A | 131 | Uncharacterized HTH-type transcriptional regulato; | 96.62 | |
| 1xn7_A | 78 | Hypothetical protein YHGG; alpha+beta, GFT structu | 96.53 | |
| 2ia2_A | 265 | Putative transcriptional regulator; SAD, PSI-2, st | 96.53 | |
| 2hzt_A | 107 | Putative HTH-type transcriptional regulator YTCD; | 96.53 | |
| 3lwf_A | 159 | LIN1550 protein, putative transcriptional regulato | 96.5 | |
| 1ub9_A | 100 | Hypothetical protein PH1061; helix-turn-helix moti | 96.48 | |
| 1ylf_A | 149 | RRF2 family protein; structural genomics, transcri | 96.46 | |
| 3t8r_A | 143 | Staphylococcus aureus CYMR; transcriptional regula | 96.44 | |
| 1on2_A | 142 | Transcriptional regulator MNTR; helix-turn-helix, | 96.43 | |
| 2k02_A | 87 | Ferrous iron transport protein C; FEOC, iron-sulfu | 96.43 | |
| 3f6v_A | 151 | Possible transcriptional regulator, ARSR family pr | 96.34 | |
| 1r1t_A | 122 | Transcriptional repressor SMTB; zinc, transcriptio | 96.33 | |
| 1r7j_A | 95 | Conserved hypothetical protein SSO10A; winged heli | 96.32 | |
| 1oyi_A | 82 | Double-stranded RNA-binding protein; (alpha+beta) | 96.31 | |
| 2wte_A | 244 | CSA3; antiviral protein, viral resistance, winged | 96.16 | |
| 2lnb_A | 80 | Z-DNA-binding protein 1; structural genomics, nort | 96.08 | |
| 3k69_A | 162 | Putative transcription regulator; putative transcr | 96.06 | |
| 3df8_A | 111 | Possible HXLR family transcriptional factor; APC89 | 96.05 | |
| 3r0a_A | 123 | Putative transcriptional regulator; structural gen | 96.03 | |
| 3fm5_A | 150 | Transcriptional regulator; MCSG, PF04017, PSI, MAR | 95.98 | |
| 2hr3_A | 147 | Probable transcriptional regulator; MCSG, structur | 95.97 | |
| 1xd7_A | 145 | YWNA; structural genomics, protein structure initi | 95.94 | |
| 2fu4_A | 83 | Ferric uptake regulation protein; DNA binding doma | 95.83 | |
| 1z7u_A | 112 | Hypothetical protein EF0647; winged-helix-turn-hel | 95.81 | |
| 2fsw_A | 107 | PG_0823 protein; alpha-beta structure, helix-turn- | 95.8 | |
| 2h09_A | 155 | Transcriptional regulator MNTR; transcription regu | 95.78 | |
| 2lkp_A | 119 | Transcriptional regulator, ARSR family; symmetric | 95.75 | |
| 2x4h_A | 139 | Hypothetical protein SSO2273; transcription; 2.30A | 95.75 | |
| 2f2e_A | 146 | PA1607; transcription factor, helix-TRUN-helix, AP | 95.73 | |
| 3vc1_A | 312 | Geranyl diphosphate 2-C-methyltransferase; rossman | 95.7 | |
| 3bdd_A | 142 | Regulatory protein MARR; putative multiple antibio | 95.59 | |
| 1sfx_A | 109 | Conserved hypothetical protein AF2008; structural | 95.58 | |
| 3k0l_A | 162 | Repressor protein; helix-turn-helix, structural ge | 95.51 | |
| 3bja_A | 139 | Transcriptional regulator, MARR family, putative; | 95.51 | |
| 2zkz_A | 99 | Transcriptional repressor PAGR; protein-DNA, HTH m | 95.5 | |
| 1tbx_A | 99 | ORF F-93, hypothetical 11.0 kDa protein; sulfolobu | 95.49 | |
| 1jg1_A | 235 | PIMT;, protein-L-isoaspartate O-methyltransferase; | 95.47 | |
| 3g3z_A | 145 | NMB1585, transcriptional regulator, MARR family; t | 95.41 | |
| 1yyv_A | 131 | Putative transcriptional regulator; reductive meth | 95.38 | |
| 3dli_A | 240 | Methyltransferase; PSI-II, NYSGXRC, structural gen | 95.38 | |
| 3hsr_A | 140 | HTH-type transcriptional regulator SARZ; helix-tur | 95.35 | |
| 3bpv_A | 138 | Transcriptional regulator; MARR, DNA binding, tran | 95.33 | |
| 3bro_A | 141 | Transcriptional regulator; helix_TURN_helix, multi | 95.33 | |
| 2nnn_A | 140 | Probable transcriptional regulator; structural gen | 95.3 | |
| 3nrv_A | 148 | Putative transcriptional regulator (MARR/EMRR FAM; | 95.28 | |
| 2a61_A | 145 | Transcriptional regulator TM0710; APC4350, MCSG, m | 95.27 | |
| 1s3j_A | 155 | YUSO protein; structural genomics, MARR transcript | 95.26 | |
| 2bv6_A | 142 | MGRA, HTH-type transcriptional regulator MGRA; mul | 95.24 | |
| 3oop_A | 143 | LIN2960 protein; protein structure initiative, PSI | 95.23 | |
| 3bj6_A | 152 | Transcriptional regulator, MARR family; helix-turn | 95.22 | |
| 2qvo_A | 95 | Uncharacterized protein AF_1382; PSI, structural g | 95.17 | |
| 1jgs_A | 138 | Multiple antibiotic resistance protein MARR; trans | 95.14 | |
| 3bkw_A | 243 | MLL3908 protein, S-adenosylmethionine dependent me | 95.12 | |
| 2fa5_A | 162 | Transcriptional regulator MARR/EMRR family; multip | 95.11 | |
| 1q1h_A | 110 | TFE, transcription factor E, TFE; TFIIE, transcrip | 95.11 | |
| 3ou2_A | 218 | SAM-dependent methyltransferase; O-methyltransfera | 95.11 | |
| 2rdp_A | 150 | Putative transcriptional regulator MARR; PFAM PF01 | 95.09 | |
| 2pg4_A | 95 | Uncharacterized protein; structural genomics, join | 95.07 | |
| 1xtp_A | 254 | LMAJ004091AAA; SGPP, structural genomics, PSI, pro | 95.07 | |
| 2pex_A | 153 | Transcriptional regulator OHRR; transcription regu | 95.04 | |
| 3boq_A | 160 | Transcriptional regulator, MARR family; MARR famil | 94.94 | |
| 3cdh_A | 155 | Transcriptional regulator, MARR family; helix-turn | 94.94 | |
| 2fbh_A | 146 | Transcriptional regulator PA3341; MARR, transcript | 94.93 | |
| 2nyx_A | 168 | Probable transcriptional regulatory protein, RV14; | 94.84 | |
| 1bja_A | 95 | Transcription regulatory protein MOTA; activation | 94.83 | |
| 3bus_A | 273 | REBM, methyltransferase; rebeccamycin synthesis; H | 94.81 | |
| 3tgn_A | 146 | ADC operon repressor ADCR; helix-turn-helix, trans | 94.8 | |
| 3deu_A | 166 | Transcriptional regulator SLYA; MARR, WING-helix, | 94.79 | |
| 3f3x_A | 144 | Transcriptional regulator, MARR family, putative; | 94.77 | |
| 2obp_A | 96 | Putative DNA-binding protein; structural genomics, | 94.76 | |
| 2cfx_A | 144 | HTH-type transcriptional regulator LRPC; transcrip | 94.74 | |
| 2eth_A | 154 | Transcriptional regulator, putative, MAR family; M | 94.73 | |
| 1lj9_A | 144 | Transcriptional regulator SLYA; HTH DNA binding pr | 94.72 | |
| 3s2w_A | 159 | Transcriptional regulator, MARR family; structural | 94.71 | |
| 2gxg_A | 146 | 146AA long hypothetical transcriptional regulator; | 94.71 | |
| 3e6m_A | 161 | MARR family transcriptional regulator; APC88769, s | 94.7 | |
| 2qww_A | 154 | Transcriptional regulator, MARR family; YP_013417. | 94.68 | |
| 2w25_A | 150 | Probable transcriptional regulatory protein; trans | 94.67 | |
| 2fbi_A | 142 | Probable transcriptional regulator; MARR, APC5816, | 94.63 | |
| 1z91_A | 147 | Organic hydroperoxide resistance transcriptional; | 94.62 | |
| 3cjn_A | 162 | Transcriptional regulator, MARR family; silicibact | 94.6 | |
| 4hbl_A | 149 | Transcriptional regulator, MARR family; HTH, trans | 94.58 | |
| 4g6q_A | 182 | Putative uncharacterized protein; structural genom | 94.57 | |
| 3eco_A | 139 | MEPR; mutlidrug efflux pump regulator winged helix | 94.56 | |
| 3hrs_A | 214 | Metalloregulator SCAR; DTXR/MNTR family member, tr | 94.55 | |
| 2p4w_A | 202 | Transcriptional regulatory protein ARSR family; ar | 94.52 | |
| 3kp7_A | 151 | Transcriptional regulator TCAR; multiple drug resi | 94.5 | |
| 1p6r_A | 82 | Penicillinase repressor; transcription regulation, | 94.49 | |
| 3dlc_A | 219 | Putative S-adenosyl-L-methionine-dependent methylt | 94.48 | |
| 3g5l_A | 253 | Putative S-adenosylmethionine dependent methyltran | 94.47 | |
| 2zfu_A | 215 | Nucleomethylin, cerebral protein 1; nucleolar prot | 94.47 | |
| 3iv6_A | 261 | Putative Zn-dependent alcohol dehydrogenase; alpha | 94.44 | |
| 2p5v_A | 162 | Transcriptional regulator, LRP/ASNC family; NMB057 | 94.43 | |
| 2pn6_A | 150 | ST1022, 150AA long hypothetical transcriptional re | 94.42 | |
| 3ofk_A | 216 | Nodulation protein S; NODS, N-methyltransferase, S | 94.4 | |
| 4gek_A | 261 | TRNA (CMO5U34)-methyltransferase; structural genom | 94.37 | |
| 4aik_A | 151 | Transcriptional regulator SLYA; transcription, tra | 94.36 | |
| 3hem_A | 302 | Cyclopropane-fatty-acyl-phospholipid synthase 2; p | 94.34 | |
| 3cgg_A | 195 | SAM-dependent methyltransferase; NP_600671.1, meth | 94.27 | |
| 2o57_A | 297 | Putative sarcosine dimethylglycine methyltransfera | 94.26 | |
| 1dus_A | 194 | MJ0882; hypothetical protein, methanococcus jannas | 94.21 | |
| 3bkx_A | 275 | SAM-dependent methyltransferase; YP_807781.1, cycl | 94.19 | |
| 2d1h_A | 109 | ST1889, 109AA long hypothetical transcriptional re | 94.18 | |
| 3ujc_A | 266 | Phosphoethanolamine N-methyltransferase; parasite; | 94.12 | |
| 2dbb_A | 151 | Putative HTH-type transcriptional regulator PH006; | 94.1 | |
| 3u2r_A | 168 | Regulatory protein MARR; structural genomics, PSI- | 94.08 | |
| 2cg4_A | 152 | Regulatory protein ASNC; DNA binding, FFRP, LRP fa | 94.07 | |
| 3pfg_A | 263 | N-methyltransferase; N,N-dimethyltransferase, SAM | 94.02 | |
| 1yb2_A | 275 | Hypothetical protein TA0852; structural genomics, | 93.98 | |
| 1uly_A | 192 | Hypothetical protein PH1932; helix-turn-helix, str | 93.96 | |
| 2qlz_A | 232 | Transcription factor PF0095; 2.50A {Pyrococcus fur | 93.94 | |
| 4e2x_A | 416 | TCAB9; kijanose, tetronitrose, tetradeoxy sugar, s | 93.94 | |
| 2cyy_A | 151 | Putative HTH-type transcriptional regulator PH151; | 93.93 | |
| 2frh_A | 127 | SARA, staphylococcal accessory regulator A; winged | 93.91 | |
| 2ia0_A | 171 | Putative HTH-type transcriptional regulator PF086; | 93.89 | |
| 4htf_A | 285 | S-adenosylmethionine-dependent methyltransferase; | 93.88 | |
| 1ku9_A | 152 | Hypothetical protein MJ223; putative transcription | 93.84 | |
| 3e05_A | 204 | Precorrin-6Y C5,15-methyltransferase (decarboxyla; | 93.83 | |
| 1j5y_A | 187 | Transcriptional regulator, biotin repressor famil; | 93.82 | |
| 1kpg_A | 287 | CFA synthase;, cyclopropane-fatty-acyl-phospholipi | 93.81 | |
| 1okr_A | 123 | MECI, methicillin resistance regulatory protein ME | 93.8 | |
| 2fk8_A | 318 | Methoxy mycolic acid synthase 4; S-adenosylmethion | 93.7 | |
| 3dtn_A | 234 | Putative methyltransferase MM_2633; structural gen | 93.68 | |
| 1i9g_A | 280 | Hypothetical protein RV2118C; mtase, adoMet, cryst | 93.64 | |
| 2o03_A | 131 | Probable zinc uptake regulation protein FURB; DNA- | 93.63 | |
| 1i1g_A | 141 | Transcriptional regulator LRPA; helix-turn-helix, | 93.62 | |
| 2fxa_A | 207 | Protease production regulatory protein HPR; protea | 93.6 | |
| 2y1w_A | 348 | Histone-arginine methyltransferase CARM1; histone | 93.6 | |
| 4fx0_A | 148 | Probable transcriptional repressor protein; helix- | 93.56 | |
| 2fbk_A | 181 | Transcriptional regulator, MARR family; winged-hel | 93.54 | |
| 2e1c_A | 171 | Putative HTH-type transcriptional regulator PH151; | 93.54 | |
| 3k2z_A | 196 | LEXA repressor; winged helix-turn-helix, SOS syste | 93.53 | |
| 2dk5_A | 91 | DNA-directed RNA polymerase III 39 kDa polypeptide | 93.5 | |
| 3jw4_A | 148 | Transcriptional regulator, MARR/EMRR family; DNA-b | 93.46 | |
| 2k4b_A | 99 | Transcriptional regulator; DNA binding protein, wi | 93.46 | |
| 3b3j_A | 480 | Histone-arginine methyltransferase CARM1; protein | 93.46 | |
| 3i4p_A | 162 | Transcriptional regulator, ASNC family; PSI, struc | 93.42 | |
| 3kkz_A | 267 | Uncharacterized protein Q5LES9; putative methyltra | 93.35 | |
| 3e8s_A | 227 | Putative SAM dependent methyltransferase; NP_74470 | 93.33 | |
| 1sfu_A | 75 | 34L protein; protein/Z-DNA complex, DNA binding pr | 93.31 | |
| 1jsx_A | 207 | Glucose-inhibited division protein B; methyltransf | 93.26 | |
| 3nqo_A | 189 | MARR-family transcriptional regulator; structural | 93.17 | |
| 3njr_A | 204 | Precorrin-6Y methylase; methyltransferase, decarbo | 93.14 | |
| 3lbf_A | 210 | Protein-L-isoaspartate O-methyltransferase; modifi | 93.12 | |
| 3f4k_A | 257 | Putative methyltransferase; structural genomics, P | 93.09 | |
| 3g2m_A | 299 | PCZA361.24; SAM-dependent methyltransferase, glyco | 93.07 | |
| 2fe3_A | 145 | Peroxide operon regulator; oxidative stress regula | 93.06 | |
| 2aot_A | 292 | HMT, histamine N-methyltransferase; classic methyl | 92.97 | |
| 3uzu_A | 279 | Ribosomal RNA small subunit methyltransferase A; s | 92.95 | |
| 2avd_A | 229 | Catechol-O-methyltransferase; structural genomics, | 92.93 | |
| 1vbf_A | 231 | 231AA long hypothetical protein-L-isoaspartate O- | 92.85 | |
| 3u1d_A | 151 | Uncharacterized protein; GNTR-superfamily, structu | 92.79 | |
| 2fyt_A | 340 | Protein arginine N-methyltransferase 3; structural | 92.79 | |
| 3hnr_A | 220 | Probable methyltransferase BT9727_4108; structural | 92.75 | |
| 3e23_A | 211 | Uncharacterized protein RPA2492; alpha-beta protei | 92.71 | |
| 1wzn_A | 252 | SAM-dependent methyltransferase; structural genomi | 92.7 | |
| 3thr_A | 293 | Glycine N-methyltransferase; GNMT, folate, methylt | 92.7 | |
| 1u2z_A | 433 | Histone-lysine N-methyltransferase, H3 lysine-79 s | 92.66 | |
| 3fut_A | 271 | Dimethyladenosine transferase; methyltransferase, | 92.63 | |
| 3orh_A | 236 | Guanidinoacetate N-methyltransferase; structura ge | 92.54 | |
| 3fzg_A | 200 | 16S rRNA methylase; methyltransferase, plasmid, tr | 92.49 | |
| 3ccf_A | 279 | Cyclopropane-fatty-acyl-phospholipid synthase; YP_ | 92.46 | |
| 1fbn_A | 230 | MJ fibrillarin homologue; MJ proteins, ribosomal R | 92.46 | |
| 2yxe_A | 215 | Protein-L-isoaspartate O-methyltransferase; rossma | 92.43 | |
| 3mb5_A | 255 | SAM-dependent methyltransferase; RNA methyltransfe | 92.43 | |
| 2hoe_A | 380 | N-acetylglucosamine kinase; TM1224, structural gen | 92.42 | |
| 2ex4_A | 241 | Adrenal gland protein AD-003; methyltransferase, s | 92.42 | |
| 2h1r_A | 299 | Dimethyladenosine transferase, putative; SGC toron | 92.4 | |
| 2vn2_A | 128 | DNAD, chromosome replication initiation protein; D | 92.4 | |
| 2esh_A | 118 | Conserved hypothetical protein TM0937; APC5794, st | 92.39 | |
| 3gru_A | 295 | Dimethyladenosine transferase; rossman fold, ribos | 92.36 | |
| 2fhp_A | 187 | Methylase, putative; alpha-beta-alpha sandwich, st | 92.35 | |
| 2xvc_A | 59 | ESCRT-III, SSO0910; cell cycle, cell division, cyt | 92.21 | |
| 1nt2_A | 210 | Fibrillarin-like PRE-rRNA processing protein; adeM | 92.09 | |
| 3uwp_A | 438 | Histone-lysine N-methyltransferase, H3 lysine-79; | 91.95 | |
| 2p7i_A | 250 | Hypothetical protein; putative methyltransferase, | 91.92 | |
| 2pwy_A | 258 | TRNA (adenine-N(1)-)-methyltransferase; mtase, ado | 91.91 | |
| 1vlm_A | 219 | SAM-dependent methyltransferase; possible histamin | 91.91 | |
| 1yzh_A | 214 | TRNA (guanine-N(7)-)-methyltransferase; alpha-beta | 91.8 | |
| 1zx0_A | 236 | Guanidinoacetate N-methyltransferase; structural g | 91.79 | |
