Citrus Sinensis ID: 036221

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------16
MAFETKQGKWRGSVGGIVDAPINKVWTIVSQTKKLPEWMPMVERCTDLAGDEGVPGYIRLVSGFMFPQENGERSWIKERLISMDSSSHSYDYKMEASNVGLDGSVNSLKLIDYGDDSTLVSWSFAIDPVEGASEDSIIDYLGFLYKSCINRIDSAIQKV
ccccccccEEEEEEEEEEcccHHHHHHHHcccccccccccccEEEEEcccccccccEEEEEEccccccccccccEEEEEEEEEcccccEEEEEEEEcccccccEEEEEEEEEcccccEEEEEEEEEEccccccHHHHHHHHHHHHHHHHHHHHHHHHHc
ccccccccccEEEEEEEccccHHHHHHHHHccccccccccccccEEEcccccccccEEEEEEccccccccccccEEEEEEEEccccccEEEEEEEccccccccEEEEEEEEEcccccEEEEEEEEEcccccccHHHHHHHHHHHHHHHHHHHHHHHHcc
mafetkqgkwrgsvggivdapinKVWTIVSQTkklpewmpmverctdlagdegvpgyIRLVSgfmfpqengerSWIKERLIsmdssshsydykmeasnvgldgsvnslklidygddstlvswsfaidpvegasedSIIDYLGFLYKSCINRIDSAIQKV
mafetkqgkwrgsvggivdapinkVWTIVSqtkklpewmPMVERCTDLAGDEGVPGYIRLVSGFMFPQENGERSWIKERLISMDSSSHSYDYKMEASNVGLDGSVNSLKLIDYGDDSTLVSWSFAIDPVEGASEDSIIDYLGFLYKSCINRIDSAIQKV
MAFETKQGKWRGSVGGIVDAPINKVWTIVSQTKKLPEWMPMVERCTDLAGDEGVPGYIRLVSGFMFPQENGERSWIKERLISMDSSSHSYDYKMEASNVGLDGSVNSLKLIDYGDDSTLVSWSFAIDPVEGASEDSIIDYLGFLYKSCINRIDSAIQKV
*********WRGSVGGIVDAPINKVWTIVSQTKKLPEWMPMVERCTDLAGDEGVPGYIRLVSGFMFPQENGERSWIKERLI**************ASNVGLDGSVNSLKLIDYGDDSTLVSWSFAIDPVEGASEDSIIDYLGFLYKSCINRID******
*************VGGIVDAPINKVWTIVSQTKKLPEWMPMVER**********PGYIRLVSGFMFPQENGERSWIKERLISMDSSSHSYDYKMEASNVGLDGSVNSLKLIDYGDDSTLVSWSFAIDPVEGASEDSIIDYLGFLYKSCINRIDSAIQK*
**********RGSVGGIVDAPINKVWTIVSQTKKLPEWMPMVERCTDLAGDEGVPGYIRLVSGFMFPQENGERSWIKERLISMDSSSHSYDYKMEASNVGLDGSVNSLKLIDYGDDSTLVSWSFAIDPVEGASEDSIIDYLGFLYKSCINRIDSAIQKV
*******GKWRGSVGGIVDAPINKVWTIVSQTKKLPEWMPMVERCTDLAGDEGVPGYIRLVSGFMFPQENGERSWIKERLISMDSSSHSYDYKMEASNVGLDGSVNSLKLIDYGDDSTLVSWSFAIDPVEGASEDSIIDYLGFLYKSCINRIDSAIQKV
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAFETKQGKWRGSVGGIVDAPINKVWTIVSQTKKLPEWMPMVERCTDLAGDEGVPGYIRLVSGFMFPQENGERSWIKERLISMDSSSHSYDYKMEASNVGLDGSVNSLKLIDYGDDSTLVSWSFAIDPVEGASEDSIIDYLGFLYKSCINRIDSAIQKV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query159 2.2.26 [Sep-21-2011]
P59082169 Lachrymatory-factor synth N/A no 0.823 0.775 0.266 3e-10
>sp|P59082|LFS_ALLCE Lachrymatory-factor synthase OS=Allium cepa GN=LFS PE=1 SV=1 Back     alignment and function desciption
 Score = 64.3 bits (155), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 36/135 (26%), Positives = 66/135 (48%), Gaps = 4/135 (2%)

Query: 9   KWRGSVGGIV-DAPINKVWTIVSQTKKLPEWMPMVERCTDLAGDEGVPGYIRLVSGFMFP 67
           KW G V  ++ +    + WT++     L + MP +  C  + G+  V G +R V G M P
Sbjct: 20  KWSGKVHALLPNTKPEQAWTLLKDFINLHKVMPSLSVCELVEGEANVVGCVRYVKGIMHP 79

Query: 68  QENGERSWIKERLISMDSSSHSYDYKMEASNVGLDGSVNSLKLIDYGDDS-TLVSWSFAI 126
            E  E  W KE+L+++D+ + SY Y       G +    ++++++  +   +   WSF  
Sbjct: 80  IE--EEFWAKEKLVALDNKNMSYSYIFTECFTGYEDYTATMQIVEGPEHKGSRFDWSFQC 137

Query: 127 DPVEGASEDSIIDYL 141
             +EG +E +  + L
Sbjct: 138 KYIEGMTESAFTEIL 152
Produces lacrymatory factor (propanthial S-oxide) from 1-propenylsulphenic acid, an unstable compound resulting from the degradation of trans-1-propenyl-L-cysteine sulphoxide (PRENCSO) by alliinase.
Allium cepa (taxid: 4679)

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query159
359486560223 PREDICTED: uncharacterized protein LOC10 0.981 0.699 0.801 2e-70
224098513163 predicted protein [Populus trichocarpa] 0.987 0.963 0.796 3e-69
356553800182 PREDICTED: uncharacterized protein LOC10 0.981 0.857 0.762 3e-68
449533068163 PREDICTED: lachrymatory-factor synthase- 0.981 0.957 0.724 3e-66
449465047163 PREDICTED: lachrymatory-factor synthase- 0.981 0.957 0.724 3e-66
357492545167 Lachrymatory-factor synthase [Medicago t 0.981 0.934 0.75 8e-65
226496547163 lachrymatory-factor synthase [Zea mays] 0.937 0.914 0.546 2e-44
414883293163 TPA: lachrymatory-factor synthase [Zea m 0.937 0.914 0.546 3e-44
242042644160 hypothetical protein SORBIDRAFT_02g00027 0.918 0.912 0.562 3e-44
224112585103 predicted protein [Populus trichocarpa] 0.641 0.990 0.754 1e-40
>gi|359486560|ref|XP_003633454.1| PREDICTED: uncharacterized protein LOC100853171 [Vitis vinifera] Back     alignment and taxonomy information
 Score =  270 bits (690), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 125/156 (80%), Positives = 140/156 (89%)

Query: 2   AFETKQGKWRGSVGGIVDAPINKVWTIVSQTKKLPEWMPMVERCTDLAGDEGVPGYIRLV 61
           A     GKWRG+VG IVDAPI+KVW +VSQTK+LPEWMPMVERCTDL GDEGVPGYIRLV
Sbjct: 62  ALAVGNGKWRGTVGSIVDAPIDKVWVMVSQTKRLPEWMPMVERCTDLDGDEGVPGYIRLV 121

Query: 62  SGFMFPQENGERSWIKERLISMDSSSHSYDYKMEASNVGLDGSVNSLKLIDYGDDSTLVS 121
           SGFMFPQ++GERSW+KE+L+ M+ SSHSY YKMEASNVGLDGSVNSLKL+DYGDDSTLV 
Sbjct: 122 SGFMFPQQDGERSWVKEKLVFMNPSSHSYAYKMEASNVGLDGSVNSLKLVDYGDDSTLVD 181

Query: 122 WSFAIDPVEGASEDSIIDYLGFLYKSCINRIDSAIQ 157
           WSF I+P++GA EDSIIDYLGFLYKSCINRI  AI+
Sbjct: 182 WSFEINPLDGACEDSIIDYLGFLYKSCINRIKGAIE 217

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224098513|ref|XP_002311201.1| predicted protein [Populus trichocarpa] gi|222851021|gb|EEE88568.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356553800|ref|XP_003545240.1| PREDICTED: uncharacterized protein LOC100780153 [Glycine max] Back     alignment and taxonomy information
>gi|449533068|ref|XP_004173499.1| PREDICTED: lachrymatory-factor synthase-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449465047|ref|XP_004150240.1| PREDICTED: lachrymatory-factor synthase-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|357492545|ref|XP_003616561.1| Lachrymatory-factor synthase [Medicago truncatula] gi|355517896|gb|AES99519.1| Lachrymatory-factor synthase [Medicago truncatula] Back     alignment and taxonomy information
>gi|226496547|ref|NP_001150895.1| lachrymatory-factor synthase [Zea mays] gi|195642724|gb|ACG40830.1| lachrymatory-factor synthase precursor [Zea mays] Back     alignment and taxonomy information
>gi|414883293|tpg|DAA59307.1| TPA: lachrymatory-factor synthase [Zea mays] Back     alignment and taxonomy information
>gi|242042644|ref|XP_002459193.1| hypothetical protein SORBIDRAFT_02g000270 [Sorghum bicolor] gi|241922570|gb|EER95714.1| hypothetical protein SORBIDRAFT_02g000270 [Sorghum bicolor] Back     alignment and taxonomy information
>gi|224112585|ref|XP_002316234.1| predicted protein [Populus trichocarpa] gi|222865274|gb|EEF02405.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query159
TAIR|locus:2134123157 AT4G32870 "AT4G32870" [Arabido 0.949 0.961 0.314 1.1e-18
TAIR|locus:2043575167 AT2G25770 "AT2G25770" [Arabido 0.811 0.772 0.298 3.7e-16
TAIR|locus:2124077164 PYL13 "AT4G18620" [Arabidopsis 0.817 0.792 0.283 4e-06
UNIPROTKB|Q9KKQ3292 VC_A1049 "Putative uncharacter 0.628 0.342 0.318 0.00078
TIGR_CMR|VC_A1049292 VC_A1049 "hypothetical protein 0.628 0.342 0.318 0.00078
TAIR|locus:2134123 AT4G32870 "AT4G32870" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 225 (84.3 bits), Expect = 1.1e-18, P = 1.1e-18
 Identities = 49/156 (31%), Positives = 79/156 (50%)

Query:     1 MAFETKQGKWRGS-VGGIVDAPINKVWTIVSQTKKLPEWMPMVERCTDLAGDEGVPGYIR 59
             M  ET   KW G  V  +      KVW++ S    + EW P V+ C  + G +GVPG IR
Sbjct:     1 MGTETVSFKWEGKKVAQVNGVTAEKVWSVFSDFCNVQEWFPSVDTCYRVQGTDGVPGLIR 60

Query:    60 LVSGFMFPQENGERSWIKERLISMDSSSHSYDYKMEASNVGLDGSVNSLKL--IDYGDDS 117
               S     +E G R W KE+L+ +D       Y++  +NVG    V ++++  +D  D  
Sbjct:    61 YCSTTK-TKEEGSR-WAKEKLVKIDPIGRCLSYEILENNVGFRSYVATVQVTPVDGEDQV 118

Query:   118 TLVSWSFAIDPVEGASEDSIIDYLGFLYKSCINRID 153
             + + WSF  DPV+G  ++ +  Y+ F  +   N+++
Sbjct:   119 SRIEWSFVADPVDGWKKEDLESYVDFCLQHMANKME 154
GO:0003674 "molecular_function" evidence=ND
GO:0005634 "nucleus" evidence=ISM
GO:0008150 "biological_process" evidence=ND
TAIR|locus:2043575 AT2G25770 "AT2G25770" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2124077 PYL13 "AT4G18620" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q9KKQ3 VC_A1049 "Putative uncharacterized protein" [Vibrio cholerae O1 biovar El Tor str. N16961 (taxid:243277)] Back     alignment and assigned GO terms
TIGR_CMR|VC_A1049 VC_A1049 "hypothetical protein" [Vibrio cholerae O1 biovar El Tor (taxid:686)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
eugene3.00080572
hypothetical protein (163 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query159
cd07821140 cd07821, PYR_PYL_RCAR_like, Pyrabactin resistance 2e-28
pfam10604140 pfam10604, Polyketide_cyc2, Polyketide cyclase / d 4e-10
cd07812141 cd07812, SRPBCC, START/RHO_alpha_C/PITP/Bet_v1/Cox 2e-06
cd07816148 cd07816, Bet_v1-like, Ligand-binding bet_v_1 domai 0.001
pfam03364125 pfam03364, Polyketide_cyc, Polyketide cyclase / de 0.004
>gnl|CDD|176863 cd07821, PYR_PYL_RCAR_like, Pyrabactin resistance 1 (PYR1), PYR1-like (PYL), regulatory component of abscisic acid receptors (RCARs), and related proteins Back     alignment and domain information 
 Score =  102 bits (255), Expect = 2e-28
 Identities = 37/148 (25%), Positives = 74/148 (50%), Gaps = 8/148 (5%)

Query: 10  WRGSVGGIVDAPINKVWTIVSQTKKLPEWMPMVERCTDLAGDEGVPGYIRLVSGFMFPQE 69
            + +V   +DAP +KVW ++S    L +W P V  C  L G     G +R V+       
Sbjct: 1   AKVTVSVTIDAPADKVWALLSDFGGLHKWHPAVASCE-LEGGGPGVGAVRTVTLKDG--- 56

Query: 70  NGERSWIKERLISMDSSSHSYDYKMEASNVGLDGSVNSLKLIDYGDDSTLVSWSFAIDPV 129
                 ++ERL+++D +   Y Y++    + +   V ++++   GD  T V+W+   DP 
Sbjct: 57  ----GTVRERLLALDDAERRYSYRIVEGPLPVKNYVATIRVTPEGDGGTRVTWTAEFDPP 112

Query: 130 EGASEDSIIDYLGFLYKSCINRIDSAIQ 157
           EG +++    +L  +Y++ +  + +A++
Sbjct: 113 EGLTDELARAFLTGVYRAGLAALKAALE 140

The PYR/PYL/RCAR-like family belongs to the SRPBCC (START/RHO_alpha_C/PITP/Bet_v1/CoxG/CalC) domain superfamily of proteins that bind hydrophobic ligands. SRPBCC domains have a deep hydrophobic ligand-binding pocket. PYR/PYL/RCAR plant proteins are receptors involved in signal transduction. They bind abscisic acid (ABA) and mediate its signaling. ABA is a vital plant hormone, which regulates plant growth, development, and response to environmental stresses. Upon binding ABA, these plant proteins interact with a type 2C protein phosphatase (PP2C), such as ABI1 and ABI2, and inhibit their activity. When ABA is bound, a loop (designated the gate/CL2 loop) closes over the ligand binding pocket, resulting in the weakening of the inactive PYL dimer and facilitating type 2C protein phosphatase binding. In the ABA:PYL1:ABI1 complex, the gate blocks substrate access to the phosphatase active site. A conserved Trp from PP2C inserts into PYL to lock the receptor in a closed formation. This group also contains Methylobacterium extorquens AM1 MxaD. The mxaD gene is located within the mxaFJGIR(S)ACKLDEHB cluster which encodes proteins involved in methanol oxidation. MxaD may participate in the periplasmic electron transport chain for oxidation of methanol. Mutants lacking MxaD exhibit a reduced growth on methanol, and a lower rate of respiration with methanol. Length = 140
>gnl|CDD|220822 pfam10604, Polyketide_cyc2, Polyketide cyclase / dehydrase and lipid transport Back     alignment and domain information
>gnl|CDD|176854 cd07812, SRPBCC, START/RHO_alpha_C/PITP/Bet_v1/CoxG/CalC (SRPBCC) ligand-binding domain superfamily Back     alignment and domain information
>gnl|CDD|176858 cd07816, Bet_v1-like, Ligand-binding bet_v_1 domain of major pollen allergen of white birch (Betula verrucosa), Bet v 1, and related proteins Back     alignment and domain information
>gnl|CDD|217515 pfam03364, Polyketide_cyc, Polyketide cyclase / dehydrase and lipid transport Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 159
cd07816148 Bet_v1-like Ligand-binding bet_v_1 domain of major 99.91
cd07821140 PYR_PYL_RCAR_like Pyrabactin resistance 1 (PYR1), 99.89
PF10604139 Polyketide_cyc2: Polyketide cyclase / dehydrase an 99.86
cd08862138 SRPBCC_Smu440-like Ligand-binding SRPBCC domain of 99.84
cd08866144 SRPBCC_11 Ligand-binding SRPBCC domain of an uncha 99.84
cd08865140 SRPBCC_10 Ligand-binding SRPBCC domain of an uncha 99.84
cd07818150 SRPBCC_1 Ligand-binding SRPBCC domain of an unchar 99.82
cd07822141 SRPBCC_4 Ligand-binding SRPBCC domain of an unchar 99.8
cd08861142 OtcD1_ARO-CYC_like N-terminal and C-terminal aroma 99.79
cd07817139 SRPBCC_8 Ligand-binding SRPBCC domain of an unchar 99.79
cd07813138 COQ10p_like Coenzyme Q-binding protein COQ10p and 99.78
cd08860146 TcmN_ARO-CYC_like N-terminal aromatase/cyclase dom 99.78
cd07819140 SRPBCC_2 Ligand-binding SRPBCC domain of an unchar 99.77
cd07825144 SRPBCC_7 Ligand-binding SRPBCC domain of an unchar 99.75
cd07814139 SRPBCC_CalC_Aha1-like Putative hydrophobic ligand- 99.71
cd07824146 SRPBCC_6 Ligand-binding SRPBCC domain of an unchar 99.71
PF00407151 Bet_v_1: Pathogenesis-related protein Bet v I fami 99.68
cd07812141 SRPBCC START/RHO_alpha_C/PITP/Bet_v1/CoxG/CalC (SR 99.68
cd05018144 CoxG Carbon monoxide dehydrogenase subunit G (CoxG 99.67
cd07820137 SRPBCC_3 Ligand-binding SRPBCC domain of an unchar 99.64
PRK10724158 hypothetical protein; Provisional 99.61
cd07823146 SRPBCC_5 Ligand-binding SRPBCC domain of an unchar 99.55
PF03364130 Polyketide_cyc: Polyketide cyclase / dehydrase and 99.52
cd08898145 SRPBCC_CalC_Aha1-like_5 Putative hydrophobic ligan 99.38
cd08893136 SRPBCC_CalC_Aha1-like_GntR-HTH Putative hydrophobi 99.37
cd08899157 SRPBCC_CalC_Aha1-like_6 Putative hydrophobic ligan 99.35
COG5637217 Predicted integral membrane protein [Function unkn 99.31
cd08894139 SRPBCC_CalC_Aha1-like_1 Putative hydrophobic ligan 99.25
cd08876195 START_1 Uncharacterized subgroup of the steroidoge 99.2
COG3427146 Carbon monoxide dehydrogenase subunit G, CoxG [Ene 99.18
PF06240140 COXG: Carbon monoxide dehydrogenase subunit G (Cox 99.17
cd08895146 SRPBCC_CalC_Aha1-like_2 Putative hydrophobic ligan 99.17
cd07826142 SRPBCC_CalC_Aha1-like_9 Putative hydrophobic ligan 99.13
cd08896146 SRPBCC_CalC_Aha1-like_3 Putative hydrophobic ligan 99.11
COG2867146 Oligoketide cyclase/lipid transport protein [Lipid 99.11
cd08897133 SRPBCC_CalC_Aha1-like_4 Putative hydrophobic ligan 99.07
cd08900143 SRPBCC_CalC_Aha1-like_7 Putative hydrophobic ligan 99.06
cd08901136 SRPBCC_CalC_Aha1-like_8 Putative hydrophobic ligan 99.05
cd08891149 SRPBCC_CalC Ligand-binding SRPBCC domain of Microm 99.03
PF08327124 AHSA1: Activator of Hsp90 ATPase homolog 1-like pr 99.0
cd08892126 SRPBCC_Aha1 Putative hydrophobic ligand-binding SR 98.83
COG3832149 Uncharacterized conserved protein [Function unknow 98.69
PTZ00220132 Activator of HSP-90 ATPase; Provisional 98.63
cd08874205 START_STARD9-like C-terminal START domain of mamma 98.58
cd08905209 START_STARD1-like Cholesterol-binding START domain 98.37
cd08877215 START_2 Uncharacterized subgroup of the steroidoge 98.37
COG4276153 Uncharacterized conserved protein [Function unknow 98.34
cd08906209 START_STARD3-like Cholesterol-binding START domain 98.27
COG489193 Uncharacterized conserved protein [Function unknow 98.25
cd08871222 START_STARD10-like Lipid-binding START domain of m 98.25
cd00177193 START Lipid-binding START domain of mammalian STAR 98.14
cd08873235 START_STARD14_15-like Lipid-binding START domain o 98.1
cd08870209 START_STARD2_7-like Lipid-binding START domain of 98.09
cd08868208 START_STARD1_3_like Cholesterol-binding START doma 98.05
cd08903208 START_STARD5-like Lipid-binding START domain of ma 98.04
cd08869197 START_RhoGAP C-terminal lipid-binding START domain 98.0
cd08911207 START_STARD7-like Lipid-binding START domain of ma 97.97
cd08908204 START_STARD12-like C-terminal lipid-binding START 97.92
cd08867206 START_STARD4_5_6-like Lipid-binding START domain o 97.87
smart00234206 START in StAR and phosphatidylcholine transfer pro 97.81
PF10698159 DUF2505: Protein of unknown function (DUF2505); In 97.81
cd08910207 START_STARD2-like Lipid-binding START domain of ma 97.61
cd08913240 START_STARD14-like Lipid-binding START domain of m 97.6
cd08914236 START_STARD15-like Lipid-binding START domain of m 97.49
cd08904204 START_STARD6-like Lipid-binding START domain of ma 97.41
PF11687120 DUF3284: Domain of unknown function (DUF3284); Int 97.31
KOG3177227 consensus Oligoketide cyclase/lipid transport prot 97.27
cd08902202 START_STARD4-like Lipid-binding START domain of ma 97.14
PF01852206 START: START domain; InterPro: IPR002913 START (St 96.99
cd08909205 START_STARD13-like C-terminal lipid-binding START 96.91
PF08982149 DUF1857: Domain of unknown function (DUF1857); Int 96.4
cd08872235 START_STARD11-like Ceramide-binding START domain o 96.03
cd08863141 SRPBCC_DUF1857 DUF1857, an uncharacterized ligand- 95.62
cd08907205 START_STARD8-like C-terminal lipid-binding START d 80.85
>cd07816 Bet_v1-like Ligand-binding bet_v_1 domain of major pollen allergen of white birch (Betula verrucosa), Bet v 1, and related proteins Back     alignment and domain information 
Probab=99.91  E-value=4.6e-22  Score=140.44  Aligned_cols=114  Identities=25%  Similarity=0.528  Sum_probs=98.4