| 2yvl_A | 248 | TRMI protein, hypothetical protein; tRNA, methyltr | 91.77 | |
| 2g9w_A | 138 | Conserved hypothetical protein; DNA-binding domain | 91.61 | |
| 2xig_A | 150 | Ferric uptake regulation protein; hpfur, transcrip | 91.52 | |
| 1v4r_A | 102 | Transcriptional repressor; helix-turn-helix, winge | 91.5 | |
| 1sd4_A | 126 | Penicillinase repressor; BLAI, MECI, methicillin, | 91.47 | |
| 3m33_A | 226 | Uncharacterized protein; structural genomics, PSI- | 91.46 | |
| 3tfw_A | 248 | Putative O-methyltransferase; PSI-biology, nysgrc, | 91.45 | |
| 3ckk_A | 235 | TRNA (guanine-N(7)-)-methyltransferase; mettl1, S- | 91.33 | |
| 2oxt_A | 265 | Nucleoside-2'-O-methyltransferase; flavivirus, vir | 91.29 | |
| 1g8a_A | 227 | Fibrillarin-like PRE-rRNA processing protein; rRNA | 91.29 | |
| 2ipx_A | 233 | RRNA 2'-O-methyltransferase fibrillarin; FBL, stru | 91.24 | |
| 2wa2_A | 276 | Non-structural protein 5; transferase, S-adenosyl- | 91.22 | |
| 3g07_A | 292 | 7SK snRNA methylphosphate capping enzyme; structur | 91.17 | |
| 2yu3_A | 95 | DNA-directed RNA polymerase III 39 kDa polypeptide | 91.13 | |
| 3lcc_A | 235 | Putative methyl chloride transferase; halide methy | 91.11 | |
| 1o9g_A | 250 | RRNA methyltransferase; antibiotic resistance, Se- | 91.05 | |
| 1ws6_A | 171 | Methyltransferase; structural genomics, riken stru | 91.05 | |
| 1dl5_A | 317 | Protein-L-isoaspartate O-methyltransferase; isoasp | 91.02 | |
| 3cta_A | 230 | Riboflavin kinase; structural genomics, transferas | 90.96 | |
| 1o54_A | 277 | SAM-dependent O-methyltransferase; TM0748, structu | 90.88 | |
| 1jhg_A | 101 | Trp operon repressor; complex (regulatory protein- | 90.87 | |
| 3ggd_A | 245 | SAM-dependent methyltransferase; YP_325210.1, stru | 90.82 | |
| 4b8x_A | 147 | SCO5413, possible MARR-transcriptional regulator; | 90.64 | |
| 3tma_A | 354 | Methyltransferase; thump domain; 2.05A {Thermus th | 90.59 | |
| 3lpm_A | 259 | Putative methyltransferase; structural genomics, p | 90.59 | |
| 1z6r_A | 406 | MLC protein; transcriptional repressor, ROK family | 90.59 | |
| 3m70_A | 286 | Tellurite resistance protein TEHB homolog; structu | 90.55 | |
| 2qe6_A | 274 | Uncharacterized protein TFU_2867; putative methylt | 90.49 | |
| 1fx7_A | 230 | Iron-dependent repressor IDER; DTXR, iron-dependen | 90.39 | |
| 3i71_A | 68 | Ethanolamine utilization protein EUTK; helix-turn- | 90.36 | |
| 2nxc_A | 254 | L11 mtase, ribosomal protein L11 methyltransferase | 90.31 | |
| 3adn_A | 294 | Spermidine synthase; aminopropyltransferase, polya | 90.3 | |
| 2vdv_E | 246 | TRNA (guanine-N(7)-)-methyltransferase; S-adenosyl | 90.16 | |
| 3p9n_A | 189 | Possible methyltransferase (methylase); RV2966C, a | 90.14 | |
| 3tqn_A | 113 | Transcriptional regulator, GNTR family; regulatory | 90.13 | |
| 3mwm_A | 139 | ZUR, putative metal uptake regulation protein; FUR | 90.08 | |
| 3q7e_A | 349 | Protein arginine N-methyltransferase 1; HET: SAH; | 90.03 | |
| 3hp7_A | 291 | Hemolysin, putative; structural genomics, APC64019 | 90.02 | |
| 4dcm_A | 375 | Ribosomal RNA large subunit methyltransferase G; 2 | 90.02 | |
| 1nv8_A | 284 | HEMK protein; class I adoMet-dependent methyltrans | 90.0 | |
| 2pjp_A | 121 | Selenocysteine-specific elongation factor; SELB, p | 89.99 | |
| 3l8d_A | 242 | Methyltransferase; structural genomics, PSI, nysgr | 89.92 | |
| 1cf7_A | 76 | Protein (transcription factor E2F-4); E2F, winged- | 89.91 | |
| 3bzb_A | 281 | Uncharacterized protein; RED ALGA, protein structu | 89.87 | |
| 2a14_A | 263 | Indolethylamine N-methyltransferase; SGC,INMT, str | 89.85 | |
| 3grz_A | 205 | L11 mtase, ribosomal protein L11 methyltransferase | 89.75 | |
| 3r0q_C | 376 | Probable protein arginine N-methyltransferase 4.2; | 89.73 | |
| 3h2b_A | 203 | SAM-dependent methyltransferase; alpha-beta protei | 89.68 | |
| 2p41_A | 305 | Type II methyltransferase; vizier, viral enzymes i | 89.66 | |
| 2qlz_A | 232 | Transcription factor PF0095; 2.50A {Pyrococcus fur | 89.51 | |
| 2avn_A | 260 | Ubiquinone/menaquinone biosynthesis methyltransfe | 89.42 | |
| 2b25_A | 336 | Hypothetical protein; structural genomics, methyl | 89.39 | |
| 3c3p_A | 210 | Methyltransferase; NP_951602.1, structural genomic | 89.3 | |
| 2ek5_A | 129 | Predicted transcriptional regulators; helix-turn-h | 89.28 | |
| 2pxx_A | 215 | Uncharacterized protein MGC2408; structural genomi | 89.19 | |
| 2vxz_A | 165 | Pyrsv_GP04; viral protein, SSPF, ORF165A; 1.7A {Py | 89.16 | |
| 2b3t_A | 276 | Protein methyltransferase HEMK; translation termin | 89.12 | |
| 1wy7_A | 207 | Hypothetical protein PH1948; seven-stranded beta s | 89.09 | |
| 2ift_A | 201 | Putative methylase HI0767; NESG, Y767_haein, struc | 89.08 | |
| 2pjd_A | 343 | Ribosomal RNA small subunit methyltransferase C; g | 89.03 | |
| 4df3_A | 233 | Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; | 89.03 | |
| 3tr6_A | 225 | O-methyltransferase; cellular processes; HET: SAH; | 89.0 | |
| 2qq9_A | 226 | Diphtheria toxin repressor; regulator, DTXR, helix | 88.97 | |
| 1xdz_A | 240 | Methyltransferase GIDB; MCSG, protein structure in | 88.94 | |
| 3duw_A | 223 | OMT, O-methyltransferase, putative; alternating of | 88.93 | |
| 3ntv_A | 232 | MW1564 protein; rossmann fold, putative methyltran | 88.92 | |
| 3bxo_A | 239 | N,N-dimethyltransferase; desosamine, sugar, carboh | 88.92 | |
| 4esf_A | 117 | PADR-like transcriptional regulator; PADR family, | 88.89 | |
| 1bia_A | 321 | BIRA bifunctional protein; transcription regulatio | 88.77 | |
| 3u81_A | 221 | Catechol O-methyltransferase; neurotransmitter deg | 88.77 | |
| 1ne2_A | 200 | Hypothetical protein TA1320; structural genomics, | 88.71 | |
| 3neu_A | 125 | LIN1836 protein; structural genomics, PSI-2, prote | 88.69 | |
| 3g89_A | 249 | Ribosomal RNA small subunit methyltransferase G; 1 | 88.62 | |
| 2gb4_A | 252 | Thiopurine S-methyltransferase; 18204406, thiopuri | 88.61 | |
| 3gdh_A | 241 | Trimethylguanosine synthase homolog; M7G, CAP, dim | 88.6 | |
| 3by6_A | 126 | Predicted transcriptional regulator; structural ge | 88.57 | |
| 1ri5_A | 298 | MRNA capping enzyme; methyltransferase, M7G, messe | 88.5 | |
| 1iy9_A | 275 | Spermidine synthase; rossmann fold, structural gen | 88.49 | |
| 1r18_A | 227 | Protein-L-isoaspartate(D-aspartate)-O-methyltrans; | 88.42 | |
| 2fpo_A | 202 | Methylase YHHF; structural genomics, putative meth | 88.18 | |
| 2p8t_A | 200 | Hypothetical protein PH0730; pyrococcus horikoshii | 88.12 | |
| 3f8b_A | 116 | Transcriptional regulator, PADR-like family; winge | 88.09 | |
| 1xma_A | 145 | Predicted transcriptional regulator; southea colla | 87.95 | |
| 3elk_A | 117 | Putative transcriptional regulator TA0346; structu | 87.93 | |
| 2v79_A | 135 | DNA replication protein DNAD; primosome, DNA-bindi | 87.88 | |
| 3bwc_A | 304 | Spermidine synthase; SAM, SGPP, structura genomics | 87.83 | |
| 2b0l_A | 102 | GTP-sensing transcriptional pleiotropic repressor; | 87.77 | |
| 2bm8_A | 236 | Cephalosporin hydroxylase CMCI; cephamycin biosynt | 87.77 | |
| 3evz_A | 230 | Methyltransferase; NYSGXRC, NEW YORK SGX research | 87.65 | |
| 2pbf_A | 227 | Protein-L-isoaspartate O-methyltransferase beta-A | 87.63 | |
| 2h00_A | 254 | Methyltransferase 10 domain containing protein; st | 87.52 | |
| 1mjf_A | 281 | Spermidine synthase; spermidine synthetase, struct | 87.52 | |
| 1uwv_A | 433 | 23S rRNA (uracil-5-)-methyltransferase RUMA; RNA m | 87.38 | |
| 3c3y_A | 237 | Pfomt, O-methyltransferase; plant secondary metabo | 87.3 | |
| 1p4x_A | 250 | Staphylococcal accessory regulator A homologue; wi | 87.29 | |
| 1z05_A | 429 | Transcriptional regulator, ROK family; structural | 87.29 | |
| 1ixk_A | 315 | Methyltransferase; open beta sheet; 1.90A {Pyrococ | 87.16 | |
| 1xj5_A | 334 | Spermidine synthase 1; structural genomics, protei | 87.09 | |
| 3ldu_A | 385 | Putative methylase; structural genomics, PSI-2, pr | 87.0 | |
| 4azs_A | 569 | Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15 | 86.97 | |
| 4ham_A | 134 | LMO2241 protein; structural genomics, PSI-biology, | 86.93 | |
| 2i62_A | 265 | Nicotinamide N-methyltransferase; structural genom | 86.93 | |
| 1inl_A | 296 | Spermidine synthase; beta-barrel, rossman fold, st | 86.8 | |
| 1mzb_A | 136 | Ferric uptake regulation protein; ferric uptake re | 86.76 | |
| 1hsj_A | 487 | Fusion protein consisting of staphylococcus access | 86.75 | |
| 2cmg_A | 262 | Spermidine synthase; transferase, putrescine amino | 86.74 | |
| 3lmm_A | 583 | Uncharacterized protein; multi-domained alpha-beta | 86.71 | |
| 3ocj_A | 305 | Putative exported protein; structural genomics, PS | 86.67 | |
| 3rkx_A | 323 | Biotin-[acetyl-COA-carboxylase] ligase; biotin pro | 86.64 | |
| 2o0m_A | 345 | Transcriptional regulator, SORC family; structural | 86.61 | |
| 2pt6_A | 321 | Spermidine synthase; transferase, structural genom | 86.58 | |
| 3dr5_A | 221 | Putative O-methyltransferase; Q8NRD3, CGL1119, PF0 | 86.47 | |
| 1i1n_A | 226 | Protein-L-isoaspartate O-methyltransferase; S-aden | 86.45 | |
| 3k0b_A | 393 | Predicted N6-adenine-specific DNA methylase; methy | 86.43 | |
| 3id6_C | 232 | Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; | 86.41 | |
| 1uir_A | 314 | Polyamine aminopropyltransferase; spermidien synth | 86.4 | |
| 1yg2_A | 179 | Gene activator APHA; virulence factor, winged heli | 86.39 | |
| 2i7c_A | 283 | Spermidine synthase; transferase, structural genom | 86.31 | |
| 3maj_A | 382 | DNA processing chain A; MCSG, PSI-2, structural ge | 86.28 | |
| 2o07_A | 304 | Spermidine synthase; structural genomics, structur | 86.22 | |
| 2hnk_A | 239 | SAM-dependent O-methyltransferase; modified rossma | 86.2 | |
| 3cbg_A | 232 | O-methyltransferase; cyanobacterium; HET: SAH FER | 86.06 | |
| 3r3h_A | 242 | O-methyltransferase, SAM-dependent; structural gen | 86.01 | |
| 2gpy_A | 233 | O-methyltransferase; structural genomics, PSI, pro | 85.99 | |
| 4hc4_A | 376 | Protein arginine N-methyltransferase 6; HRMT1L6, S | 85.96 | |
| 3l7w_A | 108 | Putative uncharacterized protein SMU.1704; PADR, t | 85.68 | |
| 3gcz_A | 282 | Polyprotein; flavivirus, RNA capping, methyltransf | 85.38 | |
| 3c7j_A | 237 | Transcriptional regulator, GNTR family; structural | 85.3 | |
| 1p91_A | 269 | Ribosomal RNA large subunit methyltransferase A; R | 85.16 | |
| 2b2c_A | 314 | Spermidine synthase; beta-alpha, transferase; 2.50 | 85.12 | |
| 3eyi_A | 72 | Z-DNA-binding protein 1; alternative splicing, DNA | 84.91 | |
| 1sui_A | 247 | Caffeoyl-COA O-methyltransferase; rossmann fold, p | 84.79 | |
| 3ldg_A | 384 | Putative uncharacterized protein SMU.472; YPSC, me | 84.35 | |
| 2vdw_A | 302 | Vaccinia virus capping enzyme D1 subunit; nucleoti | 84.09 | |
| 3tm4_A | 373 | TRNA (guanine N2-)-methyltransferase TRM14; rossma | 84.08 | |
| 4gqb_A | 637 | Protein arginine N-methyltransferase 5; TIM barrel | 84.08 | |
| 3evf_A | 277 | RNA-directed RNA polymerase NS5; NS5 methyltransfe | 83.98 | |
| 2frn_A | 278 | Hypothetical protein PH0793; structural genomics, | 83.97 | |
| 4fsd_A | 383 | Arsenic methyltransferase; rossmann fold; 1.75A {C | 83.96 | |
| 3a27_A | 272 | TYW2, uncharacterized protein MJ1557; wybutosine m | 83.69 | |
| 3hhh_A | 116 | Transcriptional regulator, PADR family; PF03551, s | 83.46 | |
| 1tc3_C | 51 | Protein (TC3 transposase); DNA binding, helix-turn | 83.37 | |
| 2g72_A | 289 | Phenylethanolamine N-methyltransferase; HET: SAM F | 83.12 | |
| 3eyy_A | 145 | Putative iron uptake regulatory protein; NUR, nick | 83.11 | |
| 2w48_A | 315 | Sorbitol operon regulator; SORC, activator, repres | 83.07 | |
| 3htx_A | 950 | HEN1; HEN1, small RNA methyltransferase, protein-R | 82.93 | |
| 2w57_A | 150 | Ferric uptake regulation protein; gene regulation, | 82.46 | |
| 3sxy_A | 218 | Transcriptional regulator, GNTR family; transcript | 82.33 | |
| 3ua3_A | 745 | Protein arginine N-methyltransferase 5; TIM-barrel | 82.19 | |
| 3ajd_A | 274 | Putative methyltransferase MJ0026; tRNA, M5C, ross | 82.17 | |
| 3frh_A | 253 | 16S rRNA methylase; methyltransferase domain, heli | 82.08 | |
| 3dmg_A | 381 | Probable ribosomal RNA small subunit methyltransf; | 81.57 | |
| 1hw1_A | 239 | FADR, fatty acid metabolism regulator protein; hel | 81.44 | |
| 2r6z_A | 258 | UPF0341 protein in RSP 3' region; alpha-beta prote | 81.2 | |
| 3ic7_A | 126 | Putative transcriptional regulator; helix-turn-hel | 80.93 | |
| 3kor_A | 119 | Possible Trp repressor; putative DNA-binding Trp r | 80.82 | |
| 3dv8_A | 220 | Transcriptional regulator, CRP/FNR family; cyclic | 80.73 | |
| 2oz6_A | 207 | Virulence factor regulator; winged helix, helix-tu | 80.64 | |
| 4ets_A | 162 | Ferric uptake regulation protein; metal binding pr | 80.54 | |
| 3fpf_A | 298 | Mtnas, putative uncharacterized protein; thermonic | 80.43 | |
| 2zcw_A | 202 | TTHA1359, transcriptional regulator, FNR/CRP famil | 80.21 |
| >3p9c_A Caffeic acid O-methyltransferase; S-adenosylmethionine dependent O-methyltransferase; HET: SAH; 1.80A {Lolium perenne} PDB: 3p9i_A* 3p9k_A* | Back alignment and structure |
|---|
Probab=100.00 E-value=8.4e-34 Score=243.95 Aligned_cols=201 Identities=46% Similarity=0.811 Sum_probs=176.6
Q ss_pred cchhcchHHHHHHHHHhhchHHHHHHHHHhhChhhHHhhcCCCCCCCHHHHHHHhcC-CCCCCcc---cHHHHHHHHhcc
Q 036188 5 VDGERDQSFAYADQLATGVVLPMAIQAVYELGIFEILDKAGPGTKLSASDIAAQLLT-KNKDAPM---MLDRILRLLASY 80 (210)
Q Consensus 5 ~~~~~~~~~~~l~~~~~~~~~~~al~~a~~lglfd~L~~~g~~~~~t~~eLA~~~~~-~~~~~~~---~l~rlLr~L~~~ 80 (210)
+..+..+++..+++++++++.+++|++|++|||||.|++.| ++|+|++|||+++++ + +|+ .|+||||+|++.
T Consensus 13 ~~~~~~~~~~~~~~l~~~~~~~~~l~~a~~Lgifd~L~~~g-~~~~t~~eLA~~~g~~~---~~~~~~~l~rlLr~L~~~ 88 (364)
T 3p9c_A 13 AASADEDACMFALQLASSSVLPMTLKNAIELGLLEILVAAG-GKSLTPTEVAAKLPSAA---NPEAPDMVDRILRLLASY 88 (364)
T ss_dssp CHHHHHHHHHHHHHHTTTTHHHHHHHHHHHHTHHHHHHHTT-TCCBCHHHHHHTTTCTT---CTTHHHHHHHHHHHHHHT
T ss_pred cchHHHHHHHHHHHHHHhHHHHHHHHHHHHCChHHHHhhcC-CCCCCHHHHHHhcCCCC---CccchhhHHHHHHHHHhC
Confidence 66778899999999999999999999999999999999853 259999999999994 3 555 999999999999
Q ss_pred cceeeecc---CCCcccceeccccccccccCCCCCChHHHHHHhcChhHHHHHhhHHHHHhcCCchhhhhhCCchhHhhc
Q 036188 81 SVVECSLD---ASGARRLYSLNSVSKYYVPNKDGVLLGPLIQIIQDKVILESWSQLKDAILEGGIPFNRAHGVHIFEYAG 157 (210)
Q Consensus 81 gl~~~~~~---~~~~~~~y~~t~~s~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~L~~~l~~g~~~f~~~~g~~~fe~l~ 157 (210)
|+|++... ++..++.|++|+.++.|+.+..+.++++++.+...+.+++.|.+|++++++|.+||+.++|.++|+|+.