Q ss_pred             EEEEEEeCChHHHHHHhhcCCC--CCccccccceEEEcCCCCCCCcEEEEeccccccCCCCCcceEEEEEEeeeCCCCEE
Q 036221           13 SVGGIVDAPINKVWTIVSQTKK--LPEWMPMVERCTDLAGDEGVPGYIRLVSGFMFPQENGERSWIKERLISMDSSSHSY   90 (159)
Q Consensus        13 ~~s~~I~ap~~~VW~~l~d~~~--~~~W~p~v~~~~~~~g~~~~~G~~r~~~~~~~~~~~g~~~~~~e~i~~~d~~~~~~   90 (159)
                      ..+++|+||+|+||++++||.+  .+.|.|.+++|+.++|+ +++|++|.+.   ++ .++....++|+|+.+|+.+|++
T Consensus         4 ~~e~~i~a~ad~vW~~~~~~~~~~~~~~~p~v~~~~~~eG~-~~~GsvR~~~---~~-~~~~~~~~kE~l~~~D~~~~~~   78 (148)
T cd07816           4 EHEVELKVPAEKLWKAFVLDSHLLPPKLPPVIKSVELLEGD-GGPGSIKLIT---FG-PGGKVKYVKERIDAVDEENKTY   78 (148)
T ss_pred             EEEEEecCCHHHHHHHHhcChhhccccccccccEEEEEecC-CCCceEEEEE---Ec-CCCcceEEEEEEEEEcccccEE
Confidence            4677899999999999999984  46799999999988886 8999999987   22 1233458999999999988999


Q ss_pred             EEEEeccCc---ceeeeEEEEEEEEcCCCCeEEEEEEEEecCCC
Q 036221           91 DYKMEASNV---GLDGSVNSLKLIDYGDDSTLVSWSFAIDPVEG  131 (159)
Q Consensus        91 ~y~~~~~~~---~~~~~~~~~~l~~~~~~~t~v~w~~~~~~~~~  131 (159)
                      +|++.++++   ++.+|.++++|.|.++++|.++|+.+|++..+
T Consensus        79 ~y~vveg~~~~~~~~~y~~t~~v~~~~~~~t~v~Wt~~ye~~~~  122 (148)
T cd07816          79 KYTVIEGDVLKDGYKSYKVEIKFVPKGDGGCVVKWTIEYEKKGD  122 (148)
T ss_pred             EEEEEecccccCceEEEEEEEEEEECCCCCEEEEEEEEEEECCC
Confidence            999999876   48999999999999888999999999998754