T Consensus 89 g~l~~~~~~~~~g~~~~~y~~t~~s~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~L~~~~r~g~~~~~~~~g~~~~~~~~ 168 (364)
T 3p9c_A 89 NVVTCLVEEGKDGRLSRSYGAAPVCKFLTPNEDGVSMAALALMNQDKVLMESWYYLKDAVLDGGIPFNKAYGMSAFEYHG 168 (364)
T ss_dssp TSEEEEEEECSSSCEEEEEEECGGGGGSSCCTTSCCTHHHHHHHTSHHHHGGGGGHHHHHHHCSCHHHHHHSSCHHHHHT
T ss_pred CCEEEeccccCCCCcCCEEecCHHHHHHcCCCCCCCHHHHHHHhcCHHHHHHHhCHHHHHhhCCChHHHhcCCCHHHHHH
Confidence 99998620 000147899999999887665335899998887777888999999999999999999999999999999
Q ss_pred cCchHHHHHHHHHhhhhhhhHHHHHHhCCCCCCCCeEEEecCCccHHHHhhh
Q 036188 158 LNPRFNKHFNAAMYNYTSLVMSNILESYKGFDNIKQLVDVGGSLGVTLQAIT 209 (210)
Q Consensus 158 ~~p~~~~~f~~~M~~~~~~~~~~~l~~~~~~~~~~~vvDiGGg~G~~~~~l~ 209 (210)
++|+..+.|+++|...+......+++.+++|++..+|||||||+|.++..++
T Consensus 169 ~~~~~~~~f~~~m~~~~~~~~~~~~~~~~~~~~~~~vlDvG~G~G~~~~~l~ 220 (364)
T 3p9c_A 169 TDPRFNRVFNEGMKNHSIIITKKLLELYHGFEGLGTLVDVGGGVGATVAAIA 220 (364)
T ss_dssp TCHHHHHHHHHHHHHHHHHHHHHHHHHCCTTTTCSEEEEETCTTSHHHHHHH
T ss_pred hCHHHHHHHHHHHHHhhHHHHHHHHHhcccccCCCEEEEeCCCCCHHHHHHH
Confidence 9999999999999998888888899998768889999999999999999886
|
| >3reo_A (ISO)eugenol O-methyltransferase; directed evolution, saturation mutagenesis, regioselectivity transferase; HET: SAH EUG; 1.90A {Clarkia breweri} PDB: 3tky_A* 1kyz_A* 1kyw_A* | Back alignment and structure |
|---|
| >3lst_A CALO1 methyltransferase; calicheamicin, enediyne, SAH, STRU genomics, PSI-2, protein structure initiative; HET: SAH; 2.40A {Micromonospora echinospora} | Back alignment and structure |
|---|
| >4a6d_A Hydroxyindole O-methyltransferase; melatonin, circadian clock; HET: SAM; 2.40A {Homo sapiens} PDB: 4a6e_A* | Back alignment and structure |
|---|
| >3gwz_A MMCR; methyltransferase, mitomycin, S-adenosyl methionine, transferase; HET: MSE SAH; 1.91A {Streptomyces lavendulae} PDB: 3gxo_A* | Back alignment and structure |
|---|
| >1zg3_A Isoflavanone 4'-O-methyltransferase; rossman fold, plant Pro transferase; HET: 2HI SAH; 2.35A {Medicago truncatula} PDB: 1zga_A* 1zhf_A* 1zgj_A* | Back alignment and structure |
|---|
| >1fp2_A Isoflavone O-methyltransferase; protein-product complex; HET: SAH HMO; 1.40A {Medicago sativa} SCOP: a.4.5.29 c.66.1.12 PDB: 1fpx_A* 2qyo_A* | Back alignment and structure |
|---|
| >2ip2_A Probable phenazine-specific methyltransferase; pyocyanin, phenazine-1-carboxy PHZM; 1.80A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >3i53_A O-methyltransferase; CO-complex, rossmann-like fold; HET: SAH; 2.08A {Streptomyces carzinostaticus subsp} PDB: 3i58_A* 3i5u_A* 3i64_A* | Back alignment and structure |
|---|
| >1fp1_D Isoliquiritigenin 2'-O-methyltransferase; protein-substrate, protein-product complex; HET: SAH HCC; 1.82A {Medicago sativa} SCOP: a.4.5.29 c.66.1.12 PDB: 1fpq_A* | Back alignment and structure |
|---|
| >1qzz_A RDMB, aclacinomycin-10-hydroxylase; anthracycline, methyltransferase, polyketide, tailoring enzymes, structural proteomics in E spine; HET: SAM; 2.10A {Streptomyces purpurascens} SCOP: a.4.5.29 c.66.1.12 PDB: 1r00_A* 1xds_A* 1xdu_A* | Back alignment and structure |
|---|
| >3dp7_A SAM-dependent methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research; 2.33A {Bacteroides vulgatus} | Back alignment and structure |
|---|
| >1tw3_A COMT, carminomycin 4-O-methyltransferase; anthracycline, methylate, tailoring enzyme, polyketide, S-adenosyl-L-homocystein; HET: SAH ERT; 2.35A {Streptomyces peucetius} SCOP: a.4.5.29 c.66.1.12 PDB: 1tw2_A* | Back alignment and structure |
|---|
| >1x19_A CRTF-related protein; methyltransferase, bacteriochllochlorophyll, BCHU, SAM, SAH, adenosylmethyonine, S-adenosylhomocysteine, ADO-Met; 2.27A {Chlorobium tepidum} PDB: 1x1a_A* 1x1b_A* 1x1c_A* 1x1d_A* | Back alignment and structure |
|---|
| >2r3s_A Uncharacterized protein; methyltransferase domain, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE; 2.15A {Nostoc punctiforme} | Back alignment and structure |
|---|
| >3mcz_A O-methyltransferase; adomet_mtases, S-adenosylmethionine-dependent methyltransfer structural genomics, PSI-2; HET: MSE; 1.90A {Burkholderia thailandensis} | Back alignment and structure |
|---|
| >2qm3_A Predicted methyltransferase; putative methyltransferase, structural genomics, pyrococcus PSI-2, protein structure initiative; HET: MSE; 2.05A {Pyrococcus furiosus dsm 3638} | Back alignment and structure |
|---|
| >2heo_A Z-DNA binding protein 1; protein DLM1-Z-DNA complex, immune system-DNA complex; 1.70A {Mus musculus} PDB: 1j75_A | Back alignment and structure |
|---|
| >1qbj_A Protein (double-stranded RNA specific adenosine D (ADAR1)); protein-Z-DNA complex, hydrolase-DNA complex; HET: DNA; 2.10A {Homo sapiens} SCOP: a.4.5.19 PDB: 3f21_A* 3f22_A* 3f23_A* 3irr_A* 3irq_D* 2gxb_A 2acj_A 2l54_A | Back alignment and structure |
|---|
| >1y0u_A Arsenical resistance operon repressor, putative; structural genomics, protein structure initiative, PSI; HET: MSE; 1.60A {Archaeoglobus fulgidus} SCOP: a.4.5.5 | Back alignment and structure |
|---|
| >1qgp_A Protein (double stranded RNA adenosine deaminase); Z-alpha-Z-DNA binding domain, RNA-editing, Z-DNA recognition, ADAR1, helix- turn-helix; NMR {Homo sapiens} SCOP: a.4.5.19 | Back alignment and structure |
|---|
| >3b73_A PHIH1 repressor-like protein; winged-helix-turn-helix, structural genomics, PSI-2, protein structure initiative; 2.12A {Haloarcula marismortui atcc 43049} | Back alignment and structure |
|---|
| >3mq0_A Transcriptional repressor of the blcabc operon; helix-turn-helix, GAF fold, transcription repressor; 1.79A {Agrobacterium tumefaciens} | Back alignment and structure |
|---|
| >1xmk_A Double-stranded RNA-specific adenosine deaminase; winged helix-turn-helix, RNA editing, interferon, ADAR1, hydrolase; 0.97A {Homo sapiens} SCOP: a.4.5.19 | Back alignment and structure |
|---|
| >3pqk_A Biofilm growth-associated repressor; helix-turn-helix motif, winged-helix fold, transcriptional R DNA binding, transcription; 2.09A {Xylella fastidiosa} PDB: 3pqj_A | Back alignment and structure |
|---|
| >2y75_A HTH-type transcriptional regulator CYMR; DNA binding protein; 2.00A {Bacillus subtilis} | Back alignment and structure |
|---|
| >3jth_A Transcription activator HLYU; transcription factor, RTXA, DNA-binding, transcription regulation; 2.00A {Vibrio vulnificus} | Back alignment and structure |
|---|
| >2oqg_A Possible transcriptional regulator, ARSR family P; winged-helix-turn-helix, structural genomics, PSI-2, protein structure initiative; 1.54A {Rhodococcus SP} | Back alignment and structure |
|---|
| >1mkm_A ICLR transcriptional regulator; structural genomics, winged helix-turn-helix, PSI, protein structure initiative; 2.20A {Thermotoga maritima} SCOP: a.4.5.33 d.110.2.2 | Back alignment and structure |
|---|
| >2xrn_A HTH-type transcriptional regulator TTGV; DNA-binding protein, tetramer gene regulator, cooperative DN binding, multidrug binding protein; 2.90A {Pseudomonas putida} PDB: 2xro_A | Back alignment and structure |
|---|
| >2htj_A P fimbrial regulatory protein KS71A; winged helix-turn-helix, PAP PILI, transcription activator; NMR {Escherichia coli} SCOP: a.4.5.73 | Back alignment and structure |
|---|
| >1u2w_A CADC repressor, cadmium efflux system accessory protein; LEAD, SOFT metal ION resistance, ARSR/SM family, DNA binding protein; 1.90A {Staphylococcus aureus} SCOP: a.4.5.5 PDB: 3f72_A | Back alignment and structure |
|---|
| >3r4k_A Transcriptional regulator, ICLR family; DNA/RNA-binding 3-helical bundle, profilin-like, structural joint center for structural genomics, JCSG; 2.46A {Ruegeria SP} | Back alignment and structure |
|---|
| >1r1u_A CZRA, repressor protein; zinc, DNA binding, transcriptional regulation, winged HTH protein, transcription repressor; 2.00A {Staphylococcus aureus} SCOP: a.4.5.5 PDB: 1r1v_A 2kjb_A 2kjc_A | Back alignment and structure |
|---|
| >3cuo_A Uncharacterized HTH-type transcriptional regulato; DNA-binding transcriptional regulator, structural genomics, MCSG; 2.00A {Escherichia coli K12} | Back alignment and structure |
|---|
| >3ech_A MEXR, multidrug resistance operon repressor; winged helix, helix-turn-helix, protein-peptide complex; 1.80A {Pseudomonas aeruginosa} SCOP: a.4.5.28 PDB: 1lnw_A 3mex_A | Back alignment and structure |
|---|
| >3f6o_A Probable transcriptional regulator, ARSR family protein; transcriptional regulator,RHA00566,MCSG, structural genomics, PSI-2; 1.90A {Rhodococcus SP} | Back alignment and structure |
|---|
| >2kko_A Possible transcriptional regulatory protein (possibly ARSR-family); NESG, DNA-binding, transcription regulation, WHTH, homodimer; NMR {Mycobacterium bovis} PDB: 3gw2_A | Back alignment and structure |
|---|
| >2o0y_A Transcriptional regulator; ICLR-family, structural genomics, protein structure initiative, midwest center for structural genomics, MCSG; 2.00A {Rhodococcus SP} | Back alignment and structure |
|---|
| >2g7u_A Transcriptional regulator; ICLR family, structural genomics, PSI, protein structure initiative, midwest center for struc genomics; 2.30A {Rhodococcus SP} | Back alignment and structure |
|---|
| >2jt1_A PEFI protein; solution structure, winged helix-turn-helix, transcripti regulatory protein, structural genomics, PSI-2; NMR {Salmonella typhimurium LT2} | Back alignment and structure |
|---|
| >4a5n_A Uncharacterized HTH-type transcriptional regulato; activator, DNA binding, MARR-like; 1.81A {Bacillus subtilis} PDB: 4a5m_A | Back alignment and structure |
|---|
| >1xn7_A Hypothetical protein YHGG; alpha+beta, GFT structural genomics, protein structure initiative, PSI, NESG; NMR {Escherichia coli} SCOP: a.4.5.62 | Back alignment and structure |
|---|
| >2ia2_A Putative transcriptional regulator; SAD, PSI-2, structural genomics, structure initiative, midwest center for structural genomic transcription; 2.10A {Rhodococcus SP} | Back alignment and structure |
|---|
| >2hzt_A Putative HTH-type transcriptional regulator YTCD; DNA-binding protein, HTH-type transcription regulators, structural genomics, PSI-2; HET: CSU MSE; 2.00A {Bacillus subtilis} SCOP: a.4.5.69 | Back alignment and structure |
|---|
| >3lwf_A LIN1550 protein, putative transcriptional regulator; structural genomics, JOI for structural genomics, JCSG; HET: SO4; 2.06A {Listeria innocua} | Back alignment and structure |
|---|
| >1ub9_A Hypothetical protein PH1061; helix-turn-helix motif, winged helix motif, structural genom transcription; 2.05A {Pyrococcus horikoshii} SCOP: a.4.5.28 | Back alignment and structure |
|---|
| >1ylf_A RRF2 family protein; structural genomics, transcription regulator, P protein structure initiative; 2.50A {Bacillus cereus atcc 14579} SCOP: a.4.5.55 | Back alignment and structure |
|---|
| >3t8r_A Staphylococcus aureus CYMR; transcriptional regulator protein, dimer, sulfenic acid, UNK function; 1.70A {Staphylococcus aureus} PDB: 3t8t_A | Back alignment and structure |
|---|
| >1on2_A Transcriptional regulator MNTR; helix-turn-helix, DNA-binding protein, metalloregulatory protein; 1.61A {Bacillus subtilis} SCOP: a.4.5.24 a.76.1.1 PDB: 2ev0_A 1on1_A 2ev5_A 2ev6_A* 2f5c_A 2f5d_A 2f5e_A 2f5f_A 2hyf_A* 2hyg_D 3r60_A* 3r61_A* | Back alignment and structure |
|---|
| >2k02_A Ferrous iron transport protein C; FEOC, iron-sulfur, metal-binding, metal binding protein; NMR {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
| >3f6v_A Possible transcriptional regulator, ARSR family protein; probable transcriptional repressor ARSR family, structural genomics, PSI-2; 1.48A {Rhodococcus SP} | Back alignment and structure |
|---|
| >1r1t_A Transcriptional repressor SMTB; zinc, transcriptional regulation, winged HTH protein, DNA binding, transcription repressor; 1.70A {Synechococcus elongatus pcc 7942} SCOP: a.4.5.5 PDB: 1r23_A 1smt_A 1r22_A | Back alignment and structure |
|---|
| >1r7j_A Conserved hypothetical protein SSO10A; winged helix-turn-helix, two-stranded antiparallel coiled CO structural genomics, PSI; 1.47A {Sulfolobus solfataricus} SCOP: a.4.5.49 PDB: 1xsx_A | Back alignment and structure |
|---|
| >1oyi_A Double-stranded RNA-binding protein; (alpha+beta) helix-turn-helix, viral protein; NMR {Vaccinia virus} SCOP: a.4.5.19 | Back alignment and structure |
|---|
| >2wte_A CSA3; antiviral protein, viral resistance, winged helix-turn-helix prnai nucleotide-binding domain; HET: MSE; 1.80A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >2lnb_A Z-DNA-binding protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, immune system; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3k69_A Putative transcription regulator; putative transcriptional regulator, structural genomics, JOI for structural genomics, JCSG; HET: MSE; 1.95A {Lactobacillus plantarum} SCOP: a.4.5.0 | Back alignment and structure |
|---|
| >3df8_A Possible HXLR family transcriptional factor; APC89000, structural genomics, midwest center for structural genomics, MCSG; 1.65A {Thermoplasma volcanium} SCOP: a.4.5.0 | Back alignment and structure |
|---|
| >3r0a_A Putative transcriptional regulator; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.31A {Methanosarcina mazei} | Back alignment and structure |
|---|
| >3fm5_A Transcriptional regulator; MCSG, PF04017, PSI, MARR, structu genomics, protein structure initiative, midwest center for structural genomics; HET: GOL; 2.00A {Rhodococcus jostii} | Back alignment and structure |
|---|
| >2hr3_A Probable transcriptional regulator; MCSG, structural genomics, PSI-2, protein structure initiati midwest center for structural genomics; 2.40A {Pseudomonas aeruginosa} SCOP: a.4.5.28 | Back alignment and structure |
|---|
| >1xd7_A YWNA; structural genomics, protein structure initiative, winged HE binding, hypothetical protein, PSI; 2.30A {Bacillus subtilis subsp} SCOP: a.4.5.55 | Back alignment and structure |
|---|
| >2fu4_A Ferric uptake regulation protein; DNA binding domain, helix-turn-helix, DNA binding protein; 1.80A {Escherichia coli} | Back alignment and structure |
|---|
| >1z7u_A Hypothetical protein EF0647; winged-helix-turn-helix, MARR, structural genomics, PSI, Pro structure initiative; 2.20A {Enterococcus faecalis} SCOP: a.4.5.69 | Back alignment and structure |
|---|
| >2fsw_A PG_0823 protein; alpha-beta structure, helix-turn-helix, winged-helix-turn-HE structural genomics, PSI, protein structure initiative; HET: MSE; 2.16A {Porphyromonas gingivalis} SCOP: a.4.5.69 | Back alignment and structure |
|---|
| >2h09_A Transcriptional regulator MNTR; transcription regulator, diphtheria toxin, manganese transport, structural genomics, NPPSFA; 2.10A {Escherichia coli} | Back alignment and structure |
|---|
| >2lkp_A Transcriptional regulator, ARSR family; symmetric homodimer, NI(II) binding protein, DNA binding Pro transcription regulator; NMR {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >2x4h_A Hypothetical protein SSO2273; transcription; 2.30A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >2f2e_A PA1607; transcription factor, helix-TRUN-helix, APC5613, structural genomics, PSI, protein structure initiative; HET: GLC; 1.85A {Pseudomonas aeruginosa} SCOP: a.4.5.69 | Back alignment and structure |
|---|
| >3vc1_A Geranyl diphosphate 2-C-methyltransferase; rossmann fold, methyltransferase fold, SAM-dependent methyltransferase; HET: SAH GST GOL; 1.82A {Streptomyces coelicolor} PDB: 3vc2_A* 4f84_A* 4f85_A 4f86_A* | Back alignment and structure |
|---|
| >3bdd_A Regulatory protein MARR; putative multiple antibiotic-resistance repressor, structura genomics, joint center for structural genomics, JCSG; 2.20A {Streptococcus suis} | Back alignment and structure |
|---|
| >1sfx_A Conserved hypothetical protein AF2008; structural genomics, HTH MOT protein structure initiative, midwest center for structural genomics; 1.55A {Archaeoglobus fulgidus} SCOP: a.4.5.50 | Back alignment and structure |
|---|
| >3k0l_A Repressor protein; helix-turn-helix, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.35A {Acinetobacter SP} | Back alignment and structure |
|---|
| >3bja_A Transcriptional regulator, MARR family, putative; NP_978771.1, putative MARR-like transcription regulator, MAR structural genomics; 2.38A {Bacillus cereus} | Back alignment and structure |
|---|
| >2zkz_A Transcriptional repressor PAGR; protein-DNA, HTH motif, dimer, DN binding, transcription regulation; 2.00A {Bacillus anthracis} | Back alignment and structure |
|---|
| >1tbx_A ORF F-93, hypothetical 11.0 kDa protein; sulfolobus spindle virus, winged helix, fusellovirus; 2.70A {Sulfolobus virus 1} SCOP: a.4.5.48 | Back alignment and structure |
|---|
| >1jg1_A PIMT;, protein-L-isoaspartate O-methyltransferase; rossmann methyltransferase, protein repair isomerization; HET: SAH; 1.20A {Pyrococcus furiosus} SCOP: c.66.1.7 PDB: 1jg2_A* 1jg3_A* 1jg4_A* | Back alignment and structure |
|---|
| >3g3z_A NMB1585, transcriptional regulator, MARR family; transcription factor, structur genomics, oxford protein production facility; 2.10A {Neisseria meningitidis serogroup B} | Back alignment and structure |
|---|
| >1yyv_A Putative transcriptional regulator; reductive methylation, D lysine, structural genomics, PSI; HET: MLY; 2.35A {Salmonella typhimurium} SCOP: a.4.5.69 | Back alignment and structure |
|---|
| >3dli_A Methyltransferase; PSI-II, NYSGXRC, structural genomics, protein structure initiative; 2.46A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >3hsr_A HTH-type transcriptional regulator SARZ; helix-turn-helix, cysteine disulfide, MARR-family transcript regulator, DNA-binding; 1.90A {Staphylococcus aureus subsp} PDB: 3hse_A 3hrm_A 4gxo_A | Back alignment and structure |
|---|
| >3bpv_A Transcriptional regulator; MARR, DNA binding, transcription factor, winged helix motif, DNA-binding; 1.40A {Methanobacterium thermoautotrophicum} PDB: 3bpx_A* | Back alignment and structure |
|---|
| >3bro_A Transcriptional regulator; helix_TURN_helix, multiple antibiotic resistance protein (MA structural genomics, PSI-2, protein structure initiative; HET: MSE; 2.04A {Oenococcus oeni} SCOP: a.4.5.28 | Back alignment and structure |
|---|
| >2nnn_A Probable transcriptional regulator; structural genomics, PSI-2, protein structure initiative, M center for structural genomics, MCSG; 2.40A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >3nrv_A Putative transcriptional regulator (MARR/EMRR FAM; PSI-2, protein structure initiati structural genomics; HET: MSE; 2.00A {Acinetobacter SP} | Back alignment and structure |