This family includes the ligand binding domain of Bet v 1 (the major pollen allergen of white birch, Betula verrucosa) and related proteins. In addition to birch Bet v 1, this family includes other plant intracellular pathogenesis-related class 10 (PR-10) proteins, norcoclaurine synthases (NCSs), cytokinin binding proteins (CSBPs), major latex proteins (MLPs), and ripening-related proteins. It belongs to the SRPBCC (START/RHO_alpha_C/PITP/Bet_v1/CoxG/CalC) domain superfamily of proteins that bind hydrophobic ligands. SRPBCC domains have a deep hydrophobic ligand-binding pocket. Members of this family binds a diverse range of ligands. Bet v 1 can bind brassinosteroids, cytokinins, flavonoids and fatty acids. Hyp-1, a PR-10 from Hypericum perforatum/St. John's wort, catalyzes the condensation of two molecules of emodin to the bioactive naphthodianth
>cd07821 PYR_PYL_RCAR_like Pyrabactin resistance 1 (PYR1), PYR1-like (PYL), regulatory component of abscisic acid receptors (RCARs), and related proteins Back     alignment and domain information
>PF10604 Polyketide_cyc2: Polyketide cyclase / dehydrase and lipid transport; InterPro: IPR019587 This family contains polyketide cylcases/dehydrases which are enzymes involved in polyketide synthesis Back     alignment and domain information
>cd08862 SRPBCC_Smu440-like Ligand-binding SRPBCC domain of Streptococcus mutans Smu Back     alignment and domain information
>cd08866 SRPBCC_11 Ligand-binding SRPBCC domain of an uncharacterized subfamily of proteins Back     alignment and domain information
>cd08865 SRPBCC_10 Ligand-binding SRPBCC domain of an uncharacterized subfamily of proteins Back     alignment and domain information
>cd07818 SRPBCC_1 Ligand-binding SRPBCC domain of an uncharacterized subfamily of proteins Back     alignment and domain information
>cd07822 SRPBCC_4 Ligand-binding SRPBCC domain of an uncharacterized subfamily of proteins Back     alignment and domain information
>cd08861 OtcD1_ARO-CYC_like N-terminal and C-terminal aromatase/cyclase domains of Streptomyces rimosus OtcD1 and related domains Back     alignment and domain information
>cd07817 SRPBCC_8 Ligand-binding SRPBCC domain of an uncharacterized subfamily of proteins Back     alignment and domain information
>cd07813 COQ10p_like Coenzyme Q-binding protein COQ10p and similar proteins Back     alignment and domain information
>cd08860 TcmN_ARO-CYC_like N-terminal aromatase/cyclase domain of the multifunctional protein tetracenomycin (TcmN) and related domains Back     alignment and domain information
>cd07819 SRPBCC_2 Ligand-binding SRPBCC domain of an uncharacterized subfamily of proteins Back     alignment and domain information
>cd07825 SRPBCC_7 Ligand-binding SRPBCC domain of an uncharacterized subfamily of proteins Back     alignment and domain information
>cd07814 SRPBCC_CalC_Aha1-like Putative hydrophobic ligand-binding SRPBCC domain of Micromonospora echinospora CalC, human Aha1, and related proteins Back     alignment and domain information
>cd07824 SRPBCC_6 Ligand-binding SRPBCC domain of an uncharacterized subfamily of proteins Back     alignment and domain information
>PF00407 Bet_v_1: Pathogenesis-related protein Bet v I family; InterPro: IPR000916 Allergies are hypersensitivity reactions of the immune system to specific substances called allergens (such as pollen, stings, drugs, or food) that, in most people, result in no symptoms Back     alignment and domain information
>cd07812 SRPBCC START/RHO_alpha_C/PITP/Bet_v1/CoxG/CalC (SRPBCC) ligand-binding domain superfamily Back     alignment and domain information
>cd05018 CoxG Carbon monoxide dehydrogenase subunit G (CoxG) Back     alignment and domain information
>cd07820 SRPBCC_3 Ligand-binding SRPBCC domain of an uncharacterized subfamily of proteins Back     alignment and domain information
>PRK10724 hypothetical protein; Provisional Back     alignment and domain information
>cd07823 SRPBCC_5 Ligand-binding SRPBCC domain of an uncharacterized subfamily of proteins Back     alignment and domain information
>PF03364 Polyketide_cyc: Polyketide cyclase / dehydrase and lipid transport; InterPro: IPR005031 Members of this family of enzymes from Streptomyces spp Back     alignment and domain information
>cd08898 SRPBCC_CalC_Aha1-like_5 Putative hydrophobic ligand-binding SRPBCC domain of an uncharacterized subgroup of CalC- and Aha1-like proteins Back     alignment and domain information
>cd08893 SRPBCC_CalC_Aha1-like_GntR-HTH Putative hydrophobic ligand-binding SRPBCC domain of an uncharacterized subgroup of CalC- and Aha1-like proteins; some contain an N-terminal GntR family winged HTH DNA-binding domain Back     alignment and domain information
>cd08899 SRPBCC_CalC_Aha1-like_6 Putative hydrophobic ligand-binding SRPBCC domain of an uncharacterized subgroup of CalC- and Aha1-like proteins Back     alignment and domain information
>COG5637 Predicted integral membrane protein [Function unknown] Back     alignment and domain information
>cd08894 SRPBCC_CalC_Aha1-like_1 Putative hydrophobic ligand-binding SRPBCC domain of an uncharacterized subgroup of CalC- and Aha1-like proteins Back     alignment and domain information
>cd08876 START_1 Uncharacterized subgroup of the steroidogenic acute regulatory protein (StAR)-related lipid transfer (START) domain family Back     alignment and domain information
>COG3427 Carbon monoxide dehydrogenase subunit G, CoxG [Energy production and conversion] Back     alignment and domain information
>PF06240 COXG: Carbon monoxide dehydrogenase subunit G (CoxG); InterPro: IPR010419 The CO dehydrogenase structural genes coxMSL are flanked by nine accessory genes arranged as the cox gene cluster Back     alignment and domain information
>cd08895 SRPBCC_CalC_Aha1-like_2 Putative hydrophobic ligand-binding SRPBCC domain of an uncharacterized subgroup of CalC- and Aha1-like proteins Back     alignment and domain information
>cd07826 SRPBCC_CalC_Aha1-like_9 Putative hydrophobic ligand-binding SRPBCC domain of an uncharacterized subgroup of CalC- and Aha1-like proteins Back     alignment and domain information
>cd08896 SRPBCC_CalC_Aha1-like_3 Putative hydrophobic ligand-binding SRPBCC domain of an uncharacterized subgroup of CalC- and Aha1-like proteins Back     alignment and domain information
>COG2867 Oligoketide cyclase/lipid transport protein [Lipid metabolism] Back     alignment and domain information
>cd08897 SRPBCC_CalC_Aha1-like_4 Putative hydrophobic ligand-binding SRPBCC domain of an uncharacterized subgroup of CalC- and Aha1-like proteins Back     alignment and domain information
>cd08900 SRPBCC_CalC_Aha1-like_7 Putative hydrophobic ligand-binding SRPBCC domain of an uncharacterized subgroup of CalC- and Aha1-like proteins Back     alignment and domain information
>cd08901 SRPBCC_CalC_Aha1-like_8 Putative hydrophobic ligand-binding SRPBCC domain of an uncharacterized subgroup of CalC- and Aha1-like proteins Back     alignment and domain information
>cd08891 SRPBCC_CalC Ligand-binding SRPBCC domain of Micromonospora echinospora CalC and related proteins Back     alignment and domain information
>PF08327 AHSA1: Activator of Hsp90 ATPase homolog 1-like protein; InterPro: IPR013538 This family includes eukaryotic, prokaryotic and archaeal proteins that bear similarity to a C-terminal region of human activator of 90 kDa heat shock protein ATPase homologue 1 (AHSA1/p38, O95433 from SWISSPROT) Back     alignment and domain information
>cd08892 SRPBCC_Aha1 Putative hydrophobic ligand-binding SRPBCC domain of the Hsp90 co-chaperone Aha1 and related proteins Back     alignment and domain information
>COG3832 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PTZ00220 Activator of HSP-90 ATPase; Provisional Back     alignment and domain information
>cd08874 START_STARD9-like C-terminal START domain of mammalian STARD9, and related domains; lipid binding Back     alignment and domain information
>cd08905 START_STARD1-like Cholesterol-binding START domain of mammalian STARD1 and related proteins Back     alignment and domain information
>cd08877 START_2 Uncharacterized subgroup of the steroidogenic acute regulatory protein (StAR)-related lipid transfer (START) domain family Back     alignment and domain information
>COG4276 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>cd08906 START_STARD3-like Cholesterol-binding START domain of mammalian STARD3 and related proteins Back     alignment and domain information
>COG4891 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>cd08871 START_STARD10-like Lipid-binding START domain of mammalian STARD10 and related proteins Back     alignment and domain information
>cd00177 START Lipid-binding START domain of mammalian STARD1-STARD15 and related proteins Back     alignment and domain information
>cd08873 START_STARD14_15-like Lipid-binding START domain of mammalian STARDT14, -15, and related proteins Back     alignment and domain information
>cd08870 START_STARD2_7-like Lipid-binding START domain of mammalian STARD2, -7, and related proteins Back     alignment and domain information
>cd08868 START_STARD1_3_like Cholesterol-binding START domain of mammalian STARD1, -3 and related proteins Back     alignment and domain information
>cd08903 START_STARD5-like Lipid-binding START domain of mammalian STARD5 and related proteins Back     alignment and domain information
>cd08869 START_RhoGAP C-terminal lipid-binding START domain of mammalian STARD8, -12, -13 and related proteins, which also have an N-terminal Rho GTPase-activating protein (RhoGAP) domain Back     alignment and domain information
>cd08911 START_STARD7-like Lipid-binding START domain of mammalian STARD7 and related proteins Back     alignment and domain information
>cd08908 START_STARD12-like C-terminal lipid-binding START domain of mammalian STARD12 and related proteins, which also have an N-terminal Rho GTPase-activating protein (RhoGAP) domain Back     alignment and domain information
>cd08867 START_STARD4_5_6-like Lipid-binding START domain of mammalian STARD4, -5, -6, and related proteins Back     alignment and domain information
>smart00234 START in StAR and phosphatidylcholine transfer protein Back     alignment and domain information
>PF10698 DUF2505: Protein of unknown function (DUF2505); InterPro: IPR019639 This entry represents proteins found Actinobacteria and Proteobacteria Back     alignment and domain information
>cd08910 START_STARD2-like Lipid-binding START domain of mammalian STARD2 and related proteins Back     alignment and domain information
>cd08913 START_STARD14-like Lipid-binding START domain of mammalian STARDT14 and related proteins Back     alignment and domain information
>cd08914 START_STARD15-like Lipid-binding START domain of mammalian STARD15 and related proteins Back     alignment and domain information
>cd08904 START_STARD6-like Lipid-binding START domain of mammalian STARD6 and related proteins Back     alignment and domain information
>PF11687 DUF3284: Domain of unknown function (DUF3284); InterPro: IPR021701 This family of proteins with unknown function appears to be restricted to Firmicutes Back     alignment and domain information
>KOG3177 consensus Oligoketide cyclase/lipid transport protein [Lipid transport and metabolism] Back     alignment and domain information
>cd08902 START_STARD4-like Lipid-binding START domain of mammalian STARD4 and related proteins Back     alignment and domain information
>PF01852 START: START domain; InterPro: IPR002913 START (StAR-related lipid-transfer) is a lipid-binding domain in StAR, HD-ZIP and signalling proteins [] Back     alignment and domain information
>cd08909 START_STARD13-like C-terminal lipid-binding START domain of mammalian STARD13 and related proteins, which also have an N-terminal Rho GTPase-activating protein (RhoGAP) domain Back     alignment and domain information
>PF08982 DUF1857: Domain of unknown function (DUF1857); InterPro: IPR015075 This protein has no known function Back     alignment and domain information
>cd08872 START_STARD11-like Ceramide-binding START domain of mammalian STARD11 and related domains Back     alignment and domain information
>cd08863 SRPBCC_DUF1857 DUF1857, an uncharacterized ligand-binding domain of the SRPBCC domain superfamily Back     alignment and domain information
>cd08907 START_STARD8-like C-terminal lipid-binding START domain of mammalian STARD8 and related proteins, which also have an N-terminal Rho GTPase-activating protein (RhoGAP) domain Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query159
3qrz_A223 Abscisic acid receptor PYL5; crystal, hormone rece 2e-27
3rt2_A183 Abscisic acid receptor PYL10; ABA-independent PP2C 2e-26
3kl1_A190 PYL2, putative uncharacterized protein AT2G26040; 2e-26
3oqu_A205 Abscisic acid receptor PYL9; RCAR1, hormone recept 6e-24
2le1_A151 Uncharacterized protein; structural genomics, nort 9e-22
3k3k_A211 Abscisic acid receptor PYR1; ABA receptor, plant h 9e-20
3jrs_A208 PYL1, putative uncharacterized protein AT5G46790; 3e-18
3f08_A146 Uncharacterized protein Q6HG14; NESG Q6HG14_bachk 6e-17
3p51_A160 Uncharacterized protein; structural genomics, PSI- 3e-14
2vq5_A201 S-norcoclaurine synthase; lyase, S- norcoclaurine 2e-09
3oji_A189 Abscisic acid receptor PYL3; crystal, PP2C, pyraba 4e-08
2flh_A155 Cytokinin-specific binding protein; zeatin, pathog 5e-08
2i9y_A166 Major latex protein-like protein 28 or MLP-like pr 8e-07
1qzv_F154 Plant photosystem I: subunit PSAF; photosynthesis, 7e-04
>3rt2_A Abscisic acid receptor PYL10; ABA-independent PP2C inhibitor, PP2CS, hydrolase inhibitor; 1.50A {Arabidopsis thaliana} PDB: 3r6p_A* 3qtj_A* 3uqh_A 3rt0_C Length = 183 Back     alignment and structure
>3kl1_A PYL2, putative uncharacterized protein AT2G26040; abscisic acid receptor, crystal, high resolution, PP2C, HORM receptor; 1.55A {Arabidopsis thaliana} PDB: 3kdi_A* 3kdh_A 3nr4_A* 3ns2_A* 3nj0_A* 3nj1_A* 3nmh_A* 3kaz_A 3kb0_A* 3kb3_A* 3ujl_A* 3nmp_A* 3nmt_A* 3nmv_A* Length = 190 Back     alignment and structure
>3oqu_A Abscisic acid receptor PYL9; RCAR1, hormone receptor; HET: A8S; 2.68A {Arabidopsis thaliana} Length = 205 Back     alignment and structure
>2le1_A Uncharacterized protein; structural genomics, northeast structural genomics consortiu PSI-2, protein structure initiative, unknown function; NMR {Thermobifida fusca} Length = 151 Back     alignment and structure
>3k3k_A Abscisic acid receptor PYR1; ABA receptor, plant hormone receptor, A sensor, drought tolerance, plant development; HET: A8S; 1.70A {Arabidopsis thaliana} PDB: 3njo_A* 3qn1_A* 3k90_A* 3jrq_B* 3kdj_A* 3nef_A* 3neg_A* 3nmn_A* 3kay_A* Length = 211 Back     alignment and structure
>3jrs_A PYL1, putative uncharacterized protein AT5G46790; plant hormone receptor, abscisic acid, hormone recepto; HET: A8S; 2.05A {Arabidopsis thaliana} Length = 208 Back     alignment and structure
>3f08_A Uncharacterized protein Q6HG14; NESG Q6HG14_bachk Q6HG14 BUR153, structural genomics, PSI-2; 2.20A {Bacillus thuringiensis serovar konkukiorganism_taxid} PDB: 3cnw_A Length = 146 Back     alignment and structure
>3p51_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; 2.06A {Nitrosospira multiformis} Length = 160 Back     alignment and structure
>2vq5_A S-norcoclaurine synthase; lyase, S- norcoclaurine biosynthesis, dopamine, hydroxybenzaldehyde; HET: MSE LDP HBA; 2.09A {Thalictrum flavum} PDB: 2vne_A* Length = 201 Back     alignment and structure
>3oji_A Abscisic acid receptor PYL3; crystal, PP2C, pyrabactin, HOR receptor; HET: PYV; 1.84A {Arabidopsis thaliana} PDB: 3klx_A Length = 189 Back     alignment and structure
>2flh_A Cytokinin-specific binding protein; zeatin, pathogenesis-related proteins, multiple- ligand binding, plant protein; HET: ZEA; 1.20A {Vigna radiata} PDB: 3c0v_A* Length = 155 Back     alignment and structure
>2i9y_A Major latex protein-like protein 28 or MLP-like protein 28; AT1G70830, BET V1-like, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} Length = 166 Back     alignment and structure
>1qzv_F Plant photosystem I: subunit PSAF; photosynthesis,plant photosynthetic reaction center, peripheral antenna; HET: CL1 PQN; 4.44A {Pisum sativum} SCOP: i.5.1.1 Length = 154 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query159
3rt2_A183 Abscisic acid receptor PYL10; ABA-independent PP2C 99.97
3f08_A146 Uncharacterized protein Q6HG14; NESG Q6HG14_bachk 99.97
3jrs_A208 PYL1, putative uncharacterized protein AT5G46790; 99.96
3oqu_A205 Abscisic acid receptor PYL9; RCAR1, hormone recept 99.96
2le1_A151 Uncharacterized protein; structural genomics, nort 99.96
3kl1_A190 PYL2, putative uncharacterized protein AT2G26040; 99.96
3k3k_A211 Abscisic acid receptor PYR1; ABA receptor, plant h 99.96
3p51_A160 Uncharacterized protein; structural genomics, PSI- 99.96
3oji_A189 Abscisic acid receptor PYL3; crystal, PP2C, pyraba 99.95
3qrz_A223 Abscisic acid receptor PYL5; crystal, hormone rece 99.95
2i9y_A166 Major latex protein-like protein 28 or MLP-like pr 99.91
2flh_A155 Cytokinin-specific binding protein; zeatin, pathog 99.91
3ijt_A155 SMU.440, putative uncharacterized protein; hypothe 99.91
1e09_A159 PRU AV 1; allergen, major cherry allergen, pathoge 99.91
3rws_A168 MTN13 protein; zeatin, cytokinin, hormone, lucerne 99.91
1tw0_A157 Pathogenesis-related class 10 protein SPE-16; seve 99.91
2vjg_A154 Major allergen DAU C 1; major carrot allergen, pat 99.9
4a8u_A159 Major pollen allergen BET V 1-J; PR-10 protein; 1. 99.9
2qim_A158 PR10.2B; trans-zeatin, cytokinin, plant hormones, 99.9
1icx_A155 Protein LLR18A, LLPR10.1A; 7-stranded beta sheet, 99.9
3ie5_A165 Phenolic oxidative coupling protein HYP-1; hyperic 99.87
2vq5_A201 S-norcoclaurine synthase; lyase, S- norcoclaurine 99.87
3tvq_A169 Multifunctional cyclase-dehydratase-3-O-methyl TR 99.85
3tfz_A172 Cyclase; helix-GRIP, BET V1-like superfamily, bios 99.85
3tl1_A159 WHIE ORF VI, polyketide cyclase; helix-GRIP fold, 99.85
2d4r_A147 Hypothetical protein TTHA0849; start domain, struc 99.84
2wql_A154 Major allergen DAU C 1; pathogenesis-related prote 99.82
3ggn_A155 Uncharacterized protein DR_A0006; structural genom 99.8
1t17_A148 Conserved hypothetical protein; beta-alpha-beta-BE 99.75
2pcs_A162 Conserved protein; structural genomics, unknown fu 99.7
2ns9_A157 Hypothetical protein APE2225; uncharacterized cons 99.66
3p9v_A161 Uncharacterized protein; structural genomics, PSI- 99.57
1xuv_A178 Hypothetical protein MM0500; alpha-beta protein, n 99.51
2il5_A171 Hypothetical protein; structural genomics, APC2365 99.5
2leq_A146 Uncharacterized protein; start domains, structural 99.48
1xn6_A143 Hypothetical protein BC4709; structural genomics, 99.47
1z94_A147 Conserved hypothetical protein; NESG, CV1439, stru 99.45
2lak_A160 AHSA1-like protein RHE_CH02687; NESG, structural g 99.44
1vjh_A122 BET V I allergen family; structural genomics, cent 99.43
1xfs_A178 NC_840354, conserved hypothetical protein; structu 99.41
2lcg_A142 Uncharacterized protein; start domain, structural 99.39
2ldk_A172 Uncharacterized protein; structural genomics, nort 99.39
3q6a_A135 Uncharacterized protein; structural genomics, PSI- 99.39
3pu2_A164 Uncharacterized protein; SRPBCC superfamily, PSI-b 99.37
2l8o_A144 Uncharacterized protein; mixed alpha-beta protein, 99.37
2lgh_A144 Uncharacterized protein; AHSA1, start domain, COG3 99.34
3q64_A162 MLL3774 protein; structural genomics, PSI-biology, 99.34
3rd6_A161 MLL3558 protein; structural genomics, PSI-biology, 99.33
3eli_A152 AHSA1, AHA1 domain protein; alpha-beta protein, st 99.32
2lf2_A175 Uncharacterized protein; NESG, structural genomics 99.32
1xn5_A146 BH1534 unknown conserved protein; structural genom 99.29
2nn5_A184 Hypothetical protein EF_2215; structural genomics, 99.29
2l9p_A164 Uncharacterized protein; structural genomics, nort 99.29
3q63_A151 MLL2253 protein; structural genomics, PSI-biology, 99.28
3put_A166 Hypothetical conserved protein; structural genomic 99.26
2kew_A152 Uncharacterized protein YNDB; start domain, resona 99.25
3uid_A168 Putative uncharacterized protein; SRPBCC superfami 99.25
2qpv_A156 Uncharacterized protein ATU1531; structural genomi 99.21
2k5g_A191 Uncharacterized protein; structural genomiccs, pro 99.2
3qsz_A189 STAR-related lipid transfer protein; structural ge 99.15
1zxf_A155 CALC; SELF-sacrificing resistance protein, structu 99.02
4fpw_A181 CALU16; structural genomics, PSI-biology, northeas 99.01
1x53_A145 Activator of 90 kDa heat shock protein ATPase homo 99.01
3ni8_A158 PFC0360W protein; heat shock, malaria, ATPase, str 99.0
3oh8_A 516 Nucleoside-diphosphate sugar epimerase (SULA FAMI; 98.94
2luz_A192 CALU16; structural genomics, northeast structural 98.94
1ln1_A214 PC-TP, phosphatidylcholine transfer protein; start 98.69
3p0l_A221 Steroidogenic acute regulatory protein, mitochond; 98.21
2lio_A136 Uncharacterized protein; structural genomics, nort 98.2
1jss_A224 Stard4, cholesterol-regulated start protein 4; sta 98.16
2r55_A231 STAR-related lipid transfer protein 5; alpha and b 98.09
1em2_A229 MLN64 protein; beta barrel, lipid binding protein; 97.96
2pso_A237 STAR-related lipid transfer protein 13; alpha and 97.75
2e3n_A255 Lipid-transfer protein CERT; ceramide transfer, li 97.69
3fo5_A258 Thioesterase, adipose associated, isoform BFIT2; o 97.49
2ffs_A157 Hypothetical protein PA1206; 7-stranded beta sheet 96.36
>3rt2_A Abscisic acid receptor PYL10; ABA-independent PP2C inhibitor, PP2CS, hydrolase inhibitor; 1.50A {Arabidopsis thaliana} PDB: 3r6p_A* 3qtj_A* 3uqh_A 3rt0_C Back     alignment and structure
Probab=99.97  E-value=1e-29  Score=183.65  Aligned_cols=148  Identities=20%  Similarity=0.347  Sum_probs=130.8