|---|
| >2a61_A Transcriptional regulator TM0710; APC4350, MCSG, midwest center for structural genomics, PSI, protein structure initiative, MARR; 1.80A {Thermotoga maritima} SCOP: a.4.5.28 | Back alignment and structure |
|---|
| >1s3j_A YUSO protein; structural genomics, MARR transcriptional regulator family, PSI, protein structure initiative; HET: MSE; 2.25A {Bacillus subtilis} SCOP: a.4.5.28 | Back alignment and structure |
|---|
| >2bv6_A MGRA, HTH-type transcriptional regulator MGRA; multidrug resistance regulator, virulence determinant, transcriptional factors; 2.8A {Staphylococcus aureus} SCOP: a.4.5.28 | Back alignment and structure |
|---|
| >3oop_A LIN2960 protein; protein structure initiative, PSI-2, structural genomics, MI center for structural genomics, MCSG, unknown function; 1.78A {Listeria innocua} | Back alignment and structure |
|---|
| >3bj6_A Transcriptional regulator, MARR family; helix-turn-helix, trasnscription regulator, STR genomics, PSI-2, protein structure initiative; 2.01A {Silicibacter pomeroyi dss-3} | Back alignment and structure |
|---|
| >2qvo_A Uncharacterized protein AF_1382; PSI, structural genomics, southeast collaboratory for structural genomics; 1.85A {Archaeoglobus fulgidus dsm 4304} PDB: 3o3k_A 3ov8_A | Back alignment and structure |
|---|
| >1jgs_A Multiple antibiotic resistance protein MARR; transcription regulation, DNA-binding, repressor, transcription; HET: SAL; 2.30A {Escherichia coli} SCOP: a.4.5.28 | Back alignment and structure |
|---|
| >3bkw_A MLL3908 protein, S-adenosylmethionine dependent methyltransferase; NP_104914.1; HET: MSE; 1.60A {Mesorhizobium loti} | Back alignment and structure |
|---|
| >2fa5_A Transcriptional regulator MARR/EMRR family; multiple antibiotics resistance repressor, XCC structural genomics, X-RAY diffraction; 1.80A {Xanthomonas campestris} | Back alignment and structure |
|---|
| >1q1h_A TFE, transcription factor E, TFE; TFIIE, transcription initiation, preinitiation complex, RNA polymerase II, transcription bubble; 2.90A {Sulfolobus solfataricus} SCOP: a.4.5.41 | Back alignment and structure |
|---|
| >3ou2_A SAM-dependent methyltransferase; O-methyltransferase, SAH; HET: SAH; 1.50A {Streptomyces luridus} PDB: 3ou6_A* 3ou7_A* | Back alignment and structure |
|---|
| >2rdp_A Putative transcriptional regulator MARR; PFAM PF01047, winged-helix binding motif, structural genomics, PSI-2; 2.30A {Geobacillus stearothermophilus} | Back alignment and structure |
|---|
| >2pg4_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, DNA binding protein; HET: MSE CIT; 2.21A {Aeropyrum pernix} SCOP: a.4.5.48 | Back alignment and structure |
|---|
| >1xtp_A LMAJ004091AAA; SGPP, structural genomics, PSI, protein structure initiative dependent methyltransferase; HET: SAI; 1.94A {Leishmania major} SCOP: c.66.1.42 | Back alignment and structure |
|---|
| >2pex_A Transcriptional regulator OHRR; transcription regulator; 1.90A {Xanthomonas campestris} PDB: 2pfb_A | Back alignment and structure |
|---|
| >3boq_A Transcriptional regulator, MARR family; MARR famil structural genomics, PSI-2, protein structure initiative; 2.39A {Silicibacter pomeroyi dss-3} | Back alignment and structure |
|---|
| >3cdh_A Transcriptional regulator, MARR family; helix-turn-hleix, structura genomics, PSI-2, protein structure initiative; 2.69A {Silicibacter pomeroyi dss-3} | Back alignment and structure |
|---|
| >2fbh_A Transcriptional regulator PA3341; MARR, transcription regulator, APC5857, structural genomics, protein structure initiative; 1.80A {Pseudomonas aeruginosa} SCOP: a.4.5.28 | Back alignment and structure |
|---|
| >2nyx_A Probable transcriptional regulatory protein, RV14; alpha/beta, structural genomics, PSI-2; 2.30A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >1bja_A Transcription regulatory protein MOTA; activation domain, middle mode transcription, alpha helical structure, transcription regulation; 2.19A {Enterobacteria phage T4} SCOP: a.4.5.9 PDB: 1i1s_A | Back alignment and structure |
|---|
| >3bus_A REBM, methyltransferase; rebeccamycin synthesis; HET: SAH; 2.65A {Lechevalieria aerocolonigenes} | Back alignment and structure |
|---|
| >3tgn_A ADC operon repressor ADCR; helix-turn-helix, transcriptional regulator, transcription; 2.00A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >3deu_A Transcriptional regulator SLYA; MARR, WING-helix, transcription regulator, activator, DNA-binding, repressor; HET: SAL; 2.30A {Salmonella typhimurium} SCOP: a.4.5.28 | Back alignment and structure |
|---|
| >3f3x_A Transcriptional regulator, MARR family, putative; DNA binding protein, DNA-binding, transcription regulation; 1.90A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >2obp_A Putative DNA-binding protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE; 1.70A {Ralstonia eutropha} SCOP: a.4.5.71 | Back alignment and structure |
|---|
| >2cfx_A HTH-type transcriptional regulator LRPC; transcriptional regulation, DNA binding, FFRP; 2.4A {Bacillus subtilis} SCOP: a.4.5.32 d.58.4.2 | Back alignment and structure |
|---|
| >2eth_A Transcriptional regulator, putative, MAR family; MARR family, structural genomics, joint center for structura genomics, JCSG; 2.30A {Thermotoga maritima} SCOP: a.4.5.28 | Back alignment and structure |
|---|
| >1lj9_A Transcriptional regulator SLYA; HTH DNA binding protein, structural genomics, PSI, protein structure initiative; 1.60A {Enterococcus faecalis} SCOP: a.4.5.28 | Back alignment and structure |
|---|
| >3s2w_A Transcriptional regulator, MARR family; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics; 2.45A {Methanosarcina mazei} | Back alignment and structure |
|---|
| >2gxg_A 146AA long hypothetical transcriptional regulator; winged helix; 1.45A {Sulfolobus tokodaii} PDB: 2eb7_A 2yr2_A 3gez_A 3gf2_A* 3gfi_A 3gfm_A 3gfj_A 3gfl_A | Back alignment and structure |
|---|
| >3e6m_A MARR family transcriptional regulator; APC88769, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; 2.20A {Silicibacter pomeroyi} | Back alignment and structure |
|---|
| >2qww_A Transcriptional regulator, MARR family; YP_013417.1, multiple antibiotic-resistance repressor (MARR) structural genomics; HET: MSE; 2.07A {Listeria monocytogenes str} | Back alignment and structure |
|---|
| >2w25_A Probable transcriptional regulatory protein; transcription regulation, mutant, RV3291C, Glu104Ala, DNA-binding; 2.15A {Mycobacterium tuberculosis} PDB: 2vbw_A* 2vbx_A* 2vby_A* 2vbz_A* 2vc0_A 2vc1_A 2w24_A 2ivm_A 2w29_A 2qz8_A | Back alignment and structure |
|---|
| >2fbi_A Probable transcriptional regulator; MARR, APC5816, structural genomic protein structure initiative; 2.10A {Pseudomonas aeruginosa} SCOP: a.4.5.28 | Back alignment and structure |
|---|
| >1z91_A Organic hydroperoxide resistance transcriptional; OHRR, MARR family, bacterial transcription factor, DNA bindi protein; 2.50A {Bacillus subtilis} SCOP: a.4.5.28 PDB: 1z9c_A* | Back alignment and structure |
|---|
| >3cjn_A Transcriptional regulator, MARR family; silicibacter pomeroy structural genomics, PSI-2, protein structure initiative; 1.95A {Silicibacter pomeroyi dss-3} | Back alignment and structure |
|---|
| >4hbl_A Transcriptional regulator, MARR family; HTH, transcription factor, DNA binding; 2.50A {Staphylococcus epidermidis} | Back alignment and structure |
|---|
| >4g6q_A Putative uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics, MCSG; 2.08A {Kribbella flavida} | Back alignment and structure |
|---|
| >3eco_A MEPR; mutlidrug efflux pump regulator winged helix-turn-helix motif, DNA-binding, transcription, transcription regulation; 2.40A {Staphylococcus aureus} SCOP: a.4.5.0 | Back alignment and structure |
|---|
| >3hrs_A Metalloregulator SCAR; DTXR/MNTR family member, transcription; 2.70A {Streptococcus gordonii} PDB: 3hrt_A 3hru_A | Back alignment and structure |
|---|
| >2p4w_A Transcriptional regulatory protein ARSR family; archaea, PHR, heat shock, transcriptional regulation, winged DNA binding; 2.60A {Pyrococcus furiosus} SCOP: a.4.5.64 | Back alignment and structure |
|---|
| >3kp7_A Transcriptional regulator TCAR; multiple drug resistance, biofilm, transcription regulation, binding, transcription regulator; 2.30A {Staphylococcus epidermidis RP62A} PDB: 3kp3_A* 3kp4_A* 3kp5_A* 3kp2_A* 3kp6_A | Back alignment and structure |
|---|
| >1p6r_A Penicillinase repressor; transcription regulation, DNA-binding, winged helix protein, bacterial resistance to antibiotics; NMR {Bacillus licheniformis} SCOP: a.4.5.39 PDB: 2p7c_B | Back alignment and structure |
|---|
| >3dlc_A Putative S-adenosyl-L-methionine-dependent methyltransferase; structural genomics, joint center for structural genomics; HET: MSE SAM; 1.15A {Methanococcus maripaludis} | Back alignment and structure |
|---|
| >3g5l_A Putative S-adenosylmethionine dependent methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.35A {Listeria monocytogenes str} | Back alignment and structure |
|---|
| >2zfu_A Nucleomethylin, cerebral protein 1; nucleolar protein, SAM-binding protein, protein structure, N phosphoprotein, nuclear protein; HET: SAH; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3iv6_A Putative Zn-dependent alcohol dehydrogenase; alpha/beta fold, rossmann-fold, structural genomics, PSI-2, structure initiative; HET: SAM; 2.70A {Rhodobacter sphaeroides} | Back alignment and structure |
|---|
| >2p5v_A Transcriptional regulator, LRP/ASNC family; NMB0573, structu genomics; 1.99A {Neisseria meningitidis} PDB: 2p6s_A 2p6t_A | Back alignment and structure |
|---|
| >2pn6_A ST1022, 150AA long hypothetical transcriptional regulator; LRP/ASNC family Gln binding, structural genomics, NPPSFA; HET: GLN; 1.44A {Sulfolobus tokodaii} PDB: 2efn_A* 2e7x_A* 2e7w_A* 2yx4_A* 2efq_A* 2pmh_A* 2yx7_A* 2efp_A* 2efo_A* | Back alignment and structure |
|---|
| >3ofk_A Nodulation protein S; NODS, N-methyltransferase, SAH, SAM, NOD factor, fixation, symbiosis, alpha/beta structure; HET: SAH; 1.85A {Bradyrhizobium SP} PDB: 3ofj_A* | Back alignment and structure |
|---|
| >4gek_A TRNA (CMO5U34)-methyltransferase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, rossmann fold; HET: GEK; 1.50A {Escherichia coli} PDB: 1im8_A* | Back alignment and structure |
|---|
| >4aik_A Transcriptional regulator SLYA; transcription, transcription factor; 1.85A {Yersinia pseudotuberculosis} PDB: 4aih_A 4aij_A 3qpt_A* 3q5f_A* | Back alignment and structure |
|---|
| >3hem_A Cyclopropane-fatty-acyl-phospholipid synthase 2; protein-ligand complex, cytoplasm, lipid synthesis, methyltransferase; HET: D22; 2.39A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kpi_A* | Back alignment and structure |
|---|
| >3cgg_A SAM-dependent methyltransferase; NP_600671.1, methyltransferase domain, structural genomics; HET: NHE CIT; 2.00A {Corynebacterium glutamicum atcc 13032} | Back alignment and structure |
|---|
| >2o57_A Putative sarcosine dimethylglycine methyltransferase; structural genomics, protein structure initiative, PSI-2; 1.95A {Galdieria sulphuraria} SCOP: c.66.1.18 | Back alignment and structure |
|---|
| >1dus_A MJ0882; hypothetical protein, methanococcus jannaschii, structural genomics, BSGC structure funded by NIH; 1.80A {Methanocaldococcus jannaschii} SCOP: c.66.1.4 | Back alignment and structure |
|---|
| >3bkx_A SAM-dependent methyltransferase; YP_807781.1, cyclopropane-fatty-acyl-phospholipid synthase-L protein, methyltransferase domain; 1.85A {Lactobacillus casei} | Back alignment and structure |
|---|
| >2d1h_A ST1889, 109AA long hypothetical transcriptional regulator; helix-turn-helix, intermolecular and intramolecular S-S bond structural genomics; 2.05A {Sulfolobus tokodaii} SCOP: a.4.5.50 | Back alignment and structure |
|---|
| >3ujc_A Phosphoethanolamine N-methyltransferase; parasite; HET: PC; 1.19A {Plasmodium falciparum} PDB: 3uj9_A* 3uj6_A* 3uj7_A* 3uj8_A* 3uja_A 3ujb_A* 4fgz_A* 3ujd_A* | Back alignment and structure |
|---|
| >2dbb_A Putative HTH-type transcriptional regulator PH006; ASNC family, helix-turn-helix (HTH) domain, structural genom NPPSFA; 2.00A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >3u2r_A Regulatory protein MARR; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, helix-turn-helix; 2.20A {Planctomyces limnophilus} | Back alignment and structure |
|---|
| >2cg4_A Regulatory protein ASNC; DNA binding, FFRP, LRP family, transcription, DNA- binding, transcription regulation; 2.4A {Escherichia coli} SCOP: a.4.5.32 d.58.4.2 | Back alignment and structure |
|---|
| >3pfg_A N-methyltransferase; N,N-dimethyltransferase, SAM binding, DTDP-linked sugar BIND transferase; HET: SAM TLO; 1.35A {Streptomyces fradiae} PDB: 3pfh_A* 3px3_A* 3px2_A* | Back alignment and structure |
|---|
| >1yb2_A Hypothetical protein TA0852; structural genomics, methyltransferase, thermoplasma acidoph midwest center for structural genomics, MCSG; 2.01A {Thermoplasma acidophilum} SCOP: c.66.1.13 | Back alignment and structure |
|---|
| >1uly_A Hypothetical protein PH1932; helix-turn-helix, structural genomics, DNA binding protein; 2.50A {Pyrococcus horikoshii} SCOP: a.4.5.58 PDB: 2cwe_A | Back alignment and structure |
|---|
| >2qlz_A Transcription factor PF0095; 2.50A {Pyrococcus furiosus} PDB: 2quf_A | Back alignment and structure |
|---|
| >4e2x_A TCAB9; kijanose, tetronitrose, tetradeoxy sugar, sugar methylation, transferase; HET: SAH TYD; 1.40A {Micromonospora chalcea} PDB: 3ndi_A* 3ndj_A* 4e32_A* 4e33_A* 4e2y_A* 4e31_A* 4e2w_A* 4e2z_A* 4e30_A* | Back alignment and structure |
|---|
| >2cyy_A Putative HTH-type transcriptional regulator PH151; structural genomics, pyrococcus horikosii OT3, NPPSFA; HET: MSE GLN; 1.80A {Pyrococcus horikoshii} SCOP: a.4.5.32 d.58.4.2 | Back alignment and structure |
|---|
| >2frh_A SARA, staphylococcal accessory regulator A; winged-helix protein, divalent metal binding, transcription; 2.50A {Staphylococcus aureus} SCOP: a.4.5.28 PDB: 2fnp_A 1fzp_D | Back alignment and structure |
|---|
| >2ia0_A Putative HTH-type transcriptional regulator PF086; ASNC, PSI, structural genomics, southeast collaboratory for structural genomics; 2.37A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >4htf_A S-adenosylmethionine-dependent methyltransferase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE SAM; 1.60A {Escherichia coli} | Back alignment and structure |
|---|
| >1ku9_A Hypothetical protein MJ223; putative transcription factor, homodimeric winged-helix fold, structural genomics, PSI; 2.80A {Methanocaldococcus jannaschii} SCOP: a.4.5.36 | Back alignment and structure |
|---|
| >3e05_A Precorrin-6Y C5,15-methyltransferase (decarboxyla; porphyrin metabolism, S-adenosyl-methionine; 1.80A {Geobacter metallireducens} SCOP: c.66.1.0 | Back alignment and structure |
|---|
| >1j5y_A Transcriptional regulator, biotin repressor famil; structural genomics, TM1602, BIOT repressor family, JCSG, conserved hypothetical protein; 2.30A {Thermotoga maritima} SCOP: a.4.5.1 d.94.2.1 | Back alignment and structure |
|---|
| >1kpg_A CFA synthase;, cyclopropane-fatty-acyl-phospholipid synthase 1; mixed alpha beta fold, structural genomics, PSI; HET: SAH 16A; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kp9_A* 1kph_A* 1tpy_A* 1l1e_A* | Back alignment and structure |
|---|
| >1okr_A MECI, methicillin resistance regulatory protein MECI; bacterial antibiotic resistance, MECI protein, transcriptional regulatory element; 2.4A {Staphylococcus aureus} SCOP: a.4.5.39 PDB: 1sax_A 1sd7_A 2d45_A 1sd6_A | Back alignment and structure |
|---|
| >2fk8_A Methoxy mycolic acid synthase 4; S-adenosylmethionine-dependent methyltransferase fold, trans; HET: SAM; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 2fk7_A* 3ha3_A* 3ha5_A* 3ha7_A* | Back alignment and structure |
|---|
| >3dtn_A Putative methyltransferase MM_2633; structural genomics, unknown function, PSI-2, protein structure initiative; 2.09A {Methanosarcina mazei} | Back alignment and structure |
|---|
| >1i9g_A Hypothetical protein RV2118C; mtase, adoMet, crystal, structural genomics, protein structure initiative; HET: SAM; 1.98A {Mycobacterium tuberculosis} SCOP: c.66.1.13 | Back alignment and structure |
|---|
| >2o03_A Probable zinc uptake regulation protein FURB; DNA-binding, helix-turn-helix, zinc binding, GE regulation; 2.70A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >1i1g_A Transcriptional regulator LRPA; helix-turn-helix, LRP/ASNC family; 2.90A {Pyrococcus furiosus} SCOP: a.4.5.32 d.58.4.2 | Back alignment and structure |
|---|
| >2fxa_A Protease production regulatory protein HPR; protease porduction, regulation, STR genomics, PSI, protein structure initiative; HET: PGE P6G 1PE; 2.40A {Bacillus subtilis} SCOP: a.4.5.28 | Back alignment and structure |
|---|
| >2y1w_A Histone-arginine methyltransferase CARM1; histone modification; HET: SFG 849; 2.10A {Homo sapiens} PDB: 2y1x_A* 3b3f_A* 3b3g_A 2v74_B* 2v7e_A | Back alignment and structure |
|---|
| >4fx0_A Probable transcriptional repressor protein; helix-turn-helix, DNA binding, transcription regulator; 2.70A {Mycobacterium tuberculosis} PDB: 4fx4_A* | Back alignment and structure |
|---|
| >2fbk_A Transcriptional regulator, MARR family; winged-helix-turn-helix; 2.30A {Deinococcus radiodurans} SCOP: a.4.5.28 | Back alignment and structure |
|---|
| >3k2z_A LEXA repressor; winged helix-turn-helix, SOS system, autoca cleavage, DNA damage, DNA repair, DNA replication, DNA-BIND hydrolase; 1.37A {Thermotoga maritima} | Back alignment and structure |
|---|
| >2dk5_A DNA-directed RNA polymerase III 39 kDa polypeptide; structural genomics, winged helix domain, NPPSFA; NMR {Homo sapiens} SCOP: a.4.5.85 | Back alignment and structure |
|---|
| >3jw4_A Transcriptional regulator, MARR/EMRR family; DNA-binding protein, structural genomics, PSI-2, protein structure initiative; HET: MSE; 2.10A {Clostridium acetobutylicum} SCOP: a.4.5.0 | Back alignment and structure |
|---|
| >2k4b_A Transcriptional regulator; DNA binding protein, winged helix; NMR {Lactococcus lactis subsp} | Back alignment and structure |
|---|