Q ss_pred             ccccceEEEEEEEEeCChHHHHHHhhcCCCCCccccccceEEEcCCCCCCCcEEEEeccccccCCCCCc-ceEEEEEEee
Q 036221            5 TKQGKWRGSVGGIVDAPINKVWTIVSQTKKLPEWMPMVERCTDLAGDEGVPGYIRLVSGFMFPQENGER-SWIKERLISM   83 (159)
Q Consensus         5 ~~~~~~~~~~s~~I~ap~~~VW~~l~d~~~~~~W~p~v~~~~~~~g~~~~~G~~r~~~~~~~~~~~g~~-~~~~e~i~~~   83 (159)
                      -.+.+=...++.+|+||+++||++++||.++++|.|.+.+| .++|+++++|++|.++     +.+|.+ ..++|+|+.+
T Consensus        22 ~~~~~~~~~v~~~I~Apa~~VW~~v~df~~l~~w~P~V~s~-~~eG~~ggvGsvR~lt-----~~~G~p~~~vkErL~~~   95 (183)
T 3rt2_A           22 LVESQCSSTLVKHIKAPLHLVWSIVRRFDEPQKYKPFISRC-VVQGKKLEVGSVREVD-----LKSGLPATKSTEVLEIL   95 (183)
T ss_dssp             CSTTEEEEEEEEEESSCHHHHHHHHTCTTCGGGTCTTEEEE-EESSSCCCTTCEEEEE-----ECCSSTTCEEEEEEEEE
T ss_pred             CCCCceEEEEEEEEeCCHHHHHHHHhCcCchhhcCccceEE-EeeCCCCCCCcEEEEE-----eCCCCccceEEEEEEEE
Confidence            34556667777899999999999999999999999999999 5677678999999986     234422 4899999999


Q ss_pred             eCCCCEEEEEEeccCcceeeeEEEEEEEEcC-CC--CeEEEEEEEEecCCCCChhHHHHHHHHHHHHHHHHHHHHHhh
Q 036221           84 DSSSHSYDYKMEASNVGLDGSVNSLKLIDYG-DD--STLVSWSFAIDPVEGASEDSIIDYLGFLYKSCINRIDSAIQK  158 (159)
Q Consensus        84 d~~~~~~~y~~~~~~~~~~~~~~~~~l~~~~-~~--~t~v~w~~~~~~~~~~~~~~~~~~~~~~~~~~l~~l~~~~e~  158 (159)
                      |+.+|+++|+++++++|+++|.++++|.|.+ +|  +|.|+|+++|+++.+...+.+..++...|+.+|++|++.+|+
T Consensus        96 D~~~~~~sY~Iieg~lp~~~y~ati~v~p~~~dG~~gt~V~Ws~~fd~~~g~~~e~~~~~~~~i~~~~L~~L~~~~e~  173 (183)
T 3rt2_A           96 DDNEHILGIRIVGGDHRLKNYSSTISLHSETIDGKTGTLAIESFVVDVPEGNTKEETCFFVEALIQCNLNSLADVTER  173 (183)
T ss_dssp             ETTTTEEEEEEEEESCSCTTCEEEEEEEEEEETTEEEEEEEEEEEEECCTTCCHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             ECCCCEEEEEEecCCcceeEEEEEEEEEEecCCCCCCEEEEEEEEEEcCCCCCHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            9999999999999988999999999999986 55  699999999999888889999999999999999999999986
>3f08_A Uncharacterized protein Q6HG14; NESG Q6HG14_bachk Q6HG14 BUR153, structural genomics, PSI-2; 2.20A {Bacillus thuringiensis serovar konkukiorganism_taxid} SCOP: d.129.3.8 PDB: 3cnw_A Back     alignment and structure
>3jrs_A PYL1, putative uncharacterized protein AT5G46790; plant hormone receptor, abscisic acid, hormone recepto; HET: A8S; 2.05A {Arabidopsis thaliana} Back     alignment and structure
>3oqu_A Abscisic acid receptor PYL9; RCAR1, hormone receptor; HET: A8S; 2.68A {Arabidopsis thaliana} Back     alignment and structure
>2le1_A Uncharacterized protein; structural genomics, northeast structural genomics consortiu PSI-2, protein structure initiative, unknown function; NMR {Thermobifida fusca} Back     alignment and structure
>3kl1_A PYL2, putative uncharacterized protein AT2G26040; abscisic acid receptor, crystal, high resolution, PP2C, HORM receptor; 1.55A {Arabidopsis thaliana} PDB: 3kdi_A* 3kdh_A 3nr4_A* 3ns2_A* 3nj0_A* 3nj1_A* 3nmh_A* 3kaz_A 3kb0_A* 3kb3_A* 3ujl_A* 3nmp_A* 3nmt_A* 3nmv_A* Back     alignment and structure
>3k3k_A Abscisic acid receptor PYR1; ABA receptor, plant hormone receptor, A sensor, drought tolerance, plant development; HET: A8S; 1.70A {Arabidopsis thaliana} PDB: 3njo_A* 3qn1_A* 3k90_A* 3zvu_A* 3jrq_B* 3kdj_A* 3nef_A* 3neg_A* 3nmn_A* 3kay_A* Back     alignment and structure
>3p51_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; 2.06A {Nitrosospira multiformis} Back     alignment and structure
>3oji_A Abscisic acid receptor PYL3; crystal, PP2C, pyrabactin, HOR receptor; HET: PYV; 1.84A {Arabidopsis thaliana} PDB: 4ds8_A* 3klx_A* 4dsb_A* 4dsc_A* Back     alignment and structure
>2i9y_A Major latex protein-like protein 28 or MLP-like protein 28; AT1G70830, BET V1-like, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} Back     alignment and structure
>2flh_A Cytokinin-specific binding protein; zeatin, pathogenesis-related proteins, multiple- ligand binding, plant protein; HET: ZEA; 1.20A {Vigna radiata} PDB: 3c0v_A* Back     alignment and structure
>3ijt_A SMU.440, putative uncharacterized protein; hypothetical protein, unknown function; 2.38A {Streptococcus mutans} SCOP: d.129.3.9 PDB: 2b79_A Back     alignment and structure
>1e09_A PRU AV 1; allergen, major cherry allergen, pathogenesis-related protein, heteronuclear structure; NMR {Prunus avium} SCOP: d.129.3.1 PDB: 1h2o_A 2lpx_A Back     alignment and structure
>1tw0_A Pathogenesis-related class 10 protein SPE-16; seven antiparallel beta-sheet, plant protein; 2.20A {Pachyrhizus erosus} SCOP: d.129.3.1 PDB: 1txc_A* Back     alignment and structure
>4a8u_A Major pollen allergen BET V 1-J; PR-10 protein; 1.16A {Betula pendula} PDB: 4a8v_A* 4a87_A* 4a81_A* 4a80_A* 4a83_A* 4a86_A* 4a85_A* 4a88_A 4a8g_A* 1b6f_A 1btv_A 1bv1_A 1fsk_A 4a84_A* 1llt_A 1fm4_A* 3k78_A 1qmr_A Back     alignment and structure
>2qim_A PR10.2B; trans-zeatin, cytokinin, plant hormones, plant protein, PR-1 protein, pathogenesis-related protein, allergen; HET: ZEA; 1.35A {Lupinus luteus} PDB: 3e85_A* 1xdf_A* 2k7h_A Back     alignment and structure
>1icx_A Protein LLR18A, LLPR10.1A; 7-stranded beta sheet, C-terminal helix, allergen; 1.95A {Lupinus luteus} SCOP: d.129.3.1 PDB: 1ifv_A Back     alignment and structure
>3ie5_A Phenolic oxidative coupling protein HYP-1; hypericin, ST JOHN'S WORT, depression, allergy, PR-10 protein, cytokinin, plant hormones; HET: PGE PG4 PE8 1PE; 1.69A {Hypericum perforatum} SCOP: d.129.3.0 Back     alignment and structure
>2vq5_A S-norcoclaurine synthase; lyase, S- norcoclaurine biosynthesis, dopamine, hydroxybenzaldehyde; HET: MSE LDP HBA; 2.09A {Thalictrum flavum} PDB: 2vne_A* Back     alignment and structure
>3tvq_A Multifunctional cyclase-dehydratase-3-O-methyl TR TCMN; tetracenomycin, aromatase, taxifolin, dihyroquercet helix-GRIP fold; HET: DQH; 1.67A {Streptomyces glaucescens} PDB: 2rer_A 2res_A 2rez_A Back     alignment and structure
>3tfz_A Cyclase; helix-GRIP, BET V1-like superfamily, biosynthetic protein; HET: CXS; 2.39A {Streptomyces SP} Back     alignment and structure
>3tl1_A WHIE ORF VI, polyketide cyclase; helix-GRIP fold, polyketide C9-C14 aromatase/cyclase, linear beta-ketone intermediate; HET: JRO; 1.80A {Streptomyces coelicolor} PDB: 3tvr_A 2kf2_A Back     alignment and structure
>2d4r_A Hypothetical protein TTHA0849; start domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; 2.40A {Thermus thermophilus} SCOP: d.129.3.6 Back     alignment and structure
>2wql_A Major allergen DAU C 1; pathogenesis-related protein, plant defense; HET: P4C; 2.70A {Daucus carota} PDB: 2bk0_A Back     alignment and structure
>3ggn_A Uncharacterized protein DR_A0006; structural genomics, PSI- 2, protein structure initiative, northeast structural genomics consortium; 2.00A {Deinococcus radiodurans R1} PDB: 2kcz_A Back     alignment and structure
>1t17_A Conserved hypothetical protein; beta-alpha-beta-BETA-beta-BETA-beta-BETA-helix, structural G protein structure initiative, PSI, NESG; NMR {Caulobacter crescentus} SCOP: d.129.3.6 Back     alignment and structure
>2pcs_A Conserved protein; structural genomics, unknown function, ligand binding, PSI-2 structure initiative; HET: UNL; 2.40A {Geobacillus kaustophilus} SCOP: d.129.3.10 Back     alignment and structure
>2ns9_A Hypothetical protein APE2225; uncharacterized conserved protein, structural genomics, PSI, structure initiative; 1.80A {Aeropyrum pernix} SCOP: d.129.3.10 Back     alignment and structure
>3p9v_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; 1.78A {Marinobacter aquaeolei} Back     alignment and structure
>1xuv_A Hypothetical protein MM0500; alpha-beta protein, northeast structural genomics consortium, NESG, structural genomics; 2.10A {Methanosarcina mazei GO1} SCOP: d.129.3.5 Back     alignment and structure
>2il5_A Hypothetical protein; structural genomics, APC23650, PSI-2, structure initiative; 2.30A {Staphylococcus aureus subsp} SCOP: d.129.3.5 Back     alignment and structure
>2leq_A Uncharacterized protein; start domains, structural genomics, PSI-biology, protein STR initiative; NMR {Cytophaga hutchinsonii} Back     alignment and structure
>1xn6_A Hypothetical protein BC4709; structural genomics, protein structure initiative, PSI, NESG target protein BCR68, alpha + beta; NMR {Bacillus cereus} SCOP: d.129.3.5 Back     alignment and structure
>1z94_A Conserved hypothetical protein; NESG, CV1439, structural genomics, PSI structure initiative; 2.10A {Chromobacterium violaceum} SCOP: d.129.3.5 Back     alignment and structure
>2lak_A AHSA1-like protein RHE_CH02687; NESG, structural genomics, northeast structural genomics CON PSI-biology, structure genomics, unknown function; NMR {Rhizobium etli} Back     alignment and structure
>1vjh_A BET V I allergen family; structural genomics, center for eukaryotic structural genomics, protein structure initiative, CESG, plant protein; 2.10A {Arabidopsis thaliana} SCOP: d.129.3.1 PDB: 2q3q_A Back     alignment and structure
>1xfs_A NC_840354, conserved hypothetical protein; structural genomics, protein structure initiative, NESG, ALP protein, PSI; 1.70A {Nitrosomonas europaea} SCOP: d.129.3.5 Back     alignment and structure
>2lcg_A Uncharacterized protein; start domain, structural genomics, northeast structural GENO consortium, NESG, unknown function, AHSA1; NMR {Ralstonia metallidurans} Back     alignment and structure
>2ldk_A Uncharacterized protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Arthrobacter aurescens} Back     alignment and structure
>3q6a_A Uncharacterized protein; structural genomics, PSI-biology; 1.80A {Staphylococcus saprophyticus subsp} Back     alignment and structure
>3pu2_A Uncharacterized protein; SRPBCC superfamily, PSI-biology, NESG, RHR263, structural GE protein structure initiative; HET: MSE; 2.61A {Rhodobacter sphaeroides} Back     alignment and structure
>2l8o_A Uncharacterized protein; mixed alpha-beta protein, PSI-biology, structural genomics, structure initiative; NMR {Cytophaga hutchinsonii} Back     alignment and structure
>2lgh_A Uncharacterized protein; AHSA1, start domain, COG3832, PF08327, HSP90, heat shock, ST genomics, PSI-biology; NMR {Aeromonas hydrophila subsp} Back     alignment and structure
>3q64_A MLL3774 protein; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; 1.50A {Mesorhizobium loti} Back     alignment and structure
>3rd6_A MLL3558 protein; structural genomics, PSI-biology, northeast structural genom consortium, NESG, unknown function; 2.80A {Mesorhizobium loti} Back     alignment and structure
>3eli_A AHSA1, AHA1 domain protein; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.80A {Silicibacter pomeroyi} SCOP: d.129.3.5 Back     alignment and structure
>2lf2_A Uncharacterized protein; NESG, structural genomics, PSI-biology, protein structure in northeast structural genomics consortium; NMR {Cytophaga hutchinsonii} Back     alignment and structure
>1xn5_A BH1534 unknown conserved protein; structural genomics, protein structure initiative, PSI, BACI halodurans protein BH1534, alpha + beta; NMR {Bacillus halodurans} SCOP: d.129.3.5 Back     alignment and structure
>2nn5_A Hypothetical protein EF_2215; structural genomics, APC29336, PSI-2, structure initiative; HET: MSE; 1.45A {Enterococcus faecalis} SCOP: d.129.3.5 Back     alignment and structure
>2l9p_A Uncharacterized protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Staphylococcus epidermidis} Back     alignment and structure
>3q63_A MLL2253 protein; structural genomics, PSI-biology, protein structure initiati alpha-beta protein, unknown, structure genomics; 2.00A {Mesorhizobium loti} Back     alignment and structure
>3put_A Hypothetical conserved protein; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium; 1.83A {Rhizobium etli cfn 42} PDB: 3otl_A* Back     alignment and structure
>2kew_A Uncharacterized protein YNDB; start domain, resonance assignments, lipid binding, structural genomics, unknown FU PSI-2; NMR {Bacillus subtilis subsp} PDB: 2kte_A Back     alignment and structure
>3uid_A Putative uncharacterized protein; SRPBCC superfamily, beta sandwich, function, structural genomics, TB structural genomics conso TBSGC; 1.57A {Mycobacterium smegmatis} SCOP: d.129.3.0 Back     alignment and structure
>2qpv_A Uncharacterized protein ATU1531; structural genomics, PSI protein structure initiative, midwest center for structural genomics; 2.35A {Agrobacterium tumefaciens str} SCOP: d.129.3.8 Back     alignment and structure
>2k5g_A Uncharacterized protein; structural genomiccs, protein structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} SCOP: d.129.3.5 Back     alignment and structure
>3qsz_A STAR-related lipid transfer protein; structural genomics, PSI-biology; 2.39A {Xanthomonas axonopodis PV} Back     alignment and structure
>1zxf_A CALC; SELF-sacrificing resistance protein, structural genomics, PSI, protein structure initiative; NMR {Micromonospora echinospora} SCOP: d.129.3.5 PDB: 2gkc_A* 2gkd_A 2l65_A* Back     alignment and structure
>4fpw_A CALU16; structural genomics, PSI-biology, northeast structural genom consortium, NESG, unknown function; 2.50A {Micromonospora echinospora} PDB: 2luz_A Back     alignment and structure
>1x53_A Activator of 90 kDa heat shock protein ATPase homolog 1; AHA1, HSP90,DUF704, C-terminal domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.129.3.5 Back     alignment and structure
>3ni8_A PFC0360W protein; heat shock, malaria, ATPase, structural genomics consortium, unknown function; 2.50A {Plasmodium falciparum} Back     alignment and structure
>3oh8_A Nucleoside-diphosphate sugar epimerase (SULA FAMI; DUF1731_C, northeast structural genomics consortium, NESG, C PSI-biology; 2.00A {Corynebacterium glutamicum} Back     alignment and structure
>2luz_A CALU16; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Micromonospora echinospora} Back     alignment and structure
>1ln1_A PC-TP, phosphatidylcholine transfer protein; start domain, lipid binding protein; HET: DLP; 2.40A {Homo sapiens} SCOP: d.129.3.2 PDB: 1ln2_A* 1ln3_A* Back     alignment and structure
>3p0l_A Steroidogenic acute regulatory protein, mitochond; structural genomics consortium, SGC, start domain, cholester transport, cholesterol; 3.40A {Homo sapiens} Back     alignment and structure
>2lio_A Uncharacterized protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>1jss_A Stard4, cholesterol-regulated start protein 4; start domain, structural genomics, PSI, protein structure initiative; 2.20A {Mus musculus} SCOP: d.129.3.2 Back     alignment and structure
>2r55_A STAR-related lipid transfer protein 5; alpha and beta protein, cholesterol binding, structural GENO structural genomics consortium, SGC; 2.50A {Homo sapiens} Back     alignment and structure
>1em2_A MLN64 protein; beta barrel, lipid binding protein; HET: TAR; 2.20A {Homo sapiens} SCOP: d.129.3.2 Back     alignment and structure
>2pso_A STAR-related lipid transfer protein 13; alpha and beta protein, lipid binding, helix swapping, struc genomics, structural genomics consortium, SGC; 2.80A {Homo sapiens} SCOP: d.129.3.2 Back     alignment and structure
>2e3n_A Lipid-transfer protein CERT; ceramide transfer, lipid transport; HET: 6CM; 1.40A {Homo sapiens} PDB: 2e3m_A* 2e3o_A* 2e3p_A* 2e3q_A* 2e3r_A* 2e3s_A 2z9y_A* 3h3q_A* 3h3r_A* 3h3s_A* 3h3t_A* 2z9z_A* Back     alignment and structure
>3fo5_A Thioesterase, adipose associated, isoform BFIT2; orthogonal bundle, consortium, lipid transport; HET: 1PE TCE; 2.00A {Homo sapiens} Back     alignment and structure
>2ffs_A Hypothetical protein PA1206; 7-stranded beta sheet, C-terminal helix, structural genomics protein structure initiative; HET: MSE; 2.50A {Pseudomonas aeruginosa} SCOP: d.129.3.7 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 159
d3cnwa1138 d.129.3.8 (A:3-140) Uncharacterized protein XoxI { 2e-11
d1txca1147 d.129.3.1 (A:1-147) Plant pathogenesis-related pro 8e-09
d1fm4a_159 d.129.3.1 (A:) Major tree pollen allergen {Europea 2e-08
d1icxa_155 d.129.3.1 (A:) Plant pathogenesis-related protein 2e-07
d1e09a_159 d.129.3.1 (A:) Major tree pollen allergen {Sweet c 6e-07
d2bk0a1153 d.129.3.1 (A:2-154) Major allergen api g 1 {Celery 2e-05
d2rera1155 d.129.3.6 (A:1-155) Multifunctional enzyme TcmN, c 3e-05
d2d4ra1146 d.129.3.6 (A:2-147) Hypothetical protein TTHA0849 3e-04
d2qpva1133 d.129.3.8 (A:1-133) Uncharacterized protein Atu153 0.001
d2pcsa1147 d.129.3.10 (A:1-147) Hypothetical protein GKP20 {G 0.001
d1xuva_163 d.129.3.5 (A:) Hypothetical protein MM0500 {Methan 0.001
>d3cnwa1 d.129.3.8 (A:3-140) Uncharacterized protein XoxI {Bacillus cereus [TaxId: 1396]} Length = 138 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: TBP-like
superfamily: Bet v1-like
family: Atu1531-like
domain: Uncharacterized protein XoxI
species: Bacillus cereus [TaxId: 1396]