| >3b3j_A Histone-arginine methyltransferase CARM1; protein arginine methyltransferase 4, APO catalytic domain, regulator, mRNA processing; 2.55A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3i4p_A Transcriptional regulator, ASNC family; PSI, structural genom protein structure initiative, midwest center for structural genomics; 2.30A {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >3kkz_A Uncharacterized protein Q5LES9; putative methyltransferase, BFR250, NESG, structural genomics, PSI-2; HET: SAM; 1.68A {Bacteroides fragilis nctc 9343} PDB: 3e7p_A 3t7s_A* 3t7r_A* 3t7t_A* | Back alignment and structure |
|---|
| >3e8s_A Putative SAM dependent methyltransferase; NP_744700.1, structural genomics, joint center for structural genom JCSG; HET: SAH; 2.10A {Pseudomonas putida KT2440} | Back alignment and structure |
|---|
| >1sfu_A 34L protein; protein/Z-DNA complex, DNA binding protein/DNA complex; 2.00A {Yaba-like disease virus} SCOP: a.4.5.19 | Back alignment and structure |
|---|
| >1jsx_A Glucose-inhibited division protein B; methyltransferase fold, structural genomics, PSI, protein structure initiative; 2.40A {Escherichia coli} SCOP: c.66.1.20 | Back alignment and structure |
|---|
| >3nqo_A MARR-family transcriptional regulator; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE PG4; 2.20A {Clostridium difficile} | Back alignment and structure |
|---|
| >3njr_A Precorrin-6Y methylase; methyltransferase, decarboxylase, transferase; HET: SAH PG4; 2.70A {Rhodobacter capsulatus} | Back alignment and structure |
|---|
| >3lbf_A Protein-L-isoaspartate O-methyltransferase; modified rossman-type fold, S-adenosyl-L- methionine; HET: SAH; 1.80A {Escherichia coli} | Back alignment and structure |
|---|
| >3f4k_A Putative methyltransferase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacteroides thetaiotaomicron} PDB: 3t0i_A* 3svz_A* 3sxj_A* | Back alignment and structure |
|---|
| >3g2m_A PCZA361.24; SAM-dependent methyltransferase, glycopeptide antibiotics biosynthesis, structural genomics; 2.00A {Amycolatopsis orientalis} PDB: 3g2o_A* 3g2p_A* 3g2q_A* | Back alignment and structure |
|---|
| >2fe3_A Peroxide operon regulator; oxidative stress regulator, DNA binding protein; 1.75A {Bacillus subtilis} PDB: 3f8n_A 2rgv_A* | Back alignment and structure |
|---|
| >2aot_A HMT, histamine N-methyltransferase; classic methyltransferase fold, protein-drug complex; HET: CSO 2PM SAH; 1.90A {Homo sapiens} SCOP: c.66.1.19 PDB: 1jqd_A* 2aou_A* 2aov_A* 2aox_A* 1jqe_A* 2aow_A* | Back alignment and structure |
|---|
| >3uzu_A Ribosomal RNA small subunit methyltransferase A; ssgcid, seattle structural genomics center for infectio disease; 1.75A {Burkholderia pseudomallei} | Back alignment and structure |
|---|
| >2avd_A Catechol-O-methyltransferase; structural genomics, structural genomics consortium, SGC; HET: SAM; 1.70A {Homo sapiens} SCOP: c.66.1.1 | Back alignment and structure |
|---|
| >1vbf_A 231AA long hypothetical protein-L-isoaspartate O- methyltransferase; trimeric coiled coil assembly; 2.80A {Sulfolobus tokodaii} SCOP: c.66.1.7 | Back alignment and structure |
|---|
| >3u1d_A Uncharacterized protein; GNTR-superfamily, structural genomics, PSI-biology, midwest for structural genomics, MCSG; 1.80A {Halomicrobium mukohataei} | Back alignment and structure |
|---|
| >2fyt_A Protein arginine N-methyltransferase 3; structural genomics, structural genomics consortium, SGC; HET: SAH; 2.00A {Homo sapiens} SCOP: c.66.1.6 PDB: 3smq_A* 1f3l_A* | Back alignment and structure |
|---|
| >3hnr_A Probable methyltransferase BT9727_4108; structural genomics, PSI-2, protein structure initiative; 2.80A {Bacillus thuringiensis serovarkonkukian} | Back alignment and structure |
|---|
| >3e23_A Uncharacterized protein RPA2492; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAM; 1.60A {Rhodopseudomonas palustris} | Back alignment and structure |
|---|
| >1wzn_A SAM-dependent methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: SAH; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.43 | Back alignment and structure |
|---|
| >3thr_A Glycine N-methyltransferase; GNMT, folate, methyltransferase binding, liver cytosol, transferase-transferase inhibitor C; HET: C2F TAM; 2.00A {Rattus norvegicus} SCOP: c.66.1.5 PDB: 3ths_A* 1xva_A* 1d2c_A 1kia_A* 1nbh_A* 1bhj_A* 2idj_A 2idk_A* 1d2g_A 1d2h_A* 1nbi_A* 1r8x_A 1r8y_A 1r74_A* 2azt_A* | Back alignment and structure |
|---|
| >1u2z_A Histone-lysine N-methyltransferase, H3 lysine-79 specific; histone methyltransferase, nucleosome; HET: SAH; 2.20A {Saccharomyces cerevisiae} SCOP: c.66.1.31 | Back alignment and structure |
|---|
| >3fut_A Dimethyladenosine transferase; methyltransferase, dimethyltransferase, dual-specific methyltransferase, 16S rRNA methyltransferase; 1.52A {Thermus thermophilus} PDB: 3fuu_A* 3fuv_A 3fuw_A* 3fux_A* | Back alignment and structure |
|---|
| >3orh_A Guanidinoacetate N-methyltransferase; structura genomics, structural genomics consortium, SGC; HET: SAH; 1.86A {Homo sapiens} PDB: 1xcj_A* 1xcl_A* 1p1c_A* 1p1b_A* 1khh_A* | Back alignment and structure |
|---|
| >3fzg_A 16S rRNA methylase; methyltransferase, plasmid, transferase; HET: SAM; 2.00A {Escherichia coli} | Back alignment and structure |
|---|
| >3ccf_A Cyclopropane-fatty-acyl-phospholipid synthase; YP_321342.1, putative methyltransferase; 1.90A {Anabaena variabilis atcc 29413} | Back alignment and structure |
|---|
| >1fbn_A MJ fibrillarin homologue; MJ proteins, ribosomal RNA processing, snoRNP, structural genomics, BSGC structure funded by NIH; 1.60A {Methanocaldococcus jannaschii} SCOP: c.66.1.3 PDB: 1g8s_A | Back alignment and structure |
|---|
| >2yxe_A Protein-L-isoaspartate O-methyltransferase; rossman-type fold, alpha/beta/alpha sandwich structure, STRU genomics, NPPSFA; 2.00A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >3mb5_A SAM-dependent methyltransferase; RNA methyltransferase, M1A, TRMI, intermolecular contacts, R specificity, tetramer, disulfide bond; HET: SAM; 1.60A {Pyrococcus abyssi} PDB: 3lga_A* 3lhd_C* | Back alignment and structure |
|---|
| >2hoe_A N-acetylglucosamine kinase; TM1224, structural genomics, PSI-2, protein structure initiative, joint center structural genomics, JCSG; 2.46A {Thermotoga maritima} SCOP: a.4.5.63 c.55.1.10 c.55.1.10 | Back alignment and structure |
|---|
| >2ex4_A Adrenal gland protein AD-003; methyltransferase, structural genomics, SGC, structural genomics consortium; HET: SAH; 1.75A {Homo sapiens} SCOP: c.66.1.42 | Back alignment and structure |
|---|
| >2h1r_A Dimethyladenosine transferase, putative; SGC toronto dimethyladenosine transferase, structural genomics, structural genomics consortium; 1.89A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >2vn2_A DNAD, chromosome replication initiation protein; DNA replication, primosome; 2.3A {Geobacillus kaustophilus HTA426} | Back alignment and structure |
|---|
| >2esh_A Conserved hypothetical protein TM0937; APC5794, structural genomics, PSI, protein structure initiative; 2.30A {Thermotoga maritima} SCOP: a.4.5.61 | Back alignment and structure |
|---|
| >3gru_A Dimethyladenosine transferase; rossman fold, ribosomal assem adenosyl-L-methionine, rRNA, methyltransferase, RNA-binding processing; HET: AMP; 1.60A {Methanocaldococcus jannaschii} PDB: 3grr_A* 3grv_A* 3gry_A* 3fyd_A 3fyc_A* | Back alignment and structure |
|---|
| >2fhp_A Methylase, putative; alpha-beta-alpha sandwich, structural genomics, PSI, protein structure initiative; HET: MSE; 1.60A {Enterococcus faecalis} SCOP: c.66.1.46 | Back alignment and structure |
|---|
| >2xvc_A ESCRT-III, SSO0910; cell cycle, cell division, cytokinesis, winged-helix; 2.15A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >1nt2_A Fibrillarin-like PRE-rRNA processing protein; adeMet, binding motif, RNA binding protein; HET: SAM; 2.90A {Archaeoglobus fulgidus} SCOP: c.66.1.3 | Back alignment and structure |
|---|
| >3uwp_A Histone-lysine N-methyltransferase, H3 lysine-79; epigenetics, tubercidin, structu genomics, structural genomics consortium, SGC; HET: 5ID; 2.05A {Homo sapiens} PDB: 4eqz_A* 3sx0_A* 4er0_A* 4er7_A* 1nw3_A* 4er6_A* 4er5_A* 3qow_A* 3qox_A* 4ek9_A* 4ekg_A* 4eki_A* 4er3_A* 3sr4_A* | Back alignment and structure |
|---|
| >2p7i_A Hypothetical protein; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; 1.74A {Pectobacterium atrosepticum SCRI1043} SCOP: c.66.1.41 PDB: 2p7h_A | Back alignment and structure |
|---|
| >2pwy_A TRNA (adenine-N(1)-)-methyltransferase; mtase, adoMet, TRMI, tRNA-M1A58; HET: SAH; 1.70A {Thermus thermophilus} | Back alignment and structure |
|---|
| >1vlm_A SAM-dependent methyltransferase; possible histamine methyltransferase, structural genomics, JCSG, protein struc initiative, PSI; 2.20A {Thermotoga maritima} SCOP: c.66.1.41 | Back alignment and structure |
|---|
| >1yzh_A TRNA (guanine-N(7)-)-methyltransferase; alpha-beta-alpha sandwich, S-adenosylmeth dependent, structural genomics, PSI; 2.02A {Streptococcus pneumoniae} SCOP: c.66.1.53 | Back alignment and structure |
|---|
| >1zx0_A Guanidinoacetate N-methyltransferase; structural genomics, structural genomics consortium; HET: SAH; 1.86A {Homo sapiens} PDB: 3orh_A* 1xcj_A* 1xcl_A* 1p1c_A* 1p1b_A* 1khh_A* | Back alignment and structure |
|---|
| >2yvl_A TRMI protein, hypothetical protein; tRNA, methyltransferase, S-adenosylmethionine, structural GE NPPSFA; HET: SAM; 2.20A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >2g9w_A Conserved hypothetical protein; DNA-binding domain, bacterial transcription repressor, DNA B protein; 1.80A {Mycobacterium tuberculosis} SCOP: a.4.5.39 | Back alignment and structure |
|---|
| >2xig_A Ferric uptake regulation protein; hpfur, transcription, homeostasis; HET: CIT; 1.85A {Helicobacter pylori} | Back alignment and structure |
|---|
| >1v4r_A Transcriptional repressor; helix-turn-helix, winged-helix, gene regulation; NMR {Streptomyces} SCOP: a.4.5.6 | Back alignment and structure |
|---|
| >1sd4_A Penicillinase repressor; BLAI, MECI, methicillin, B-lactam, DNA binding PR; 2.00A {Staphylococcus aureus} SCOP: a.4.5.39 PDB: 1xsd_A | Back alignment and structure |
|---|
| >3m33_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, MCSG, midwest center for structural genomics; 2.19A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >3tfw_A Putative O-methyltransferase; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium; 1.88A {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
| >3ckk_A TRNA (guanine-N(7)-)-methyltransferase; mettl1, S-adenosyl-L-methionine, tRNA Pro structural genomics, structural genomics consortium, SGC; HET: SAM; 1.55A {Homo sapiens} | Back alignment and structure |
|---|
| >2oxt_A Nucleoside-2'-O-methyltransferase; flavivirus, viral enzyme, RNA capping, S-adenosyl-L-methionine, viral protein; HET: SAM; 2.90A {Meaban virus} | Back alignment and structure |
|---|
| >1g8a_A Fibrillarin-like PRE-rRNA processing protein; rRNA binding, RNA binding, structural genomics, BSGC structure funded by NIH; 1.40A {Pyrococcus horikoshii} SCOP: c.66.1.3 PDB: 2nnw_B 3nmu_F* 3nvk_I* 3nvm_B 1pry_A | Back alignment and structure |
|---|
| >2ipx_A RRNA 2'-O-methyltransferase fibrillarin; FBL, structural genomics, structural genomics consortium, SGC; HET: MTA; 1.82A {Homo sapiens} | Back alignment and structure |
|---|
| >2wa2_A Non-structural protein 5; transferase, S-adenosyl-L- methionine, virion, membrane, flavivirus, N7-methyltransferase, 2'-O-methyltransferase; HET: SAM; 1.80A {Modoc virus} PDB: 2wa1_A* | Back alignment and structure |
|---|
| >3g07_A 7SK snRNA methylphosphate capping enzyme; structural genomics consortium (SGC), methyltransferase, phosphoprotein, S-adenosyl-L-methionine; HET: SAM; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >2yu3_A DNA-directed RNA polymerase III 39 kDa polypeptide F variant; winged helix domain, RNA polymerase III C39 subunit, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3lcc_A Putative methyl chloride transferase; halide methyltransferase; HET: SAH; 1.80A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1o9g_A RRNA methyltransferase; antibiotic resistance, Se-MAD; 1.5A {Streptomyces viridochromogenes} SCOP: c.66.1.29 PDB: 1o9h_A | Back alignment and structure |
|---|
| >1ws6_A Methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.50A {Thermus thermophilus} SCOP: c.66.1.46 | Back alignment and structure |
|---|
| >1dl5_A Protein-L-isoaspartate O-methyltransferase; isoaspartyl residues, protein repair, deamidation, post-translational modification; HET: SAH; 1.80A {Thermotoga maritima} SCOP: c.66.1.7 d.197.1.1 | Back alignment and structure |
|---|
| >3cta_A Riboflavin kinase; structural genomics, transferase, PSI-2, protein structure initiative; 2.20A {Thermoplasma acidophilum dsm 1728} SCOP: a.4.5.28 b.43.5.2 | Back alignment and structure |
|---|
| >1o54_A SAM-dependent O-methyltransferase; TM0748, structural genomi PSI, protein structure initiative, joint center for structu genomics; 1.65A {Thermotoga maritima} SCOP: c.66.1.13 | Back alignment and structure |
|---|
| >1jhg_A Trp operon repressor; complex (regulatory protein-peptide), DNA-binding regulatory complex (regulatory protein-peptide) complex; HET: TRP; 1.30A {Escherichia coli} SCOP: a.4.12.1 PDB: 1co0_A* 1mi7_R 1p6z_R 1wrp_R* 1zt9_A* 2oz9_R* 3ssw_R 3wrp_A 1rcs_A* 1wrs_R* 1wrt_R 2xdi_A 3ssx_R* 1trr_A* 1tro_A* | Back alignment and structure |
|---|
| >3ggd_A SAM-dependent methyltransferase; YP_325210.1, structural GEN joint center for structural genomics, JCSG; HET: SAH; 2.11A {Anabaena variabilis atcc 29413} | Back alignment and structure |
|---|
| >4b8x_A SCO5413, possible MARR-transcriptional regulator; winged helix motif; HET: CME; 1.25A {Streptomyces coelicolor} | Back alignment and structure |
|---|
| >3tma_A Methyltransferase; thump domain; 2.05A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3lpm_A Putative methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium, nysgxrc; 2.40A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >1z6r_A MLC protein; transcriptional repressor, ROK family protein, DNA binding P helix-turn-helix, phosphotransferase system; 2.70A {Escherichia coli} SCOP: a.4.5.63 c.55.1.10 c.55.1.10 PDB: 3bp8_A | Back alignment and structure |
|---|
| >3m70_A Tellurite resistance protein TEHB homolog; structural genomics, PSI-2, protein ST initiative; 1.95A {Haemophilus influenzae} | Back alignment and structure |
|---|
| >2qe6_A Uncharacterized protein TFU_2867; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; HET: NEP SAM; 1.95A {Thermobifida fusca} | Back alignment and structure |
|---|
| >1fx7_A Iron-dependent repressor IDER; DTXR, iron-dependent regulator, signaling protein; 2.00A {Mycobacterium tuberculosis} SCOP: a.4.5.24 a.76.1.1 b.34.1.2 PDB: 1u8r_A | Back alignment and structure |
|---|
| >3i71_A Ethanolamine utilization protein EUTK; helix-turn-helix, unknown function; HET: FLC; 2.10A {Escherichia coli} | Back alignment and structure |
|---|
| >2nxc_A L11 mtase, ribosomal protein L11 methyltransferase; transferase S-adenosly-L-methionine dependent methyltransfer posttranslational modification; 1.59A {Thermus thermophilus} SCOP: c.66.1.39 PDB: 1ufk_A 2nxe_A* 2nxj_A 2nxn_A 2zbp_A* 2zbq_A* 2zbr_A* 3cjq_A* 3cjr_A* 3cju_A* 3egv_A* 3cjt_A* | Back alignment and structure |
|---|
| >2vdv_E TRNA (guanine-N(7)-)-methyltransferase; S-adenosyl-L-methionine, phosphorylation, M7G, spout MT, tRNA processing; HET: SAM; 2.30A {Saccharomyces cerevisiae} PDB: 2vdu_E | Back alignment and structure |
|---|
| >3p9n_A Possible methyltransferase (methylase); RV2966C, adoMet binding, RNA methylase, RSMD, SAM-fold, RNA methyltransferase; 1.90A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >3tqn_A Transcriptional regulator, GNTR family; regulatory functions; 2.80A {Coxiella burnetii} | Back alignment and structure |
|---|
| >3mwm_A ZUR, putative metal uptake regulation protein; FUR, regulatory metal, graded transcription regulation, transcription; 2.40A {Streptomyces coelicolor} | Back alignment and structure |
|---|
| >3q7e_A Protein arginine N-methyltransferase 1; HET: SAH; 2.20A {Rattus norvegicus} PDB: 1orh_A* 1ori_A* 1or8_A* | Back alignment and structure |
|---|
| >3hp7_A Hemolysin, putative; structural genomics, APC64019, PSI-2, protein STR initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.53A {Streptococcus thermophilus} | Back alignment and structure |
|---|
| >4dcm_A Ribosomal RNA large subunit methyltransferase G; 23S rRNA (guanine1835-N2)-methyltransferase; HET: SAM; 2.30A {Escherichia coli} | Back alignment and structure |
|---|
| >1nv8_A HEMK protein; class I adoMet-dependent methyltransferase; HET: SAM MEQ; 2.20A {Thermotoga maritima} SCOP: c.66.1.30 PDB: 1nv9_A* 1vq1_A* 1sg9_A* | Back alignment and structure |
|---|
| >2pjp_A Selenocysteine-specific elongation factor; SELB, protein-RNA complex, elongation factor, winged- helix, bulge, translation/RNA complex; 2.30A {Escherichia coli} | Back alignment and structure |
|---|
| >3l8d_A Methyltransferase; structural genomics, PSI, nysgrc, protein structure initiative, NEW YORK SGX research center for STRU genomics; 1.70A {Bacillus thuringiensis} | Back alignment and structure |
|---|
| >1cf7_A Protein (transcription factor E2F-4); E2F, winged-helix, DNA-binding domain, cell cycle, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: a.4.5.17 | Back alignment and structure |
|---|
| >3bzb_A Uncharacterized protein; RED ALGA, protein structure initiat center for eukaryotic structural genomics, CESG, structural genomics; 2.79A {Cyanidioschyzon merolae} | Back alignment and structure |
|---|
| >2a14_A Indolethylamine N-methyltransferase; SGC,INMT, structural genomics, structural genomics consortium; HET: SAH; 1.70A {Homo sapiens} SCOP: c.66.1.15 | Back alignment and structure |
|---|
| >3grz_A L11 mtase, ribosomal protein L11 methyltransferase; methylase, SAM-binding domain, PSI-2, nysgxrc; 2.00A {Lactobacillus delbrueckii subsp} | Back alignment and structure |
|---|
| >3r0q_C Probable protein arginine N-methyltransferase 4.2; arginine methyltransferase, methylation; HET: SAH; 2.61A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3h2b_A SAM-dependent methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAH; 2.00A {Corynebacterium glutamicum atcc 13032} | Back alignment and structure |
|---|
| >2p41_A Type II methyltransferase; vizier, viral enzymes involved in replication, dengue virus methyltransferase, structural genomics; HET: G1G SAH CIT; 1.80A {Dengue virus 2} SCOP: c.66.1.25 PDB: 2p1d_A* 1l9k_A* 2p3o_A* 2p3q_A* 2p40_A* 2p3l_A* 1r6a_A* | Back alignment and structure |
|---|
| >2qlz_A Transcription factor PF0095; 2.50A {Pyrococcus furiosus} PDB: 2quf_A | Back alignment and structure |
|---|
| >2avn_A Ubiquinone/menaquinone biosynthesis methyltransfe related protein; ubiquinone/menaquinone biosynthesis methyltransferase-relate protein; HET: SAI; 2.35A {Thermotoga maritima} SCOP: c.66.1.41 | Back alignment and structure |
|---|
| >2b25_A Hypothetical protein; structural genomics, methyl transferase, SAM, structural GEN consortium, SGC, transferase; HET: SAM; 2.50A {Homo sapiens} SCOP: c.66.1.13 | Back alignment and structure |
|---|
| >3c3p_A Methyltransferase; NP_951602.1, structural genomics, joint for structural genomics, JCSG, protein structure initiative transferase; 1.90A {Geobacter sulfurreducens pca} | Back alignment and structure |
|---|
| >2ek5_A Predicted transcriptional regulators; helix-turn-helix, interwined alpha helices; 2.20A {Corynebacterium glutamicum atcc 13032} PDB: 2du9_A | Back alignment and structure |
|---|
| >2pxx_A Uncharacterized protein MGC2408; structural genomics consortium, SGC, methyltransferase, LOC84291, transferase; HET: SAH; 1.30A {Homo sapiens} | Back alignment and structure |
|---|
| >2vxz_A Pyrsv_GP04; viral protein, SSPF, ORF165A; 1.7A {Pyrobaculum spherical virus} | Back alignment and structure |
|---|
| >2b3t_A Protein methyltransferase HEMK; translation termination, methylation, conformational changes; HET: SAH; 3.10A {Escherichia coli} SCOP: c.66.1.30 PDB: 1t43_A* | Back alignment and structure |
|---|
| >1wy7_A Hypothetical protein PH1948; seven-stranded beta sheet, methyltransferase fold, structura genomics, transferase; HET: SAH; 2.20A {Pyrococcus horikoshii} SCOP: c.66.1.32 | Back alignment and structure |
|---|
| >2ift_A Putative methylase HI0767; NESG, Y767_haein, structural genomics, PSI-2, protein structure initiative; 2.30A {Haemophilus influenzae} SCOP: c.66.1.46 | Back alignment and structure |
|---|
| >2pjd_A Ribosomal RNA small subunit methyltransferase C; gene duplication, RNA modification, SAM binding; 2.10A {Escherichia coli} | Back alignment and structure |
|---|
| >4df3_A Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; NADP rossmann superfamily, S-adenosyl-L-M (SAM) binding, nucleolus; HET: SAM; 1.73A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >3tr6_A O-methyltransferase; cellular processes; HET: SAH; 2.70A {Coxiella burnetii} SCOP: c.66.1.0 | Back alignment and structure |
|---|
| >2qq9_A Diphtheria toxin repressor; regulator, DTXR, helix-turn-helix, metal ION, ACT DNA-binding, ferrous iron, transcription; 1.71A {Corynebacterium diphtheriae} PDB: 2tdx_A 1ddn_A 1g3t_A 1g3s_A 1g3w_A 2qqa_A 2qqb_A 2dtr_A 1bi0_A 1bi2_A 1bi3_A 1dpr_A 1bi1_A 1fwz_A 1g3y_A 1c0w_A* 3glx_A 1p92_A 1xcv_A 1f5t_A ... | Back alignment and structure |
|---|
| >1xdz_A Methyltransferase GIDB; MCSG, protein structure initiative, structural genomics, methyltransferase fold, PSI; 1.60A {Bacillus subtilis} SCOP: c.66.1.20 | Back alignment and structure |
|---|
| >3duw_A OMT, O-methyltransferase, putative; alternating of alpha and beta with complex SAH; HET: SAH; 1.20A {Bacillus cereus} PDB: 3dul_A* | Back alignment and structure |
|---|
| >3ntv_A MW1564 protein; rossmann fold, putative methyltransferase, transferase; HET: MSE; 1.55A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >3bxo_A N,N-dimethyltransferase; desosamine, sugar, carbohydrate, antibiotic, SAM, adoMet; HET: SAM UPP; 2.00A {Streptomyces venezuelae} | Back alignment and structure |
|---|
| >4esf_A PADR-like transcriptional regulator; PADR family, DNA binding protein, HTH fold; 2.20A {Bacillus cereus} | Back alignment and structure |
|---|
| >1bia_A BIRA bifunctional protein; transcription regulation; 2.30A {Escherichia coli} SCOP: a.4.5.1 b.34.1.1 d.104.1.2 PDB: 1bib_A* 1hxd_A* 2ewn_A* | Back alignment and structure |
|---|
| >3u81_A Catechol O-methyltransferase; neurotransmitter degradation, transferase transferase inhibitor complex; HET: SAH; 1.13A {Rattus norvegicus} SCOP: c.66.1.1 PDB: 3nwe_A* 3oe5_A* 3ozr_A* 3oe4_A* 3ozt_A* 3ozs_A* 3r6t_A* 3hvi_A* 1jr4_A* 1vid_A* 1h1d_A* 2cl5_A* 3hvh_A* 3hvj_A* 3hvk_A* 3nw9_A* 3nwb_A* 3s68_A* 2zlb_A 2zth_A* ... | Back alignment and structure |
|---|
| >1ne2_A Hypothetical protein TA1320; structural genomics, conserved hypothetical protein, PSI, protein structure initiative; 1.75A {Thermoplasma acidophilum} SCOP: c.66.1.32 | Back alignment and structure |
|---|
| >3neu_A LIN1836 protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG, unknown function; 1.58A {Listeria innocua} | Back alignment and structure |
|---|
| >3g89_A Ribosomal RNA small subunit methyltransferase G; 16S rRNA methyltransferase, translation, cytoplasm, rRNA processing; HET: HIC SAM AMP; 1.50A {Thermus thermophilus} PDB: 3g88_A* 3g8a_A* 3g8b_A* | Back alignment and structure |
|---|
| >2gb4_A Thiopurine S-methyltransferase; 18204406, thiopurine methyltransferase, structural genomics, PSI, protein structure initiative; HET: SAH; 1.25A {Mus musculus} PDB: 3bgi_A* 3bgd_A* 2bzg_A* 2h11_A* | Back alignment and structure |
|---|
| >3gdh_A Trimethylguanosine synthase homolog; M7G, CAP, dimethyltransferase, usnRNA, snoRNA, telomerase, cytoplasm, methyltransferase, nucleus; HET: MGP SAH; 2.00A {Homo sapiens} PDB: 3egi_A* | Back alignment and structure |
|---|
| >3by6_A Predicted transcriptional regulator; structural genomics, PSI-2, MCSG, structure initiative, midwest center for structural genomic binding; 2.20A {Oenococcus oeni} | Back alignment and structure |
|---|
| >1ri5_A MRNA capping enzyme; methyltransferase, M7G, messenger RNA CAP, structural genomics, PSI, protein structure initiative; 2.10A {Encephalitozoon cuniculi} SCOP: c.66.1.34 PDB: 1ri2_A* 1ri3_A* 1ri1_A* 1ri4_A 1z3c_A* 2hv9_A* | Back alignment and structure |
|---|
| >1iy9_A Spermidine synthase; rossmann fold, structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacillus subtilis} SCOP: c.66.1.17 | Back alignment and structure |
|---|
| >1r18_A Protein-L-isoaspartate(D-aspartate)-O-methyltrans; methyltransferase, isomerization, protein repair, S-adenosyl homocysteine; HET: SAH; 2.20A {Drosophila melanogaster} SCOP: c.66.1.7 | Back alignment and structure |
|---|
| >2fpo_A Methylase YHHF; structural genomics, putative methyltransferase, PSI, protei structure initiative; HET: MSE; 2.05A {Escherichia coli} SCOP: c.66.1.46 | Back alignment and structure |
|---|
| >2p8t_A Hypothetical protein PH0730; pyrococcus horikoshii OT3, STR genomics, PSI, protein structure initiative; 1.80A {Pyrococcus horikoshii} SCOP: a.4.5.72 d.74.4.2 | Back alignment and structure |
|---|
| >3f8b_A Transcriptional regulator, PADR-like family; winged helix turn helix, transcription regulator; 2.00A {Lactococcus lactis subsp} SCOP: a.4.5.0 PDB: 3f8c_A* 3f8f_A* | Back alignment and structure |
|---|
| >1xma_A Predicted transcriptional regulator; southea collaboratory for structural genomics, secsg, protein struc initiative, PSI; 2.30A {Clostridium thermocellum} SCOP: a.4.5.61 | Back alignment and structure |
|---|
| >3elk_A Putative transcriptional regulator TA0346; structural genomics, PSI-2, prote structure initiative; 1.70A {Thermoplasma acidophilum} | Back alignment and structure |
|---|
| >2v79_A DNA replication protein DNAD; primosome, DNA-binding protein; HET: DNA; 2.00A {Bacillus subtilis} | Back alignment and structure |
|---|
| >3bwc_A Spermidine synthase; SAM, SGPP, structura genomics, PSI, protein structure initiative, structural GEN pathogenic protozoa consortium; HET: MSE SAM; 2.30A {Trypanosoma cruzi} PDB: 3bwb_A* | Back alignment and structure |
|---|
| >2b0l_A GTP-sensing transcriptional pleiotropic repressor; CODY, DNA-binding, nucleotide-binding, transcript regulation, winged HTH motif.; 2.90A {Bacillus subtilis} SCOP: a.4.5.66 | Back alignment and structure |
|---|
| >2bm8_A Cephalosporin hydroxylase CMCI; cephamycin biosynthesis; 2.5A {Streptomyces clavuligerus} SCOP: c.66.1.50 PDB: 2bm9_A* 2br5_A* 2br4_A* 2br3_A* | Back alignment and structure |
|---|
| >3evz_A Methyltransferase; NYSGXRC, NEW YORK SGX research CE structural genomics, protein structure initiative, pyrococc furiosus, PSI-2; 2.20A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >2pbf_A Protein-L-isoaspartate O-methyltransferase beta-A methyltransferase; protein repair, isoaspartyl formation, P. falciparum; HET: SAH; 2.00A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >2h00_A Methyltransferase 10 domain containing protein; structural genomics, structural genomics consortium, SGC; HET: SAH; 2.00A {Homo sapiens} SCOP: c.66.1.54 | Back alignment and structure |
|---|
| >1mjf_A Spermidine synthase; spermidine synthetase, structural genomics, PSI, protein structure initiative; 1.80A {Pyrococcus furiosus} SCOP: c.66.1.17 PDB: 2e5w_A* 2zsu_A* | Back alignment and structure |
|---|
| >1uwv_A 23S rRNA (uracil-5-)-methyltransferase RUMA; RNA modification, iron-sulfur cluster, RNA processing; 1.95A {Escherichia coli} SCOP: b.40.4.12 c.66.1.40 PDB: 2bh2_A* | Back alignment and structure |
|---|
| >3c3y_A Pfomt, O-methyltransferase; plant secondary metabolism; HET: SAH; 1.37A {Mesembryanthemum crystallinum} | Back alignment and structure |
|---|
| >1p4x_A Staphylococcal accessory regulator A homologue; winged-helix protein, transcription; 2.20A {Staphylococcus aureus} SCOP: a.4.5.28 a.4.5.28 | Back alignment and structure |
|---|
| >1z05_A Transcriptional regulator, ROK family; structural genomics, protein structure initiative, midwest center for structural genomics; 2.00A {Vibrio cholerae o1 biovar eltor} SCOP: a.4.5.63 c.55.1.10 c.55.1.10 | Back alignment and structure |
|---|
| >1ixk_A Methyltransferase; open beta sheet; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.38 | Back alignment and structure |
|---|
| >1xj5_A Spermidine synthase 1; structural genomics, protein structure initiative, CESG, AT1G23820, putrescine aminopropyl transferase, SPDS1; 2.70A {Arabidopsis thaliana} SCOP: c.66.1.17 PDB: 2q41_A | Back alignment and structure |
|---|
| >3ldu_A Putative methylase; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: MSE GTP; 1.70A {Clostridium difficile} | Back alignment and structure |
|---|
| >4azs_A Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15A {Escherichia coli} PDB: 4azt_A* 4azv_A* 4azw_A* | Back alignment and structure |
|---|
| >4ham_A LMO2241 protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, winged helix-turn-helix, four helix bundle; 1.91A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >2i62_A Nicotinamide N-methyltransferase; structural genomics, structural genomics consortium, SGC; HET: SAH; 1.80A {Mus musculus} PDB: 2iip_A* 3rod_A* | Back alignment and structure |
|---|
| >1inl_A Spermidine synthase; beta-barrel, rossman fold, structural genomics, PSI, protein structure initiative; 1.50A {Thermotoga maritima} SCOP: c.66.1.17 PDB: 1jq3_A* | Back alignment and structure |
|---|
| >1mzb_A Ferric uptake regulation protein; ferric uptake regulator, iron, DTXR, gene regulation; 1.80A {Pseudomonas aeruginosa} SCOP: a.4.5.42 | Back alignment and structure |
|---|
| >1hsj_A Fusion protein consisting of staphylococcus accessary regulator protein R and maltose...; novel fold for DNA binding; HET: GLC; 2.30A {Escherichia coli} SCOP: a.4.5.28 c.94.1.1 | Back alignment and structure |
|---|
| >2cmg_A Spermidine synthase; transferase, putrescine aminopropyltransferase, spermidine biosynthesis, polyamine biosynthesis, SPEE; 2.0A {Helicobacter pylori} PDB: 2cmh_A | Back alignment and structure |
|---|
| >3lmm_A Uncharacterized protein; multi-domained alpha-beta protein, structural genomics, PSI- 2, protein structure initiative; 3.00A {Corynebacterium diphtheriae} | Back alignment and structure |
|---|
| >3ocj_A Putative exported protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: PLM; 1.39A {Bordetella parapertussis} | Back alignment and structure |
|---|
| >3rkx_A Biotin-[acetyl-COA-carboxylase] ligase; biotin protein ligase, 3 domains, enzyme DNA binding, biotin coupling domains; 2.10A {Staphylococcus aureus} PDB: 3rir_A* 3rkw_A 3rky_A* 3v7c_A* 3v7s_A* 3v8j_A 3v7r_A 3v8k_A* 3v8l_A* 4dq2_A* | Back alignment and structure |
|---|
| >2o0m_A Transcriptional regulator, SORC family; structural genomics, protein structure initiative, midwest center for structural genomics, MCSG; 1.60A {Enterococcus faecalis} SCOP: c.124.1.8 | Back alignment and structure |
|---|
| >2pt6_A Spermidine synthase; transferase, structural genomics consor SGC,dcadoMet complex; HET: S4M 1PG; 2.00A {Plasmodium falciparum} PDB: 2pss_A* 2pt9_A* | Back alignment and structure |
|---|
| >3dr5_A Putative O-methyltransferase; Q8NRD3, CGL1119, PF01596, CGR117, NESG, structural genomics, PSI-2, protein structure initiative; 2.25A {Corynebacterium glutamicum} | Back alignment and structure |
|---|
| >1i1n_A Protein-L-isoaspartate O-methyltransferase; S-adenosyl homocysteine, protein repair; HET: SAH; 1.50A {Homo sapiens} SCOP: c.66.1.7 PDB: 1kr5_A* | Back alignment and structure |
|---|
| >3k0b_A Predicted N6-adenine-specific DNA methylase; methylase,PF01170, putative RNA methylase, PSI,MCSG, structu genomics; 1.50A {Listeria monocytogenes str} | Back alignment and structure |
|---|
| >3id6_C Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; C/D guide RNA, 2'-O-methylation, coiled-coil, methyltransfer binding, rRNA processing; HET: SAM; 2.60A {Sulfolobus solfataricus} SCOP: c.66.1.0 PDB: 3id5_B* 3pla_E* | Back alignment and structure |
|---|
| >1uir_A Polyamine aminopropyltransferase; spermidien synthase, spermine synthase, riken STR genomics/proteomics initiative, RSGI; 2.00A {Thermus thermophilus} SCOP: c.66.1.17 PDB: 3anx_A* | Back alignment and structure |
|---|
| >1yg2_A Gene activator APHA; virulence factor, winged helix, transcripti factor, transcription; 2.20A {Vibrio cholerae} SCOP: a.4.5.61 | Back alignment and structure |
|---|
| >2i7c_A Spermidine synthase; transferase, structural genomics consor; HET: AAT 1PG; 1.71A {Plasmodium falciparum} PDB: 2hte_A* 3b7p_A* 3rie_A* 2pwp_A* | Back alignment and structure |
|---|
| >3maj_A DNA processing chain A; MCSG, PSI-2, structural genomics, protein structure initiati midwest center for structural genomics; HET: DNA; 2.05A {Rhodopseudomonas palustris} | Back alignment and structure |
|---|
| >2o07_A Spermidine synthase; structural genomics, structural genomics consortium, SGC, transferase; HET: SPD MTA; 1.89A {Homo sapiens} SCOP: c.66.1.17 PDB: 2o06_A* 2o05_A* 2o0l_A* 3rw9_A* | Back alignment and structure |
|---|
| >2hnk_A SAM-dependent O-methyltransferase; modified rossman fold; HET: SAH; 2.30A {Leptospira interrogans} | Back alignment and structure |
|---|
| >3cbg_A O-methyltransferase; cyanobacterium; HET: SAH FER 4FE; 2.00A {Synechocystis SP} | Back alignment and structure |
|---|
| >3r3h_A O-methyltransferase, SAM-dependent; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.65A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >2gpy_A O-methyltransferase; structural genomics, PSI, protein structure initiative, NEW research center for structural genomics, nysgxrc; HET: MSE; 1.90A {Bacillus halodurans} | Back alignment and structure |
|---|
| >4hc4_A Protein arginine N-methyltransferase 6; HRMT1L6, S-adenosyl-L-homocysteine, struc genomics, structural genomics consortium, SGC; HET: SAH; 1.97A {Homo sapiens} | Back alignment and structure |
|---|
| >3l7w_A Putative uncharacterized protein SMU.1704; PADR, transcriptional factor, transcription; HET: MSE; 2.20A {Streptococcus mutans} SCOP: a.4.5.0 | Back alignment and structure |
|---|
| >3gcz_A Polyprotein; flavivirus, RNA capping, methyltransferase, viral enzyme STR ATP-binding, nucleotide-binding, RNA replication, structura genomics; HET: SAM; 1.70A {Yokose virus} | Back alignment and structure |
|---|
| >3c7j_A Transcriptional regulator, GNTR family; structural genomics, PSI-2, protein structure initiative, midwest center for STR genomics; HET: MSE; 2.10A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >1p91_A Ribosomal RNA large subunit methyltransferase A; RLMA, RRMA, 23S rRNA, NESG, structural genomics, PSI, protein structure initiative; HET: SAM; 2.80A {Escherichia coli} SCOP: c.66.1.33 | Back alignment and structure |
|---|
| >2b2c_A Spermidine synthase; beta-alpha, transferase; 2.50A {Caenorhabditis elegans} SCOP: c.66.1.17 | Back alignment and structure |
|---|
| >3eyi_A Z-DNA-binding protein 1; alternative splicing, DNA-binding, polymorphism, DNA binding protein/Z-DNA complex, DNA binding protein/DNA complex; 1.45A {Homo sapiens} PDB: 2l4m_A | Back alignment and structure |
|---|
| >1sui_A Caffeoyl-COA O-methyltransferase; rossmann fold, protein-cofactor-substrate complex; HET: SAH FRE; 2.70A {Medicago sativa} SCOP: c.66.1.1 PDB: 1sus_A* | Back alignment and structure |
|---|
| >3ldg_A Putative uncharacterized protein SMU.472; YPSC, methyltransferase, transferase; HET: SAH; 1.96A {Streptococcus mutans} | Back alignment and structure |
|---|
| >2vdw_A Vaccinia virus capping enzyme D1 subunit; nucleotidyltransferase, S-adenosyl-L-methionine, RNA metabolism, mRNA processing, methyltransferase, poxvirus; HET: SAH; 2.70A {Vaccinia virus} | Back alignment and structure |
|---|
| >3tm4_A TRNA (guanine N2-)-methyltransferase TRM14; rossmann fold, thump domain, tRNA methyltransferase; HET: SAM; 1.95A {Pyrococcus furiosus} PDB: 3tlj_A* 3tm5_A* | Back alignment and structure |
|---|
| >4gqb_A Protein arginine N-methyltransferase 5; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} PDB: 4g56_A* | Back alignment and structure |
|---|
| >3evf_A RNA-directed RNA polymerase NS5; NS5 methyltransferase, RNA CAP binding, binding, capsid protein; HET: GTA SAH; 1.45A {Yellow fever virus} SCOP: c.66.1.0 PDB: 3evb_A* 3evc_A* 3evd_A* 3eve_A* 3eva_A* | Back alignment and structure |
|---|
| >2frn_A Hypothetical protein PH0793; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 2.10A {Pyrococcus horikoshii OT3} PDB: 3k6r_A 3a25_A* 3a26_A* | Back alignment and structure |
|---|
| >4fsd_A Arsenic methyltransferase; rossmann fold; 1.75A {Cyanidioschyzon SP} PDB: 4fr0_A* 4fs8_A 3p7e_A 3qnh_A 3qhu_A | Back alignment and structure |
|---|
| >3a27_A TYW2, uncharacterized protein MJ1557; wybutosine modification, transferase; HET: SAM; 2.00A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >3hhh_A Transcriptional regulator, PADR family; PF03551, structural PSI-2, protein structure initiative, midwest center for STR genomics, MCSG; 2.70A {Enterococcus faecalis} SCOP: a.4.5.0 | Back alignment and structure |
|---|
| >1tc3_C Protein (TC3 transposase); DNA binding, helix-turn-helix, TC1/mariner family, complex (transposase/DNA), DNA binding protein/DNA complex; HET: DNA; 2.45A {Caenorhabditis elegans} SCOP: a.4.1.2 | Back alignment and structure |
|---|
| >2g72_A Phenylethanolamine N-methyltransferase; HET: SAM F21; 2.00A {Homo sapiens} SCOP: c.66.1.15 PDB: 1yz3_A* 2an4_A* 2an5_A* 2g70_A* 2g71_A* 2an3_A* 2g8n_A* 2ony_A* 3hcb_A* 3hcc_A* 3hcd_A* 3hcf_A* 3kpj_A* 3kpu_A* 3kpv_A* 3kpw_A* 3kpy_A* 3kqm_A* 3kqo_A* 3kqp_A* ... | Back alignment and structure |
|---|
| >3eyy_A Putative iron uptake regulatory protein; NUR, nickel-uptake regulator, D-domain, dimerization domain, DB-domain, DNA-binding domain; 2.40A {Streptomyces coelicolor} | Back alignment and structure |
|---|
| >2w48_A Sorbitol operon regulator; SORC, activator, repressor, DNA-binding, transcription, transcription regulator, transcription regulation; 3.20A {Klebsiella pneumoniae} | Back alignment and structure |
|---|
| >3htx_A HEN1; HEN1, small RNA methyltransferase, protein-RNA complex; HET: SAH; 3.10A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2w57_A Ferric uptake regulation protein; gene regulation, transcription regulation, transport, iron, repressor, DNA-binding, transcription; 2.60A {Vibrio cholerae} | Back alignment and structure |
|---|
| >3sxy_A Transcriptional regulator, GNTR family; transcription factor, metal-binding, structur genomics, PSI-2, protein structure initiative; 1.65A {Thermotoga maritima} PDB: 3dbw_A 3fms_A* | Back alignment and structure |
|---|
| >3ua3_A Protein arginine N-methyltransferase 5; TIM-barrel, rossmann fold, beta-barrel, symmetric arginine dimethylase, SAM binding; HET: SAH; 3.00A {Caenorhabditis elegans} PDB: 3ua4_A | Back alignment and structure |
|---|
| >3ajd_A Putative methyltransferase MJ0026; tRNA, M5C, rossmann fold, structural genomics, riken structu genomics/proteomics initiative; 1.27A {Methanocaldococcus jannaschii} PDB: 3a4t_A | Back alignment and structure |
|---|
| >3frh_A 16S rRNA methylase; methyltransferase domain, helical N-terminal domain, methyltransferase, plasmid, transferase; HET: SAH; 1.20A {Escherichia coli} PDB: 3fri_A* 3b89_A* | Back alignment and structure |
|---|
| >3dmg_A Probable ribosomal RNA small subunit methyltransf; monomethyltranserase, 16S rRNA methyltransferase, N2 G1207 methyltransferase; HET: SAH; 1.55A {Thermus thermophilus} PDB: 3dmf_A* 3dmh_A* 2zul_A* 2zwv_A* | Back alignment and structure |
|---|
| >1hw1_A FADR, fatty acid metabolism regulator protein; helix-turn-helix, helix bundle, transcription; 1.50A {Escherichia coli} SCOP: a.4.5.6 a.78.1.1 PDB: 1hw2_A 1e2x_A 1h9g_A* 1h9t_A | Back alignment and structure |
|---|
| >2r6z_A UPF0341 protein in RSP 3' region; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 1.80A {Neisseria gonorrhoeae} | Back alignment and structure |
|---|
| >3ic7_A Putative transcriptional regulator; helix-turn-helix, structural genomics, PSI-2, protein struct initiative; 2.82A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >3kor_A Possible Trp repressor; putative DNA-binding Trp repressor, TRPR like protein, struc genomics, transcription; 1.60A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >3dv8_A Transcriptional regulator, CRP/FNR family; cyclic nucleotide-binding domain, structural genomics, joint for structural genomics; 2.55A {Eubacterium rectale atcc 33656} | Back alignment and structure |
|---|
| >2oz6_A Virulence factor regulator; winged helix, helix-turn-helix, transcription factor, CAMP-B proteins, CAMP receptor protein; HET: CMP; 2.80A {Pseudomonas aeruginosa} SCOP: a.4.5.4 b.82.3.2 | Back alignment and structure |
|---|
| >4ets_A Ferric uptake regulation protein; metal binding protein, transcription factor; 2.10A {Campylobacter jejuni subsp} | Back alignment and structure |
|---|
| >3fpf_A Mtnas, putative uncharacterized protein; thermonicotianamine, nicotianamine, biosynthetic protein; HET: TNA MTA; 1.66A {Methanothermobacter thermautotrophicusorganism_taxid} PDB: 3fpe_A* 3fph_A* 3fpg_A* 3fpj_A* 3o31_A* | Back alignment and structure |
|---|
| >2zcw_A TTHA1359, transcriptional regulator, FNR/CRP family; stationary phase, DNA-binding, transcription regulation; 1.50A {Thermus thermophilus} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 210 | ||||
| d1kyza1 | 107 | a.4.5.29 (A:13-119) Caffeic acid/5-hydroxyferulic | 2e-33 | |
| d1fp1d1 | 110 | a.4.5.29 (D:19-128) Chalcone O-methyltransferase { | 7e-33 | |
| d1kyza2 | 243 | c.66.1.12 (A:120-362) Caffeic acid/5-hydroxyferuli | 1e-31 | |
| d1fp1d2 | 244 | c.66.1.12 (D:129-372) Chalcone O-methyltransferase | 2e-29 | |
| d1fp2a2 | 244 | c.66.1.12 (A:109-352) Isoflavone O-methyltransfera | 2e-27 | |
| d1qzza2 | 256 | c.66.1.12 (A:102-357) Aclacinomycin-10-hydroxylase | 3e-20 | |
| d1tw3a2 | 253 | c.66.1.12 (A:99-351) Carminomycin 4-O-methyltransf | 8e-20 | |
| d1fp2a1 | 101 | a.4.5.29 (A:8-108) Isoflavone O-methyltransferase | 2e-15 | |
| d1qzza1 | 92 | a.4.5.29 (A:10-101) Aclacinomycin-10-hydroxylase R | 1e-09 | |
| d1tw3a1 | 85 | a.4.5.29 (A:14-98) Carminomycin 4-O-methyltransfer | 2e-08 |
| >d1kyza1 a.4.5.29 (A:13-119) Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Length = 107 | Back information, alignment and structure |
|---|
class: All alpha proteins fold: DNA/RNA-binding 3-helical bundle superfamily: "Winged helix" DNA-binding domain family: Plant O-methyltransferase, N-terminal domain domain: Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltransferase species: Alfalfa (Medicago sativa) [TaxId: 3879]
Score = 113 bits (285), Expect = 2e-33
Identities = 48/105 (45%), Positives = 71/105 (67%), Gaps = 3/105 (2%)
Query: 8 ERDQSFAYADQLATGVVLPMAIQAVYELGIFEILDKAGPGTKLSASDIAAQLLTKNKDAP 67
+++ +A QLA+ VLPM +++ EL + EI+ KAGPG ++S +IA+QL T N DAP
Sbjct: 3 SDEEANLFAMQLASASVLPMILKSALELDLLEIIAKAGPGAQISPIEIASQLPTTNPDAP 62
Query: 68 MMLDRILRLLASYSVVECSLDAS---GARRLYSLNSVSKYYVPNK 109
+MLDR+LRLLA Y ++ CS+ +RLY L +V+KY V N+
Sbjct: 63 VMLDRMLRLLACYIILTCSVRTQQDGKVQRLYGLATVAKYLVKNE 107
|
| >d1fp1d1 a.4.5.29 (D:19-128) Chalcone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Length = 110 | Back information, alignment and structure |
|---|
| >d1kyza2 c.66.1.12 (A:120-362) Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Length = 243 | Back information, alignment and structure |
|---|
| >d1fp1d2 c.66.1.12 (D:129-372) Chalcone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Length = 244 | Back information, alignment and structure |
|---|
| >d1fp2a2 c.66.1.12 (A:109-352) Isoflavone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Length = 244 | Back information, alignment and structure |
|---|
| >d1qzza2 c.66.1.12 (A:102-357) Aclacinomycin-10-hydroxylase RdmB {Streptomyces purpurascens [TaxId: 1924]} Length = 256 | Back information, alignment and structure |
|---|
| >d1tw3a2 c.66.1.12 (A:99-351) Carminomycin 4-O-methyltransferase {Streptomyces peucetius [TaxId: 1950]} Length = 253 | Back information, alignment and structure |
|---|
| >d1fp2a1 a.4.5.29 (A:8-108) Isoflavone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Length = 101 | Back information, alignment and structure |
|---|
| >d1qzza1 a.4.5.29 (A:10-101) Aclacinomycin-10-hydroxylase RdmB {Streptomyces purpurascens [TaxId: 1924]} Length = 92 | Back information, alignment and structure |
|---|
| >d1tw3a1 a.4.5.29 (A:14-98) Carminomycin 4-O-methyltransferase {Streptomyces peucetius [TaxId: 1950]} Length = 85 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 210 | |||
| d1fp2a1 | 101 | Isoflavone O-methyltransferase {Alfalfa (Medicago | 99.83 | |
| d1kyza2 | 243 | Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltra | 99.8 | |
| d1tw3a1 | 85 | Carminomycin 4-O-methyltransferase {Streptomyces p | 99.78 | |
| d1fp1d2 | 244 | Chalcone O-methyltransferase {Alfalfa (Medicago sa | 99.76 | |
| d1kyza1 | 107 | Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltra | 99.74 | |
| d1qzza1 | 92 | Aclacinomycin-10-hydroxylase RdmB {Streptomyces pu | 99.72 | |
| d1fp1d1 | 110 | Chalcone O-methyltransferase {Alfalfa (Medicago sa | 99.69 | |
| d1fp2a2 | 244 | Isoflavone O-methyltransferase {Alfalfa (Medicago | 99.67 | |
| d1qzza2 | 256 | Aclacinomycin-10-hydroxylase RdmB {Streptomyces pu | 99.64 | |
| d1tw3a2 | 253 | Carminomycin 4-O-methyltransferase {Streptomyces p | 99.59 | |
| d1mkma1 | 75 | Transcriptional regulator IclR, N-terminal domain | 98.29 | |
| d1r1ua_ | 94 | Metal-sensing transcriptional repressor CzrA {Stap | 96.94 | |
| d1ub9a_ | 100 | Hypothetical protein PH1061 {Archaeon Pyrococcus h | 96.83 | |
| d1r1ta_ | 98 | SmtB repressor {Cyanobacteria (Synechococcus), pcc | 96.81 | |
| d1j5ya1 | 65 | Putative transcriptional regulator TM1602, N-termi | 96.8 | |
| d2o57a1 | 282 | Putative sarcosine dimethylglycine methyltransfera | 96.75 | |
| d1biaa1 | 63 | Biotin repressor, N-terminal domain {Escherichia c | 96.71 | |
| d1z05a1 | 71 | Transcriptional regulator VC2007 N-terminal domain | 96.71 | |
| d2hoea1 | 62 | N-acetylglucosamine kinase {Thermotoga maritima [T | 96.63 | |
| d1ylfa1 | 138 | Hypothetical protein BC1842 {Bacillus cereus [TaxI | 96.59 | |
| d1u2wa1 | 108 | Cadmium efflux system accessory protein CadC {Stap | 96.54 | |
| d1lvaa3 | 64 | C-terminal fragment of elongation factor SelB {Moo | 96.54 | |
| d1xd7a_ | 127 | Hypothetical protein ywnA {Bacillus subtilis [TaxI | 96.34 | |
| d2d1ha1 | 109 | Hypothetical transcriptional regulator ST1889 {Sul | 96.32 | |
| d1ulya_ | 190 | Hypothetical protein PH1932 {Pyrococcus horikoshii | 96.32 | |
| d1z6ra1 | 70 | Mlc protein N-terminal domain {Escherichia coli [T | 96.12 | |
| d3ctaa1 | 85 | Ta1064 (RFK), N-terminal domain {Thermoplasma acid | 96.07 | |
| d2p4wa1 | 194 | Transcriptional regulatory protein PF1790 {Pyrococ | 96.0 | |
| d1sfxa_ | 109 | Hypothetical protein AF2008 {Archaeoglobus fulgidu | 95.96 | |
| d1lnwa_ | 141 | MexR repressor {Pseudomonas aeruginosa [TaxId: 287 | 95.93 | |
| d1r7ja_ | 90 | Sso10a (SSO10449) {Archaeon Sulfolobus solfataricu | 95.82 | |
| d1wzna1 | 251 | Hypothetical methyltransferase PH1305 {Archaeon Py | 95.71 | |
| d3broa1 | 135 | Transcriptional regulator OEOE1854 {Oenococcus oen | 95.58 | |
| d1ku9a_ | 151 | DNA-binding protein Mj223 {Archaeon Methanococcus | 95.3 | |
| d1dpua_ | 69 | C-terminal domain of RPA32 {Human (Homo sapiens) [ | 95.18 | |
| d1i1ga1 | 60 | LprA {Archaeon Pyrococcus furiosus [TaxId: 2261]} | 95.14 | |
| d2cg4a1 | 63 | Regulatory protein AsnC {Escherichia coli [TaxId: | 95.11 | |
| d2cfxa1 | 63 | Transcriptional regulator LrpC {Bacillus subtilis | 95.11 | |
| d2cyya1 | 60 | Putative transcriptional regulator PH1519 {Archaeo | 95.08 | |
| d1j75a_ | 57 | Dlm-1 {Mouse (Mus musculus) [TaxId: 10090]} | 94.91 | |
| d2hzta1 | 95 | Putative transcriptional regulator YtcD {Bacillus | 94.86 | |
| d2gxba1 | 59 | Z-alpha domain of dsRNA-specific adenosine deamina | 94.84 | |
| d1dusa_ | 194 | Hypothetical protein MJ0882 {Archaeon Methanococcu | 94.82 | |
| d2hr3a1 | 145 | Probable transcriptional regulator PA3067 {Pseudom | 94.8 | |
| d1jhfa1 | 71 | LexA repressor, N-terminal DNA-binding domain {Esc | 94.77 | |
| d1s3ja_ | 143 | Putative transcriptional regulator YusO {Bacillus | 94.75 | |
| d2fk8a1 | 280 | Methoxy mycolic acid synthase 4, Mma4 {Mycobacteri | 94.69 | |
| d1kpga_ | 285 | CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]} | 94.65 | |
| d2bv6a1 | 136 | Transcriptional regulator MgrA {Staphylococcus aur | 94.59 | |
| d2etha1 | 140 | Putative transcriptional regulator TM0816 {Thermot | 94.56 | |
| d1jqea_ | 280 | Histamine methyltransferase {Human (Homo sapiens) | 94.55 | |
| d2fbha1 | 137 | Transcriptional regulator PA3341 {Pseudomonas aeru | 94.52 | |
| d1kpia_ | 291 | CmaA2 {Mycobacterium tuberculosis [TaxId: 1773]} | 94.5 | |
| d2a61a1 | 139 | Transcriptional regulator TM0710 {Thermotoga marit | 94.44 | |
| d1xtpa_ | 254 | Hypothetical protein Lmaj004091aaa (LmjF30.0810) { | 94.35 | |
| d1q1ha_ | 88 | Transcription factor E/IIe-alpha, N-terminal domai | 94.32 | |
| d2ex4a1 | 222 | Adrenal gland protein AD-003 (C9orf32) {Human (Hom | 94.13 | |
| d1jgsa_ | 138 | Multiple antibiotic resistance repressor, MarR {Es | 94.09 | |
| d2avna1 | 246 | Hypothetical methyltransferase TM1389 {Thermotoga | 94.08 | |
| d2fswa1 | 102 | Hypothetical protein PG0823 {Porphyromonas gingiva | 94.08 | |
| d1yyva1 | 114 | Putative transcriptional regulator YtfH {Salmonell | 94.08 | |
| d2ev0a1 | 61 | Manganese transport regulator MntR {Bacillus subti | 93.86 | |
| d3deua1 | 140 | Transcriptional regulator SlyA {Salmonella typhimu | 93.74 | |
| d1zx0a1 | 229 | Guanidinoacetate methyltransferase {Human (Homo sa | 93.7 | |
| d2isya1 | 63 | Iron-dependent regulator IdeR {Mycobacterium tuber | 93.56 | |
| d1xvaa_ | 292 | Glycine N-methyltransferase {Rat (Rattus norvegicu | 93.5 | |
| d1u2za_ | 406 | Catalytic, N-terminal domain of histone methyltran | 93.48 | |
| d2hs5a1 | 69 | Putative transcriptional regulator RHA1_ro03477 {R | 93.45 | |
| d2f2ea1 | 142 | Hypothetical protein PA1607 {Pseudomonas aeruginos | 93.29 | |
| d1dl5a1 | 213 | Protein-L-isoaspartyl O-methyltransferase {Thermot | 93.09 | |
| d1xmka1 | 73 | Z-alpha domain of dsRNA-specific adenosine deamina | 93.07 | |
| d1z7ua1 | 108 | Hypothetical protein EF0647 {Enterococcus faecalis | 92.99 | |
| d1p91a_ | 268 | rRNA methyltransferase RlmA {Escherichia coli [Tax | 92.88 | |
| d2nxca1 | 254 | PrmA-like protein TTHA0656 (TT0836) {Thermus therm | 92.78 | |
| d1yb2a1 | 250 | Hypothetical protein Ta0852 {Thermoplasma acidophi | 92.75 | |
| d1z91a1 | 137 | Organic hydroperoxide resistance transcriptional r | 92.75 | |
| d2frha1 | 115 | Pleiotropic regulator of virulence genes, SarA {St | 92.66 | |
| d2fbia1 | 136 | Probable transcriptional regulator PA4135 {Pseudom | 92.58 | |
| d1g8sa_ | 230 | Fibrillarin homologue {Archaeon Methanococcus jann | 92.53 | |
| d1hw1a1 | 74 | Fatty acid responsive transcription factor FadR, N | 92.51 | |
| d1zyba1 | 73 | Probable transcription regulator BT4300, C-termina | 91.97 | |
| d1p4xa1 | 125 | Staphylococcal accessory regulator A homolog, SarS | 91.9 | |
| d3bwga1 | 78 | Transcriptional regulator YydK {Bacillus subtilis | 91.82 | |
| d1nw3a_ | 328 | Catalytic, N-terminal domain of histone methyltran | 91.76 | |
| d2obpa1 | 81 | Putative DNA-binding protein ReutB4095 {Ralstonia | 91.67 | |
| d2fbka1 | 172 | Transcriptional regulator DR1159 {Deinococcus radi | 91.58 | |
| d1ne2a_ | 197 | Hypothetical protein Ta1320 {Archaeon Thermoplasma | 91.51 | |
| d1lj9a_ | 144 | Transcriptional regulator SlyA {Enterococcus faeca | 91.43 | |
| d2bzga1 | 229 | Thiopurine S-methyltransferase {Human (Homo sapien | 91.39 | |
| d1vbfa_ | 224 | Protein-L-isoaspartyl O-methyltransferase {Sulfolo | 91.36 | |
| d1o54a_ | 266 | Hypothetical protein TM0748 {Thermotoga maritima [ | 91.34 | |
| d1nt2a_ | 209 | Fibrillarin homologue {Archaeon Archaeoglobus fulg | 91.28 | |
| d1i9ga_ | 264 | Probable methyltransferase Rv2118c {Mycobacterium | 91.27 | |
| d1hsja1 | 115 | Staphylococcal accessory regulator A homolog, SarR | 90.97 | |
| d1sfua_ | 70 | 34L {Yaba-like disease virus, YLDV [TaxId: 132475] | 90.56 | |
| d1bl0a1 | 54 | MarA {Escherichia coli [TaxId: 562]} | 90.08 | |
| d1wy7a1 | 201 | Hypothetical protein PH1948 {Archaeon Pyrococcus h | 90.0 | |
| d1cf7a_ | 67 | Cell cycle transcription factor E2F-4 {Human (Homo | 89.97 | |
| d2b25a1 | 324 | Hypothetical protein FLJ20628 {Human (Homo sapiens | 89.84 | |
| d1p4xa2 | 125 | Staphylococcal accessory regulator A homolog, SarS | 89.84 | |
| d2gaua1 | 81 | Transcriptional regulator PG0396, C-terminal domai | 89.84 | |
| d1ft9a1 | 80 | CO-sensing protein CooA, C-terminal domain {Rhodos | 89.83 | |
| d2zcwa1 | 82 | Transcriptional regulator TTHA1359, C-terminal dom | 89.8 | |
| d2dk5a1 | 78 | DNA-directed RNA polymerase III subunit RPC6, RPO3 | 89.64 | |
| d2b3ta1 | 274 | N5-glutamine methyltransferase, HemK {Escherichia | 89.57 | |
| d2fxaa1 | 162 | Protease production regulatory protein Hpr {Bacill | 89.56 | |
| d1i5za1 | 69 | Catabolite gene activator protein (CAP), C-termina | 89.13 | |
| d2a14a1 | 257 | Indolethylamine N-methyltransferase, INMT {Human ( | 89.02 | |
| d1i1na_ | 224 | Protein-L-isoaspartyl O-methyltransferase {Human ( | 88.49 | |
| d1stza1 | 87 | Heat-inducible transcription repressor HrcA, N-ter | 88.26 | |
| d1g8aa_ | 227 | Fibrillarin homologue {Archaeon Pyrococcus horikos | 87.17 | |
| d3e5ua1 | 80 | Chlorophenol reduction protein CprK {Desulfitobact | 86.7 | |
| d1jg1a_ | 215 | Protein-L-isoaspartyl O-methyltransferase {Archaeo | 86.02 | |
| d1r18a_ | 223 | Protein-L-isoaspartyl O-methyltransferase {Fruit f | 85.64 | |
| d1ws6a1 | 171 | Methyltransferase TTHA0928 {Thermus thermophilus [ | 85.12 | |
| d1v4ra1 | 100 | Transcriptional repressor TraR, N-terminal domain | 84.44 | |
| d1d5ya1 | 54 | Rob transcription factor, N-terminal domain {Esche | 83.39 | |
| d1okra_ | 120 | Methicillin resistance regulatory protein MecI {St | 82.97 | |
| d1u5ta2 | 68 | Vacuolar sorting protein SNF8 {Baker's yeast (Sacc | 81.62 | |
| d1xn7a_ | 78 | Hypothetical protein YhgG {Escherichia coli [TaxId | 81.23 | |
| d2p8ta1 | 69 | Hypothetical protein PH0730 {Pyrococcus horikoshii | 80.92 | |
| d1s6la1 | 60 | Alkylmercury lyase MerB {Escherichia coli [TaxId: | 80.55 | |
| d2fpoa1 | 183 | Methylase YhhF {Escherichia coli [TaxId: 562]} | 80.28 |
| >d1fp2a1 a.4.5.29 (A:8-108) Isoflavone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} | Back information, alignment and structure |
|---|
class: All alpha proteins fold: DNA/RNA-binding 3-helical bundle superfamily: "Winged helix" DNA-binding domain family: Plant O-methyltransferase, N-terminal domain domain: Isoflavone O-methyltransferase species: Alfalfa (Medicago sativa) [TaxId: 3879]
Probab=99.83 E-value=4.9e-21 Score=133.56 Aligned_cols=96 Identities=20% Similarity=0.217 Sum_probs=83.4
Q ss_pred hcchHHHHHHHHHhhchHHHHHHHHHhhChhhHHhhcCCCCCCCHHHHHHHhcCCCCCCcccHHHHHHHHhcccceeeec
Q 036188 8 ERDQSFAYADQLATGVVLPMAIQAVYELGIFEILDKAGPGTKLSASDIAAQLLTKNKDAPMMLDRILRLLASYSVVECSL 87 (210)
Q Consensus 8 ~~~~~~~~l~~~~~~~~~~~al~~a~~lglfd~L~~~g~~~~~t~~eLA~~~~~~~~~~~~~l~rlLr~L~~~gl~~~~~ 87 (210)
|..+++..+|+++++|+.+++|++|+++||||.|+++| +|+|++|||+++++ ++.+++.|.|+||+|++.|+|+++.
T Consensus 5 e~~qaq~~l~~~~~gf~~s~aL~~aveLgi~d~l~~~~--~p~t~~eLa~~~~~-~~~~~~~L~RlLR~L~~~gi~~~~~ 81 (101)
T d1fp2a1 5 EIFKAQALLYKHIYAFIDSMSLKWAVEMNIPNIIQNHG--KPISLSNLVSILQV-PSSKIGNVRRLMRYLAHNGFFEIIT 81 (101)
T ss_dssp HHHHHHHHHHHHHTTHHHHHHHHHHHHTTHHHHHHHHT--SCEEHHHHHHHHTC-CGGGHHHHHHHHHHHHHTTSEEEEE
T ss_pred HHHHHHHHHHHHHHhHHHHHHHHHHHHcCcHHHHHHcC--CCCCHHHHHHHcCC-CCccchHHHHHHHHHHhCCceeeec
Confidence 56789999999999999999999999999999999876 79999999999998 2223466999999999999998652
Q ss_pred cCCCcccceeccccccccccCC
Q 036188 88 DASGARRLYSLNSVSKYYVPNK 109 (210)
Q Consensus 88 ~~~~~~~~y~~t~~s~~l~~~~ 109 (210)
. .+++|++||.|++|++++
T Consensus 82 ~---~~~~Y~lt~~s~~Lv~~~ 100 (101)
T d1fp2a1 82 K---EEESYALTVASELLVRGS 100 (101)
T ss_dssp S---SSEEEEECHHHHTTSTTS
T ss_pred C---CCCeEecCHHHHHhhcCC
Confidence 1 357899999999998765
|
| >d1kyza2 c.66.1.12 (A:120-362) Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} | Back information, alignment and structure |
|---|
| >d1tw3a1 a.4.5.29 (A:14-98) Carminomycin 4-O-methyltransferase {Streptomyces peucetius [TaxId: 1950]} | Back information, alignment and structure |
|---|
| >d1fp1d2 c.66.1.12 (D:129-372) Chalcone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} | Back information, alignment and structure |
|---|
| >d1kyza1 a.4.5.29 (A:13-119) Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} | Back information, alignment and structure |
|---|
| >d1qzza1 a.4.5.29 (A:10-101) Aclacinomycin-10-hydroxylase RdmB {Streptomyces purpurascens [TaxId: 1924]} | Back information, alignment and structure |
|---|
| >d1fp1d1 a.4.5.29 (D:19-128) Chalcone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} | Back information, alignment and structure |
|---|
| >d1fp2a2 c.66.1.12 (A:109-352) Isoflavone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} | Back information, alignment and structure |
|---|
| >d1qzza2 c.66.1.12 (A:102-357) Aclacinomycin-10-hydroxylase RdmB {Streptomyces purpurascens [TaxId: 1924]} | Back information, alignment and structure |
|---|
| >d1tw3a2 c.66.1.12 (A:99-351) Carminomycin 4-O-methyltransferase {Streptomyces peucetius [TaxId: 1950]} | Back information, alignment and structure |
|---|
| >d1mkma1 a.4.5.33 (A:1-75) Transcriptional regulator IclR, N-terminal domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1r1ua_ a.4.5.5 (A:) Metal-sensing transcriptional repressor CzrA {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1ub9a_ a.4.5.28 (A:) Hypothetical protein PH1061 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1r1ta_ a.4.5.5 (A:) SmtB repressor {Cyanobacteria (Synechococcus), pcc7942 [TaxId: 1129]} | Back information, alignment and structure |
|---|
| >d1j5ya1 a.4.5.1 (A:3-67) Putative transcriptional regulator TM1602, N-terminal domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2o57a1 c.66.1.18 (A:16-297) Putative sarcosine dimethylglycine methyltransferase {Red algae (Galdieria sulphuraria) [TaxId: 130081]} | Back information, alignment and structure |
|---|
| >d1biaa1 a.4.5.1 (A:1-63) Biotin repressor, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1z05a1 a.4.5.63 (A:10-80) Transcriptional regulator VC2007 N-terminal domain {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d2hoea1 a.4.5.63 (A:10-71) N-acetylglucosamine kinase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1ylfa1 a.4.5.55 (A:5-142) Hypothetical protein BC1842 {Bacillus cereus [TaxId: 1396]} | Back information, alignment and structure |
|---|
| >d1u2wa1 a.4.5.5 (A:12-119) Cadmium efflux system accessory protein CadC {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1lvaa3 a.4.5.35 (A:511-574) C-terminal fragment of elongation factor SelB {Moorella thermoacetica [TaxId: 1525]} | Back information, alignment and structure |
|---|
| >d1xd7a_ a.4.5.55 (A:) Hypothetical protein ywnA {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2d1ha1 a.4.5.50 (A:1-109) Hypothetical transcriptional regulator ST1889 {Sulfolobus tokodaii [TaxId: 111955]} | Back information, alignment and structure |
|---|
| >d1ulya_ a.4.5.58 (A:) Hypothetical protein PH1932 {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1z6ra1 a.4.5.63 (A:12-81) Mlc protein N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d3ctaa1 a.4.5.28 (A:5-89) Ta1064 (RFK), N-terminal domain {Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d2p4wa1 a.4.5.64 (A:1-194) Transcriptional regulatory protein PF1790 {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1sfxa_ a.4.5.50 (A:) Hypothetical protein AF2008 {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1lnwa_ a.4.5.28 (A:) MexR repressor {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1r7ja_ a.4.5.49 (A:) Sso10a (SSO10449) {Archaeon Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1wzna1 c.66.1.43 (A:1-251) Hypothetical methyltransferase PH1305 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d3broa1 a.4.5.28 (A:3-137) Transcriptional regulator OEOE1854 {Oenococcus oeni [TaxId: 1247]} | Back information, alignment and structure |
|---|
| >d1ku9a_ a.4.5.36 (A:) DNA-binding protein Mj223 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1dpua_ a.4.5.16 (A:) C-terminal domain of RPA32 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1i1ga1 a.4.5.32 (A:2-61) LprA {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d2cg4a1 a.4.5.32 (A:4-66) Regulatory protein AsnC {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2cfxa1 a.4.5.32 (A:1-63) Transcriptional regulator LrpC {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2cyya1 a.4.5.32 (A:5-64) Putative transcriptional regulator PH1519 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1j75a_ a.4.5.19 (A:) Dlm-1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2hzta1 a.4.5.69 (A:4-98) Putative transcriptional regulator YtcD {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2gxba1 a.4.5.19 (A:140-198) Z-alpha domain of dsRNA-specific adenosine deaminase, ADAR1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dusa_ c.66.1.4 (A:) Hypothetical protein MJ0882 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d2hr3a1 a.4.5.28 (A:2-146) Probable transcriptional regulator PA3067 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1jhfa1 a.4.5.2 (A:2-72) LexA repressor, N-terminal DNA-binding domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1s3ja_ a.4.5.28 (A:) Putative transcriptional regulator YusO {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2fk8a1 c.66.1.18 (A:22-301) Methoxy mycolic acid synthase 4, Mma4 {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1kpga_ c.66.1.18 (A:) CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2bv6a1 a.4.5.28 (A:5-140) Transcriptional regulator MgrA {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d2etha1 a.4.5.28 (A:1-140) Putative transcriptional regulator TM0816 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1jqea_ c.66.1.19 (A:) Histamine methyltransferase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fbha1 a.4.5.28 (A:8-144) Transcriptional regulator PA3341 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1kpia_ c.66.1.18 (A:) CmaA2 {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2a61a1 a.4.5.28 (A:5-143) Transcriptional regulator TM0710 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1xtpa_ c.66.1.42 (A:) Hypothetical protein Lmaj004091aaa (LmjF30.0810) {Leishmania major [TaxId: 5664]} | Back information, alignment and structure |
|---|
| >d1q1ha_ a.4.5.41 (A:) Transcription factor E/IIe-alpha, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d2ex4a1 c.66.1.42 (A:2-224) Adrenal gland protein AD-003 (C9orf32) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jgsa_ a.4.5.28 (A:) Multiple antibiotic resistance repressor, MarR {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2avna1 c.66.1.41 (A:1-246) Hypothetical methyltransferase TM1389 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2fswa1 a.4.5.69 (A:3-104) Hypothetical protein PG0823 {Porphyromonas gingivalis [TaxId: 837]} | Back information, alignment and structure |
|---|
| >d1yyva1 a.4.5.69 (A:9-122) Putative transcriptional regulator YtfH {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d2ev0a1 a.4.5.24 (A:2-62) Manganese transport regulator MntR {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d3deua1 a.4.5.28 (A:2-141) Transcriptional regulator SlyA {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1zx0a1 c.66.1.16 (A:8-236) Guanidinoacetate methyltransferase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2isya1 a.4.5.24 (A:2-64) Iron-dependent regulator IdeR {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1xvaa_ c.66.1.5 (A:) Glycine N-methyltransferase {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1u2za_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2hs5a1 a.4.5.6 (A:25-93) Putative transcriptional regulator RHA1_ro03477 {Rhodococcus sp. RHA1 [TaxId: 101510]} | Back information, alignment and structure |
|---|
| >d2f2ea1 a.4.5.69 (A:5-146) Hypothetical protein PA1607 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1dl5a1 c.66.1.7 (A:1-213) Protein-L-isoaspartyl O-methyltransferase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1xmka1 a.4.5.19 (A:294-366) Z-alpha domain of dsRNA-specific adenosine deaminase, ADAR1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z7ua1 a.4.5.69 (A:1-108) Hypothetical protein EF0647 {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d1p91a_ c.66.1.33 (A:) rRNA methyltransferase RlmA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2nxca1 c.66.1.39 (A:1-254) PrmA-like protein TTHA0656 (TT0836) {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1yb2a1 c.66.1.13 (A:6-255) Hypothetical protein Ta0852 {Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d1z91a1 a.4.5.28 (A:8-144) Organic hydroperoxide resistance transcriptional regulator OhrR {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2frha1 a.4.5.28 (A:102-216) Pleiotropic regulator of virulence genes, SarA {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d2fbia1 a.4.5.28 (A:5-140) Probable transcriptional regulator PA4135 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1g8sa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1hw1a1 a.4.5.6 (A:5-78) Fatty acid responsive transcription factor FadR, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1zyba1 a.4.5.4 (A:148-220) Probable transcription regulator BT4300, C-terminal domain {Bacteroides thetaiotaomicron [TaxId: 818]} | Back information, alignment and structure |
|---|
| >d1p4xa1 a.4.5.28 (A:1-125) Staphylococcal accessory regulator A homolog, SarS {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d3bwga1 a.4.5.6 (A:5-82) Transcriptional regulator YydK {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1nw3a_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2obpa1 a.4.5.71 (A:12-92) Putative DNA-binding protein ReutB4095 {Ralstonia eutropha [TaxId: 106590]} | Back information, alignment and structure |
|---|
| >d2fbka1 a.4.5.28 (A:8-179) Transcriptional regulator DR1159 {Deinococcus radiodurans [TaxId: 1299]} | Back information, alignment and structure |
|---|
| >d1ne2a_ c.66.1.32 (A:) Hypothetical protein Ta1320 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d1lj9a_ a.4.5.28 (A:) Transcriptional regulator SlyA {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d2bzga1 c.66.1.36 (A:17-245) Thiopurine S-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vbfa_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Sulfolobus tokodaii [TaxId: 111955]} | Back information, alignment and structure |
|---|
| >d1o54a_ c.66.1.13 (A:) Hypothetical protein TM0748 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1nt2a_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1i9ga_ c.66.1.13 (A:) Probable methyltransferase Rv2118c {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1hsja1 a.4.5.28 (A:373-487) Staphylococcal accessory regulator A homolog, SarR {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1sfua_ a.4.5.19 (A:) 34L {Yaba-like disease virus, YLDV [TaxId: 132475]} | Back information, alignment and structure |
|---|
| >d1bl0a1 a.4.1.8 (A:9-62) MarA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1wy7a1 c.66.1.32 (A:4-204) Hypothetical protein PH1948 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1cf7a_ a.4.5.17 (A:) Cell cycle transcription factor E2F-4 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2b25a1 c.66.1.13 (A:6-329) Hypothetical protein FLJ20628 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p4xa2 a.4.5.28 (A:126-250) Staphylococcal accessory regulator A homolog, SarS {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d2gaua1 a.4.5.4 (A:152-232) Transcriptional regulator PG0396, C-terminal domain {Porphyromonas gingivalis [TaxId: 837]} | Back information, alignment and structure |
|---|
| >d1ft9a1 a.4.5.4 (A:134-213) CO-sensing protein CooA, C-terminal domain {Rhodospirillum rubrum [TaxId: 1085]} | Back information, alignment and structure |
|---|
| >d2dk5a1 a.4.5.85 (A:8-85) DNA-directed RNA polymerase III subunit RPC6, RPO3F {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2b3ta1 c.66.1.30 (A:2-275) N5-glutamine methyltransferase, HemK {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2fxaa1 a.4.5.28 (A:6-167) Protease production regulatory protein Hpr {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1i5za1 a.4.5.4 (A:138-206) Catabolite gene activator protein (CAP), C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2a14a1 c.66.1.15 (A:5-261) Indolethylamine N-methyltransferase, INMT {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1i1na_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1stza1 a.4.5.51 (A:14-100) Heat-inducible transcription repressor HrcA, N-terminal domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1g8aa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d3e5ua1 a.4.5.4 (A:148-227) Chlorophenol reduction protein CprK {Desulfitobacterium hafniense [TaxId: 49338]} | Back information, alignment and structure |
|---|
| >d1jg1a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1r18a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1ws6a1 c.66.1.46 (A:15-185) Methyltransferase TTHA0928 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1v4ra1 a.4.5.6 (A:1-100) Transcriptional repressor TraR, N-terminal domain {Streptomyces sp. [TaxId: 1931]} | Back information, alignment and structure |
|---|
| >d1d5ya1 a.4.1.8 (A:3-56) Rob transcription factor, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1okra_ a.4.5.39 (A:) Methicillin resistance regulatory protein MecI {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1u5ta2 a.4.5.54 (A:165-232) Vacuolar sorting protein SNF8 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1xn7a_ a.4.5.62 (A:) Hypothetical protein YhgG {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2p8ta1 a.4.5.72 (A:14-82) Hypothetical protein PH0730 {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1s6la1 a.4.5.79 (A:21-80) Alkylmercury lyase MerB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2fpoa1 c.66.1.46 (A:10-192) Methylase YhhF {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|