 Score = 56.4 bits (135), Expect = 2e-11
 Identities = 23/139 (16%), Positives = 52/139 (37%), Gaps = 14/139 (10%)

Query: 18  VDAPINKVWTIVSQTKKLPEWMPMVERCTDLAGDEGVPGYIRLVSGFMFPQENGERSWIK 77
           +     +VW ++     LP+W+P +       G              +    N +   I 
Sbjct: 10  IFGSPEQVWQLIGGFNSLPDWLPYIPSSKLTEGGR------------VRHLANPDGDTII 57

Query: 78  ERLISMDSSSHSYDYKMEASNVGLDGSVNSLKLIDYGDDS-TLVSWSFAIDPVEGASEDS 136
           ERL   +     Y Y +  +   +   ++++++ +  + + +LV WS    P    S++ 
Sbjct: 58  ERLEVFNDKERYYTYSIMNAPFPVTNYLSTIQVKEGTESNTSLVEWSGTFTP-VEVSDEE 116

Query: 137 IIDYLGFLYKSCINRIDSA 155
            I+    +Y   +  +  A
Sbjct: 117 AINLFHGIYSDGLKALQQA 135
>d1txca1 d.129.3.1 (A:1-147) Plant pathogenesis-related protein PR10 {Jicama (Pachyrhizus erosus), SPE-16 [TaxId: 109171]} Length = 147 Back     information, alignment and structure
>d1fm4a_ d.129.3.1 (A:) Major tree pollen allergen {European white birch (Betula pendula), Bet v 1-l [TaxId: 3505]} Length = 159 Back     information, alignment and structure
>d1icxa_ d.129.3.1 (A:) Plant pathogenesis-related protein PR10 {Yellow lupine (Lupinus luteus) [TaxId: 3873]} Length = 155 Back     information, alignment and structure
>d1e09a_ d.129.3.1 (A:) Major tree pollen allergen {Sweet cherry (Prunus avium), pru av 1 [TaxId: 42229]} Length = 159 Back     information, alignment and structure
>d2bk0a1 d.129.3.1 (A:2-154) Major allergen api g 1 {Celery (Apium graveolens) [TaxId: 4045]} Length = 153 Back     information, alignment and structure
>d2rera1 d.129.3.6 (A:1-155) Multifunctional enzyme TcmN, cyclase/aromatase domain {Streptomyces glaucescens [TaxId: 1907]} Length = 155 Back     information, alignment and structure
>d2d4ra1 d.129.3.6 (A:2-147) Hypothetical protein TTHA0849 {Thermus thermophilus [TaxId: 274]} Length = 146 Back     information, alignment and structure
>d2qpva1 d.129.3.8 (A:1-133) Uncharacterized protein Atu1531 {Agrobacterium tumefaciens [TaxId: 358]} Length = 133 Back     information, alignment and structure
>d2pcsa1 d.129.3.10 (A:1-147) Hypothetical protein GKP20 {Geobacillus kaustophilus [TaxId: 1462]} Length = 147 Back     information, alignment and structure
>d1xuva_ d.129.3.5 (A:) Hypothetical protein MM0500 {Methanosarcina mazei [TaxId: 2209]} Length = 163 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query159
d3cnwa1138 Uncharacterized protein XoxI {Bacillus cereus [Tax 99.96
d2b79a1137 Hypothetical protein SMU440 {Streptococcus mutans 99.88
d2rera1155 Multifunctional enzyme TcmN, cyclase/aromatase dom 99.85
d2d4ra1146 Hypothetical protein TTHA0849 {Thermus thermophilu 99.84
d1fm4a_159 Major tree pollen allergen {European white birch ( 99.82
d1txca1147 Plant pathogenesis-related protein PR10 {Jicama (P 99.81
d1e09a_159 Major tree pollen allergen {Sweet cherry (Prunus a 99.81
d1icxa_155 Plant pathogenesis-related protein PR10 {Yellow lu 99.8
d2bk0a1153 Major allergen api g 1 {Celery (Apium graveolens) 99.79
d1xdfa1157 Plant pathogenesis-related protein PR10 {Yellow lu 99.78
d2ns9a1147 Hypothetical protein APE2225 {Aeropyrum pernix [Ta 99.75
d1t17a_148 Hypothetical protein CC1736 {Caulobacter crescentu 99.64
d2qpva1133 Uncharacterized protein Atu1531 {Agrobacterium tum 99.59
d2pcsa1147 Hypothetical protein GKP20 {Geobacillus kaustophil 99.53
d1xuva_163 Hypothetical protein MM0500 {Methanosarcina mazei 99.44
d2il5a1164 Hypothetical protein SA2116 {Staphylococcus aureus 99.38
d1vjha_120 Hypothetical protein At1G24000 {Thale cress (Arabi 99.23
d1xfsa_165 Hypothetical protein NE0264 {Nitrosomonas europaea 99.21
d1z94a1143 Hypothetical protein CV1439 {Chromobacterium viola 99.19
d1xn6a_143 Hypothetical protein BC4709 {Bacillus cereus [TaxI 99.19
d1xn5a_138 Hypothetical protein BH1534 {Bacillus halodurans [ 99.15
d2nn5a1160 Hypothetical protein EF2215 {Enterococcus faecalis 99.11
d1zxfa1155 Calicheamicin gene cluster protein CalC {Micromono 99.0
d3elia1143 Uncharacterized protein SPO3351 {Silicibacter pome 99.0
d2k5ga1183 Uncharacterized protein BPP1335 {Bordetella parape 98.76
d1jssa_199 Cholesterol-regulated Start protein 4 (Stard4). {M 98.46
d1x53a1132 Activator of 90 kda heat shock protein ATPase homo 98.45
d1em2a_214 Lipid transport domain of Mln64 {Human (Homo sapie 98.32
d1ln1a_203 Phosphatidylcholine transfer protein {Human (Homo 98.21
d2psoa1197 Star-related lipid transfer protein 13 {Human (Hom 97.58
d2ffsa1151 Hypothetical protein PA1206 {Pseudomonas aeruginos 96.83
>d3cnwa1 d.129.3.8 (A:3-140) Uncharacterized protein XoxI {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: TBP-like
superfamily: Bet v1-like
family: Atu1531-like
domain: Uncharacterized protein XoxI
species: Bacillus cereus [TaxId: 1396]

Probab=99.96  E-value=2.2e-27  Score=162.88  Aligned_cols=134  Identities=20%  Similarity=0.454  Sum_probs=116.9

Q ss_pred             EEEEEEEEeCChHHHHHHhhcCCCCCccccccceEEEcCCCCCCCcEEEEeccccccCCCCCcceEEEEEEeeeCCCCEE
Q 036221           11 RGSVGGIVDAPINKVWTIVSQTKKLPEWMPMVERCTDLAGDEGVPGYIRLVSGFMFPQENGERSWIKERLISMDSSSHSY   90 (159)
Q Consensus        11 ~~~~s~~I~ap~~~VW~~l~d~~~~~~W~p~v~~~~~~~g~~~~~G~~r~~~~~~~~~~~g~~~~~~e~i~~~d~~~~~~   90 (159)
                      +.+.|++|+|||++||++++||.++++|+|.+.+|+...+     |++|.+.     +.+|  ..+.|+++.+|+++|++
T Consensus         3 ~~~~si~I~A~pe~VW~~v~df~~~~~W~p~v~~~~~~~~-----G~~R~~~-----~~~g--~~~~E~l~~~d~~~~~~   70 (138)
T d3cnwa1           3 HTTTSMEIFGSPEQVWQLIGGFNSLPDWLPYIPSSKLTEG-----GRVRHLA-----NPDG--DTIIERLEVFNDKERYY   70 (138)
T ss_dssp             EEEEEEEESSCHHHHHHHHCCTTCGGGTCTTCSEEEEEGG-----GTEEEEE-----CTTC--CEEEEEEEEEETTTTEE
T ss_pred             cEEEEEEEeCCHHHHHHHHhCccchHHHhcccceeEeecC-----ceeEEEE-----ecCC--ceeEEEEEEEeCCCcEE
Confidence            5678999999999999999999999999999999985432     6778885     3344  57899999999998999


Q ss_pred             EEEEeccCcceeeeEEEEEEEEcCC-CCeEEEEEEEEecCCCCChhHHHHHHHHHHHHHHHHHHHHHh
Q 036221           91 DYKMEASNVGLDGSVNSLKLIDYGD-DSTLVSWSFAIDPVEGASEDSIIDYLGFLYKSCINRIDSAIQ  157 (159)
Q Consensus        91 ~y~~~~~~~~~~~~~~~~~l~~~~~-~~t~v~w~~~~~~~~~~~~~~~~~~~~~~~~~~l~~l~~~~e  157 (159)
                      +|++.++++|+.+|.++++|.|.++ ++|+|+|+.+|++.. ...+.+...++..|+.+|++|++++.
T Consensus        71 ~y~~~~~~~p~~~~~~~~~l~p~~~g~~t~v~w~~~f~p~~-~~~~~~~~~~~~~~~~~l~~L~~~f~  137 (138)
T d3cnwa1          71 TYSIMNAPFPVTNYLSTIQVKEGTESNTSLVEWSGTFTPVE-VSDEEAINLFHGIYSDGLKALQQAFL  137 (138)
T ss_dssp             EEEEEECSSSEEEEEEEEEEEECSSTTCEEEEEEEEEEESS-SCHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             EEEEecCCCcceeeEEEEEEEECCCCCeEEEEEEEEEecCC-CCHHHHHHHHHHHHHHHHHHHHHhhc
Confidence            9999998889999999999999875 469999999999763 56777888999999999999999874
>d2b79a1 d.129.3.9 (A:1-137) Hypothetical protein SMU440 {Streptococcus mutans [TaxId: 1309]} Back     information, alignment and structure
>d2rera1 d.129.3.6 (A:1-155) Multifunctional enzyme TcmN, cyclase/aromatase domain {Streptomyces glaucescens [TaxId: 1907]} Back     information, alignment and structure
>d2d4ra1 d.129.3.6 (A:2-147) Hypothetical protein TTHA0849 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1fm4a_ d.129.3.1 (A:) Major tree pollen allergen {European white birch (Betula pendula), Bet v 1-l [TaxId: 3505]} Back     information, alignment and structure
>d1txca1 d.129.3.1 (A:1-147) Plant pathogenesis-related protein PR10 {Jicama (Pachyrhizus erosus), SPE-16 [TaxId: 109171]} Back     information, alignment and structure
>d1e09a_ d.129.3.1 (A:) Major tree pollen allergen {Sweet cherry (Prunus avium), pru av 1 [TaxId: 42229]} Back     information, alignment and structure
>d1icxa_ d.129.3.1 (A:) Plant pathogenesis-related protein PR10 {Yellow lupine (Lupinus luteus) [TaxId: 3873]} Back     information, alignment and structure
>d2bk0a1 d.129.3.1 (A:2-154) Major allergen api g 1 {Celery (Apium graveolens) [TaxId: 4045]} Back     information, alignment and structure
>d1xdfa1 d.129.3.1 (A:1-157) Plant pathogenesis-related protein PR10 {Yellow lupine (Lupinus luteus) [TaxId: 3873]} Back     information, alignment and structure
>d2ns9a1 d.129.3.10 (A:10-156) Hypothetical protein APE2225 {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1t17a_ d.129.3.6 (A:) Hypothetical protein CC1736 {Caulobacter crescentus [TaxId: 155892]} Back     information, alignment and structure
>d2qpva1 d.129.3.8 (A:1-133) Uncharacterized protein Atu1531 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2pcsa1 d.129.3.10 (A:1-147) Hypothetical protein GKP20 {Geobacillus kaustophilus [TaxId: 1462]} Back     information, alignment and structure
>d1xuva_ d.129.3.5 (A:) Hypothetical protein MM0500 {Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d2il5a1 d.129.3.5 (A:5-168) Hypothetical protein SA2116 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1vjha_ d.129.3.1 (A:) Hypothetical protein At1G24000 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1xfsa_ d.129.3.5 (A:) Hypothetical protein NE0264 {Nitrosomonas europaea [TaxId: 915]} Back     information, alignment and structure
>d1z94a1 d.129.3.5 (A:2-144) Hypothetical protein CV1439 {Chromobacterium violaceum [TaxId: 536]} Back     information, alignment and structure
>d1xn6a_ d.129.3.5 (A:) Hypothetical protein BC4709 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1xn5a_ d.129.3.5 (A:) Hypothetical protein BH1534 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d2nn5a1 d.129.3.5 (A:1-160) Hypothetical protein EF2215 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1zxfa1 d.129.3.5 (A:1-155) Calicheamicin gene cluster protein CalC {Micromonospora echinospora [TaxId: 1877]} Back     information, alignment and structure
>d3elia1 d.129.3.5 (A:2-144) Uncharacterized protein SPO3351 {Silicibacter pomeroyi [TaxId: 89184]} Back     information, alignment and structure
>d2k5ga1 d.129.3.5 (A:1-183) Uncharacterized protein BPP1335 {Bordetella parapertussis [TaxId: 519]} Back     information, alignment and structure
>d1jssa_ d.129.3.2 (A:) Cholesterol-regulated Start protein 4 (Stard4). {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x53a1 d.129.3.5 (A:8-139) Activator of 90 kda heat shock protein ATPase homolog 1, AHSA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1em2a_ d.129.3.2 (A:) Lipid transport domain of Mln64 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ln1a_ d.129.3.2 (A:) Phosphatidylcholine transfer protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2psoa1 d.129.3.2 (A:908-1104) Star-related lipid transfer protein 13 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ffsa1 d.129.3.7 (A:1-151) Hypothetical protein PA1206 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure