Citrus Sinensis ID: 036289
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 149 | ||||||
| 255576174 | 153 | metal ion binding protein, putative [Ric | 1.0 | 0.973 | 0.859 | 2e-66 | |
| 449451469 | 151 | PREDICTED: heavy metal-associated isopre | 0.986 | 0.973 | 0.832 | 2e-63 | |
| 225438631 | 151 | PREDICTED: uncharacterized protein LOC10 | 0.986 | 0.973 | 0.791 | 1e-61 | |
| 356525507 | 153 | PREDICTED: uncharacterized protein LOC10 | 1.0 | 0.973 | 0.818 | 2e-61 | |
| 351726052 | 152 | uncharacterized protein LOC100500473 [Gl | 0.993 | 0.973 | 0.812 | 6e-61 | |
| 388504118 | 155 | unknown [Lotus japonicus] | 1.0 | 0.961 | 0.794 | 3e-59 | |
| 224083753 | 153 | predicted protein [Populus trichocarpa] | 0.993 | 0.967 | 0.78 | 2e-58 | |
| 357519565 | 153 | hypothetical protein MTR_8g091420 [Medic | 1.0 | 0.973 | 0.758 | 6e-56 | |
| 388511387 | 153 | unknown [Medicago truncatula] | 1.0 | 0.973 | 0.751 | 1e-55 | |
| 217075424 | 153 | unknown [Medicago truncatula] | 1.0 | 0.973 | 0.751 | 4e-55 |
| >gi|255576174|ref|XP_002528981.1| metal ion binding protein, putative [Ricinus communis] gi|223531571|gb|EEF33400.1| metal ion binding protein, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
Score = 256 bits (654), Expect = 2e-66, Method: Compositional matrix adjust.
Identities = 128/149 (85%), Positives = 139/149 (93%)
Query: 1 MGVAGTLEYLSDLMGSSGHKHKKKKKQLQTVDLKVRMDCDGCELKVKNAVSSLSGVKSVE 60
MGV GTLEYLSDLMGSSGHK+KKKKKQLQTV+LK+RMDCDGCELKVKNA+SS+SGVK VE
Sbjct: 1 MGVGGTLEYLSDLMGSSGHKYKKKKKQLQTVELKIRMDCDGCELKVKNALSSMSGVKKVE 60
Query: 61 INRKQQKVSVTGYVEANKVLKKAKSTGKRAEIWPYVPYNLVAQPYIAGAYDKRAPPGYVR 120
INRKQQKV+VTGYV+ NKVLKKAKSTGK+AEIWPYVPYNLVAQPYIA AYDK+APPGYVR
Sbjct: 61 INRKQQKVTVTGYVDPNKVLKKAKSTGKKAEIWPYVPYNLVAQPYIAQAYDKKAPPGYVR 120
Query: 121 KVEGTATNASVTTLEDPYISMFSDDNPNA 149
VE TAT+ +VT EDPY SMFSDDNPNA
Sbjct: 121 NVENTATSGTVTRYEDPYSSMFSDDNPNA 149
|
Source: Ricinus communis Species: Ricinus communis Genus: Ricinus Family: Euphorbiaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|449451469|ref|XP_004143484.1| PREDICTED: heavy metal-associated isoprenylated plant protein 26-like [Cucumis sativus] gi|449504848|ref|XP_004162311.1| PREDICTED: heavy metal-associated isoprenylated plant protein 26-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|225438631|ref|XP_002281217.1| PREDICTED: uncharacterized protein LOC100245736 isoform 1 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|356525507|ref|XP_003531366.1| PREDICTED: uncharacterized protein LOC100776974 isoform 1 [Glycine max] gi|356525509|ref|XP_003531367.1| PREDICTED: uncharacterized protein LOC100776974 isoform 2 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|351726052|ref|NP_001238649.1| uncharacterized protein LOC100500473 [Glycine max] gi|255630409|gb|ACU15561.1| unknown [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|388504118|gb|AFK40125.1| unknown [Lotus japonicus] | Back alignment and taxonomy information |
|---|
| >gi|224083753|ref|XP_002307111.1| predicted protein [Populus trichocarpa] gi|222856560|gb|EEE94107.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|357519565|ref|XP_003630071.1| hypothetical protein MTR_8g091420 [Medicago truncatula] gi|355524093|gb|AET04547.1| hypothetical protein MTR_8g091420 [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|388511387|gb|AFK43755.1| unknown [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|217075424|gb|ACJ86072.1| unknown [Medicago truncatula] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 149 | ||||||
| TAIR|locus:2135277 | 158 | AT4G39700 [Arabidopsis thalian | 1.0 | 0.943 | 0.655 | 1.2e-49 | |
| TAIR|locus:2026336 | 152 | HIPP20 "heavy metal associated | 0.986 | 0.967 | 0.573 | 1.2e-40 | |
| TAIR|locus:2133544 | 150 | AT4G08570 "AT4G08570" [Arabido | 0.973 | 0.966 | 0.546 | 1.8e-39 | |
| TAIR|locus:2017759 | 152 | HIPP22 "heavy metal associated | 0.959 | 0.940 | 0.550 | 4.8e-39 | |
| TAIR|locus:2157457 | 149 | HIPP21 "heavy metal associated | 0.959 | 0.959 | 0.482 | 9.2e-36 | |
| TAIR|locus:2121199 | 153 | FP6 "farnesylated protein 6" [ | 0.973 | 0.947 | 0.466 | 2.5e-33 | |
| TAIR|locus:2156927 | 147 | HIPP27 "heavy metal associated | 0.825 | 0.836 | 0.496 | 2.3e-30 | |
| TAIR|locus:2131561 | 153 | HIPP25 "heavy metal associated | 0.966 | 0.941 | 0.429 | 8.2e-28 | |
| TAIR|locus:2202265 | 159 | AT1G06330 "AT1G06330" [Arabido | 0.483 | 0.452 | 0.575 | 2.3e-22 | |
| TAIR|locus:4515103273 | 166 | AT3G56891 [Arabidopsis thalian | 0.476 | 0.427 | 0.569 | 2.4e-19 |
| TAIR|locus:2135277 AT4G39700 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 517 (187.1 bits), Expect = 1.2e-49, P = 1.2e-49
Identities = 101/154 (65%), Positives = 122/154 (79%)
Query: 1 MGVAGTLEYLSDLMXXXXXXXXXXXX---QLQTVDLKVRMDCDGCELKVKNAVSSLSGVK 57
MGV GTLEY+S+L+ Q QTV+LKVRMDCDGC LK+KN++SSL GVK
Sbjct: 1 MGVGGTLEYISELIGNGGSHSYGKRKKKKQFQTVELKVRMDCDGCVLKIKNSLSSLKGVK 60
Query: 58 SVEINRKQQKVSVTGYVEANKVLKKAKSTGKRAEIWPYVPYNLVAQPYIAGAYDKRAPPG 117
+VEIN+KQQKV+V+GY +A+KVLKKAK+TGK+AEIWPYVPYNLVAQPYIA AYDK+APPG
Sbjct: 61 TVEINKKQQKVTVSGYADASKVLKKAKATGKKAEIWPYVPYNLVAQPYIAQAYDKKAPPG 120
Query: 118 YVRKVEGTATNASVTTL-EDP-YISMFSDDNPNA 149
YVRKV+ T ++ +DP Y S+FSDDNPNA
Sbjct: 121 YVRKVDPNVTTGTMAVYYDDPSYTSLFSDDNPNA 154
|
|
| TAIR|locus:2026336 HIPP20 "heavy metal associated isoprenylated plant protein 20" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2133544 AT4G08570 "AT4G08570" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2017759 HIPP22 "heavy metal associated isoprenylated plant protein 22" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2157457 HIPP21 "heavy metal associated isoprenylated plant protein 21" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2121199 FP6 "farnesylated protein 6" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2156927 HIPP27 "heavy metal associated isoprenylated plant protein 27" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2131561 HIPP25 "heavy metal associated isoprenylated plant protein 25" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2202265 AT1G06330 "AT1G06330" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:4515103273 AT3G56891 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| GSVIVG00019438001 | SubName- Full=Chromosome chr7 scaffold_20, whole genome shotgun sequence; (151 aa) | |||||||
(Vitis vinifera) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 149 | |||
| cd00371 | 63 | cd00371, HMA, Heavy-metal-associated domain (HMA) | 2e-12 | |
| pfam00403 | 62 | pfam00403, HMA, Heavy-metal-associated domain | 5e-10 | |
| PLN02957 | 238 | PLN02957, PLN02957, copper, zinc superoxide dismut | 6e-07 | |
| COG2608 | 71 | COG2608, CopZ, Copper chaperone [Inorganic ion tra | 2e-05 | |
| PRK10671 | 834 | PRK10671, copA, copper exporting ATPase; Provision | 6e-04 | |
| PRK11033 | 741 | PRK11033, zntA, zinc/cadmium/mercury/lead-transpor | 0.004 |
| >gnl|CDD|238219 cd00371, HMA, Heavy-metal-associated domain (HMA) is a conserved domain of approximately 30 amino acid residues found in a number of proteins that transport or detoxify heavy metals, for example, the CPx-type heavy metal ATPases and copper chaperones | Back alignment and domain information |
|---|
Score = 58.0 bits (141), Expect = 2e-12
Identities = 18/57 (31%), Positives = 32/57 (56%), Gaps = 2/57 (3%)
Query: 37 MDCDGCELKVKNAVSSLSGVKSVEINRKQQKVSVTGYVEAN--KVLKKAKSTGKRAE 91
M C GC K++ A+ L GV+SVE++ + K +V E + ++L+ + G +A
Sbjct: 7 MTCAGCVSKIEKALEKLPGVESVEVDLETGKATVEYDPEVSPEELLEAIEDAGYKAR 63
|
HMA domain contains two cysteine residues that are important in binding and transfer of metal ions, such as copper, cadmium, cobalt and zinc. In the case of copper, stoichiometry of binding is one Cu+ ion per binding domain. Repeats of the HMA domain in copper chaperone has been associated with Menkes/Wilson disease due to binding of multiple copper ions. Length = 63 |
| >gnl|CDD|215902 pfam00403, HMA, Heavy-metal-associated domain | Back alignment and domain information |
|---|
| >gnl|CDD|215516 PLN02957, PLN02957, copper, zinc superoxide dismutase | Back alignment and domain information |
|---|
| >gnl|CDD|225328 COG2608, CopZ, Copper chaperone [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|182635 PRK10671, copA, copper exporting ATPase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236827 PRK11033, zntA, zinc/cadmium/mercury/lead-transporting ATPase; Provisional | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 149 | |||
| PF00403 | 62 | HMA: Heavy-metal-associated domain; InterPro: IPR0 | 99.48 | |
| KOG4656 | 247 | consensus Copper chaperone for superoxide dismutas | 99.45 | |
| COG2608 | 71 | CopZ Copper chaperone [Inorganic ion transport and | 99.37 | |
| KOG1603 | 73 | consensus Copper chaperone [Inorganic ion transpor | 99.3 | |
| PLN02957 | 238 | copper, zinc superoxide dismutase | 98.67 | |
| PRK10671 | 834 | copA copper exporting ATPase; Provisional | 98.4 | |
| COG2217 | 713 | ZntA Cation transport ATPase [Inorganic ion transp | 98.22 | |
| TIGR00003 | 68 | copper ion binding protein. This model describes a | 97.97 | |
| KOG0207 | 951 | consensus Cation transport ATPase [Inorganic ion t | 97.8 | |
| PRK10671 | 834 | copA copper exporting ATPase; Provisional | 97.4 | |
| KOG0207 | 951 | consensus Cation transport ATPase [Inorganic ion t | 97.32 | |
| PRK11033 | 741 | zntA zinc/cadmium/mercury/lead-transporting ATPase | 97.11 | |
| TIGR02052 | 92 | MerP mercuric transport protein periplasmic compon | 94.72 | |
| PRK13748 | 561 | putative mercuric reductase; Provisional | 90.85 | |
| COG1888 | 97 | Uncharacterized protein conserved in archaea [Func | 90.67 | |
| PF02680 | 95 | DUF211: Uncharacterized ArCR, COG1888; InterPro: I | 89.54 | |
| cd00371 | 63 | HMA Heavy-metal-associated domain (HMA) is a conse | 88.3 | |
| PF01206 | 70 | TusA: Sulfurtransferase TusA; InterPro: IPR001455 | 87.58 | |
| PRK11018 | 78 | hypothetical protein; Provisional | 80.14 |
| >PF00403 HMA: Heavy-metal-associated domain; InterPro: IPR006121 Proteins that transport heavy metals in micro-organisms and mammals share similarities in their sequences and structures | Back alignment and domain information |
|---|
Probab=99.48 E-value=2.8e-13 Score=84.97 Aligned_cols=58 Identities=36% Similarity=0.619 Sum_probs=53.9
Q ss_pred EEEE-cCcChhHHHHHHHHHhCCCCeeEEEEecCCCEEEEEec---CCHHHHHHHHHhcCCc
Q 036289 32 DLKV-RMDCDGCELKVKNAVSSLSGVKSVEINRKQQKVSVTGY---VEANKVLKKAKSTGKR 89 (149)
Q Consensus 32 ~l~V-gm~C~~C~~kV~k~L~~~~GV~~v~vdl~~~~v~V~g~---~~~~~I~~~I~~~G~~ 89 (149)
+|+| +|+|++|+.+|+++|.+++||.++.+|+.+++++|.++ +++++|.++|+++||+
T Consensus 1 t~~v~~m~C~~C~~~v~~~l~~~~GV~~v~vd~~~~~v~v~~~~~~~~~~~i~~~i~~~Gy~ 62 (62)
T PF00403_consen 1 TFKVPGMTCEGCAKKVEKALSKLPGVKSVKVDLETKTVTVTYDPDKTSIEKIIEAIEKAGYE 62 (62)
T ss_dssp EEEEESTTSHHHHHHHHHHHHTSTTEEEEEEETTTTEEEEEESTTTSCHHHHHHHHHHTTSE
T ss_pred CEEECCcccHHHHHHHHHHHhcCCCCcEEEEECCCCEEEEEEecCCCCHHHHHHHHHHhCcC
Confidence 4789 99999999999999999999999999999999999965 4569999999999985
|
These proteins provide an important focus for research, some being involved in bacterial resistance to toxic metals, such as lead and cadmium, while others are involved in inherited human syndromes, such as Wilson's and Menke's diseases []. A conserved domain has been found in a number of these heavy metal transport or detoxification proteins []. The domain, which has been termed Heavy-Metal-Associated (HMA), contains two conserved cysteines that are probably involved in metal binding. Structure solution of the fourth HMA domain of the Menke's copper transporting ATPase shows a well-defined structure comprising a four-stranded antiparallel beta-sheet and two alpha helices packed in an alpha-beta sandwich fold []. This fold is common to other domains and is classified as "ferredoxin-like".; GO: 0046872 metal ion binding, 0030001 metal ion transport; PDB: 2VOY_A 1P6T_A 1KQK_A 2RML_A 1JWW_A 3K7R_F 1FES_A 1CC8_A 1FD8_A 2GGP_A .... |
| >KOG4656 consensus Copper chaperone for superoxide dismutase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >COG2608 CopZ Copper chaperone [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >KOG1603 consensus Copper chaperone [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PLN02957 copper, zinc superoxide dismutase | Back alignment and domain information |
|---|
| >PRK10671 copA copper exporting ATPase; Provisional | Back alignment and domain information |
|---|
| >COG2217 ZntA Cation transport ATPase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR00003 copper ion binding protein | Back alignment and domain information |
|---|
| >KOG0207 consensus Cation transport ATPase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK10671 copA copper exporting ATPase; Provisional | Back alignment and domain information |
|---|
| >KOG0207 consensus Cation transport ATPase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK11033 zntA zinc/cadmium/mercury/lead-transporting ATPase; Provisional | Back alignment and domain information |
|---|
| >TIGR02052 MerP mercuric transport protein periplasmic component | Back alignment and domain information |
|---|
| >PRK13748 putative mercuric reductase; Provisional | Back alignment and domain information |
|---|
| >COG1888 Uncharacterized protein conserved in archaea [Function unknown] | Back alignment and domain information |
|---|
| >PF02680 DUF211: Uncharacterized ArCR, COG1888; InterPro: IPR003831 This entry describes proteins of unknown function | Back alignment and domain information |
|---|
| >cd00371 HMA Heavy-metal-associated domain (HMA) is a conserved domain of approximately 30 amino acid residues found in a number of proteins that transport or detoxify heavy metals, for example, the CPx-type heavy metal ATPases and copper chaperones | Back alignment and domain information |
|---|
| >PF01206 TusA: Sulfurtransferase TusA; InterPro: IPR001455 SirA functions as a response regulator as part of a two-component system, where BarA is the sensor kinase | Back alignment and domain information |
|---|
| >PRK11018 hypothetical protein; Provisional | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 149 | |||
| 2crl_A | 98 | Copper chaperone for superoxide dismutase; SOD1, f | 1e-22 | |
| 1qup_A | 222 | Superoxide dismutase 1 copper chaperone; two domai | 4e-21 | |
| 3iwl_A | 68 | Copper transport protein ATOX1; beta-alpha-beta-BE | 3e-18 | |
| 1jk9_B | 249 | CCS, copper chaperone for superoxide dismutase; pr | 5e-18 | |
| 1cc8_A | 73 | Protein (metallochaperone ATX1); copper transport, | 8e-17 | |
| 2k2p_A | 85 | Uncharacterized protein ATU1203; putative metal-bi | 2e-08 | |
| 2xmm_A | 64 | SSR2857 protein, ATX1; metal transport, copper hom | 2e-07 | |
| 2roe_A | 66 | Heavy metal binding protein; NMR {Thermus thermoph | 3e-07 | |
| 1yg0_A | 66 | COP associated protein; open-faced beta-sandwich, | 7e-06 | |
| 2aj0_A | 71 | Probable cadmium-transporting ATPase; ferrodoxin-l | 2e-05 | |
| 2kkh_A | 95 | Putative heavy metal transporter; zinc transport, | 3e-05 | |
| 2qif_A | 69 | Copper chaperone COPZ; tetranuclear Cu(I) cluster; | 4e-05 | |
| 1osd_A | 72 | MERP, hypothetical protein MERP; mercury resistanc | 4e-05 | |
| 3cjk_B | 75 | Copper-transporting ATPase 1; HAH1, ATP7B, menkes | 7e-05 | |
| 2rop_A | 202 | Copper-transporting ATPase 2; wilson protein, mobi | 7e-05 | |
| 1kvi_A | 79 | Copper-transporting ATPase 1; menkes, Cu-protein, | 9e-05 | |
| 2l3m_A | 71 | Copper-ION-binding protein; structural genomics, c | 9e-05 | |
| 1p6t_A | 151 | Potential copper-transporting ATPase; COPA, P-type | 1e-04 | |
| 1p6t_A | 151 | Potential copper-transporting ATPase; COPA, P-type | 2e-04 | |
| 3dxs_X | 74 | Copper-transporting ATPase RAN1; CXXC motif, ferre | 2e-04 | |
| 2xmw_A | 71 | PACS-N, cation-transporting ATPase PACS; hydrolase | 2e-04 | |
| 1mwy_A | 73 | ZNTA; open-faced beta-sandwich fold, beta-alpha-be | 2e-04 | |
| 2ew9_A | 149 | Copper-transporting ATPase 2; copper trafficking, | 5e-04 | |
| 2ew9_A | 149 | Copper-transporting ATPase 2; copper trafficking, | 9e-04 |
| >2crl_A Copper chaperone for superoxide dismutase; SOD1, familial ALS, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 98 | Back alignment and structure |
|---|
Score = 84.9 bits (210), Expect = 1e-22
Identities = 19/78 (24%), Positives = 39/78 (50%)
Query: 16 SSGHKHKKKKKQLQTVDLKVRMDCDGCELKVKNAVSSLSGVKSVEINRKQQKVSVTGYVE 75
S + L T++ V+M C C V+ ++ ++GV+ VE++ + Q V V +
Sbjct: 6 SGMASDSGNQGTLCTLEFAVQMTCQSCVDAVRKSLQGVAGVQDVEVHLEDQMVLVHTTLP 65
Query: 76 ANKVLKKAKSTGKRAEIW 93
+ +V + TG++A +
Sbjct: 66 SQEVQALLEGTGRQAVLK 83
|
| >1qup_A Superoxide dismutase 1 copper chaperone; two domains, beta-alpha-beta-BETA-alpha-beta and beta barrel; 1.80A {Saccharomyces cerevisiae} SCOP: b.1.8.1 d.58.17.1 Length = 222 | Back alignment and structure |
|---|
| >3iwl_A Copper transport protein ATOX1; beta-alpha-beta-BETA-alpha-beta, cisplatin, platinum, chaperone, ION transport, metal-binding, metal transport; HET: TCE; 1.60A {Homo sapiens} PDB: 1fe4_A* 1fee_A* 1tl4_A 1tl5_A 2k1r_B 1fe0_A* 3iwx_A 3cjk_A Length = 68 | Back alignment and structure |
|---|
| >1jk9_B CCS, copper chaperone for superoxide dismutase; protein-protein complex, heterodimer, metallochaperone, amyotrophic lateral sclerosis; 2.90A {Saccharomyces cerevisiae} SCOP: b.1.8.1 d.58.17.1 Length = 249 | Back alignment and structure |
|---|
| >1cc8_A Protein (metallochaperone ATX1); copper transport, mercury coordination, metal transport; 1.02A {Saccharomyces cerevisiae} SCOP: d.58.17.1 PDB: 1cc7_A 1fd8_A 1fes_A 2ggp_A 3k7r_A Length = 73 | Back alignment and structure |
|---|
| >2k2p_A Uncharacterized protein ATU1203; putative metal-binding domain ATU1203, ontario centre for ST proteomics, structural genomics; NMR {Agrobacterium tumefaciens str} Length = 85 | Back alignment and structure |
|---|
| >2xmm_A SSR2857 protein, ATX1; metal transport, copper homeostasis, chaperone, P-type atpas; 1.65A {Synechocystis SP} PDB: 2xmv_A 1sb6_A 2xmj_A 2xmk_A 2xmt_A 2xmu_A Length = 64 | Back alignment and structure |
|---|
| >2roe_A Heavy metal binding protein; NMR {Thermus thermophilus} PDB: 2rog_A Length = 66 | Back alignment and structure |
|---|
| >1yg0_A COP associated protein; open-faced beta-sandwich, missing C-terminal beta-sheet, Met transport; NMR {Helicobacter pylori} Length = 66 | Back alignment and structure |
|---|
| >2aj0_A Probable cadmium-transporting ATPase; ferrodoxin-like fold, beta-alpha-beta-BETA-alpha-beta, metal binding protein, hydrolase; NMR {Listeria monocytogenes} PDB: 2aj1_A Length = 71 | Back alignment and structure |
|---|
| >2kkh_A Putative heavy metal transporter; zinc transport, metal binding, metal selectivity, ferredoxin fold, ATP-binding, hydrolase; NMR {Arabidopsis thaliana} Length = 95 | Back alignment and structure |
|---|
| >2qif_A Copper chaperone COPZ; tetranuclear Cu(I) cluster; 1.50A {Bacillus subtilis} SCOP: d.58.17.1 PDB: 3i9z_A 1k0v_A 1p8g_A Length = 69 | Back alignment and structure |
|---|
| >1osd_A MERP, hypothetical protein MERP; mercury resistance, metal binding protein, perisplasm, structural genomics; 2.00A {Cupriavidus metallidurans} SCOP: d.58.17.1 PDB: 1afi_A 1afj_A 2hqi_A Length = 72 | Back alignment and structure |
|---|
| >3cjk_B Copper-transporting ATPase 1; HAH1, ATP7B, menkes disease, metal homeostasis, chaperone, ION transport, metal- binding, alternative splicing; 1.80A {Homo sapiens} PDB: 2k1r_A Length = 75 | Back alignment and structure |
|---|
| >2rop_A Copper-transporting ATPase 2; wilson protein, mobility, protein-protein interaction, alternative splicing, ATP-binding, copper transport cytoplasm; NMR {Homo sapiens} Length = 202 | Back alignment and structure |
|---|
| >1kvi_A Copper-transporting ATPase 1; menkes, Cu-protein, hydrolase; NMR {Homo sapiens} SCOP: d.58.17.1 PDB: 1kvj_A Length = 79 | Back alignment and structure |
|---|
| >2l3m_A Copper-ION-binding protein; structural genomics, center for structural genomics of infec diseases, csgid, metal binding protein; NMR {Bacillus anthracis} Length = 71 | Back alignment and structure |
|---|
| >1p6t_A Potential copper-transporting ATPase; COPA, P-type ATPase, water-soluble region, beta-alpha-beta- beta-alpha-beta fold; NMR {Bacillus subtilis} SCOP: d.58.17.1 d.58.17.1 PDB: 2rml_A Length = 151 | Back alignment and structure |
|---|
| >1p6t_A Potential copper-transporting ATPase; COPA, P-type ATPase, water-soluble region, beta-alpha-beta- beta-alpha-beta fold; NMR {Bacillus subtilis} SCOP: d.58.17.1 d.58.17.1 PDB: 2rml_A Length = 151 | Back alignment and structure |
|---|
| >3dxs_X Copper-transporting ATPase RAN1; CXXC motif, ferredoxin-like fold, ATP- binding, ethylene signaling pathway, hydrolase, ION transport; 1.70A {Arabidopsis thaliana} Length = 74 | Back alignment and structure |
|---|
| >2xmw_A PACS-N, cation-transporting ATPase PACS; hydrolase, Cu(I)-binding, trafficking; 1.80A {Synechocystis SP} PDB: 2gcf_A Length = 71 | Back alignment and structure |
|---|
| >1mwy_A ZNTA; open-faced beta-sandwich fold, beta-alpha-beta-BETA-alpha- beta, hydrolase; NMR {Escherichia coli} SCOP: d.58.17.1 PDB: 1mwz_A Length = 73 | Back alignment and structure |
|---|
| >2ew9_A Copper-transporting ATPase 2; copper trafficking, ferrodoxin-like fold, structural genomics, structural proteomics in europe, spine, hydrolase; NMR {Homo sapiens} Length = 149 | Back alignment and structure |
|---|
| >2ew9_A Copper-transporting ATPase 2; copper trafficking, ferrodoxin-like fold, structural genomics, structural proteomics in europe, spine, hydrolase; NMR {Homo sapiens} Length = 149 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 149 | |||
| 3iwl_A | 68 | Copper transport protein ATOX1; beta-alpha-beta-BE | 99.59 | |
| 4a4j_A | 69 | Pacszia, cation-transporting ATPase PACS; hydrolas | 99.51 | |
| 3dxs_X | 74 | Copper-transporting ATPase RAN1; CXXC motif, ferre | 99.5 | |
| 1cc8_A | 73 | Protein (metallochaperone ATX1); copper transport, | 99.47 | |
| 3fry_A | 73 | Probable copper-exporting P-type ATPase A; transpo | 99.47 | |
| 2crl_A | 98 | Copper chaperone for superoxide dismutase; SOD1, f | 99.37 | |
| 2l3m_A | 71 | Copper-ION-binding protein; structural genomics, c | 99.33 | |
| 2roe_A | 66 | Heavy metal binding protein; NMR {Thermus thermoph | 99.33 | |
| 2xmm_A | 64 | SSR2857 protein, ATX1; metal transport, copper hom | 99.33 | |
| 1osd_A | 72 | MERP, hypothetical protein MERP; mercury resistanc | 99.32 | |
| 2xmw_A | 71 | PACS-N, cation-transporting ATPase PACS; hydrolase | 99.31 | |
| 2k2p_A | 85 | Uncharacterized protein ATU1203; putative metal-bi | 99.3 | |
| 1mwy_A | 73 | ZNTA; open-faced beta-sandwich fold, beta-alpha-be | 99.29 | |
| 1q8l_A | 84 | Copper-transporting ATPase 1; metal binding protei | 99.28 | |
| 1aw0_A | 72 | Menkes copper-transporting ATPase; copper-binding | 99.27 | |
| 3cjk_B | 75 | Copper-transporting ATPase 1; HAH1, ATP7B, menkes | 99.27 | |
| 1opz_A | 76 | Potential copper-transporting ATPase; mutation, fo | 99.27 | |
| 2g9o_A | 90 | Copper-transporting ATPase 1; menkes disease, solu | 99.27 | |
| 2qif_A | 69 | Copper chaperone COPZ; tetranuclear Cu(I) cluster; | 99.27 | |
| 1y3j_A | 77 | Copper-transporting ATPase 1; ferrodoxin-like fold | 99.24 | |
| 1fvq_A | 72 | Copper-transporting ATPase; APO-CCC2A, hydrolase; | 99.23 | |
| 1kvi_A | 79 | Copper-transporting ATPase 1; menkes, Cu-protein, | 99.23 | |
| 1cpz_A | 68 | Protein (COPZ); copper chaperone, metal transport, | 99.23 | |
| 2kt2_A | 69 | Mercuric reductase; nmera, MERA, HMA domain, mercu | 99.21 | |
| 1jww_A | 80 | Potential copper-transporting ATPase; beta-alpha-b | 99.21 | |
| 2kkh_A | 95 | Putative heavy metal transporter; zinc transport, | 99.21 | |
| 1yg0_A | 66 | COP associated protein; open-faced beta-sandwich, | 99.21 | |
| 2ldi_A | 71 | Zinc-transporting ATPase; metal homeostasis, metal | 99.19 | |
| 2kyz_A | 67 | Heavy metal binding protein; structural genomics, | 99.18 | |
| 1yjr_A | 75 | Copper-transporting ATPase 1; metallochaperone, pr | 99.16 | |
| 2ofg_X | 111 | Zinc-transporting ATPase; ferredoxin-like fold, be | 99.15 | |
| 1p6t_A | 151 | Potential copper-transporting ATPase; COPA, P-type | 99.14 | |
| 2ew9_A | 149 | Copper-transporting ATPase 2; copper trafficking, | 99.13 | |
| 1qup_A | 222 | Superoxide dismutase 1 copper chaperone; two domai | 99.1 | |
| 2aj0_A | 71 | Probable cadmium-transporting ATPase; ferrodoxin-l | 99.04 | |
| 2rop_A | 202 | Copper-transporting ATPase 2; wilson protein, mobi | 99.02 | |
| 1jk9_B | 249 | CCS, copper chaperone for superoxide dismutase; pr | 98.98 | |
| 2ew9_A | 149 | Copper-transporting ATPase 2; copper trafficking, | 98.95 | |
| 1p6t_A | 151 | Potential copper-transporting ATPase; COPA, P-type | 98.69 | |
| 2rop_A | 202 | Copper-transporting ATPase 2; wilson protein, mobi | 98.64 | |
| 3j09_A | 723 | COPA, copper-exporting P-type ATPase A; copper tra | 98.6 | |
| 3bpd_A | 100 | Uncharacterized protein; heptamer, Mg+2 ION, PSI-2 | 89.98 | |
| 2raq_A | 97 | Conserved protein MTH889; alpha-beta protein, stru | 88.36 | |
| 2x3d_A | 96 | SSO6206; unknown function; 2.70A {Sulfolobus solfa | 87.7 | |
| 3lvj_C | 82 | Sulfurtransferase TUSA; protein-protein complex, s | 83.34 | |
| 1jdq_A | 98 | TM006 protein, hypothetical protein TM0983; struct | 81.17 | |
| 3cq1_A | 103 | Putative uncharacterized protein TTHB138; DTDP-4-k | 81.17 |
| >3iwl_A Copper transport protein ATOX1; beta-alpha-beta-BETA-alpha-beta, cisplatin, platinum, chaperone, ION transport, metal-binding, metal transport; HET: TCE; 1.60A {Homo sapiens} SCOP: d.58.17.1 PDB: 1fe4_A* 1fee_A* 1tl4_A 1tl5_A 2k1r_B 1fe0_A* 3iwx_A 3cjk_A | Back alignment and structure |
|---|
Probab=99.59 E-value=6e-15 Score=92.76 Aligned_cols=67 Identities=25% Similarity=0.459 Sum_probs=62.1
Q ss_pred ceEEEEEEcCcChhHHHHHHHHHhCCCCeeEEEEecCCCEEEEEecCCHHHHHHHHHhcCCceEEccC
Q 036289 28 LQTVDLKVRMDCDGCELKVKNAVSSLSGVKSVEINRKQQKVSVTGYVEANKVLKKAKSTGKRAEIWPY 95 (149)
Q Consensus 28 ~~~v~l~Vgm~C~~C~~kV~k~L~~~~GV~~v~vdl~~~~v~V~g~~~~~~I~~~I~~~G~~a~~~~~ 95 (149)
|.+.+|.|||+|.+|+.+|+++|.+++|| ++++|+..++++|.+.+++++|.++|+++||++.+|+.
T Consensus 1 m~~~~~~vgm~C~~C~~~i~~~l~~~~gV-~v~v~~~~~~~~v~~~~~~~~i~~~i~~~Gy~~~~~~~ 67 (68)
T 3iwl_A 1 MPKHEFSVDMTCGGCAEAVSRVLNKLGGV-KYDIDLPNKKVCIESEHSMDTLLATLKKTGKTVSYLGL 67 (68)
T ss_dssp -CEEEEEECCCSHHHHHHHHHHHHHHCSE-EEEEETTTTEEEEEESSCHHHHHHHHHTTCSCEEEEEC
T ss_pred CceEEEEECcCcHHHHHHHHHHHHcCCCe-EEEEEcCCCEEEEEecCCHHHHHHHHHHcCCceEecCC
Confidence 34677888999999999999999999999 99999999999999989999999999999999998874
|
| >4a4j_A Pacszia, cation-transporting ATPase PACS; hydrolase, copper homeostasis, zinc homeostasis, ATX1, metal-transporting atpases; 1.25A {Synechocystis} PDB: 4a48_A 2gcf_A 2xmw_A | Back alignment and structure |
|---|
| >3dxs_X Copper-transporting ATPase RAN1; CXXC motif, ferredoxin-like fold, ATP- binding, ethylene signaling pathway, hydrolase, ION transport; 1.70A {Arabidopsis thaliana} SCOP: d.58.17.0 | Back alignment and structure |
|---|
| >1cc8_A Protein (metallochaperone ATX1); copper transport, mercury coordination, metal transport; 1.02A {Saccharomyces cerevisiae} SCOP: d.58.17.1 PDB: 1cc7_A 1fd8_A 1fes_A 2ggp_A 3k7r_A | Back alignment and structure |
|---|
| >3fry_A Probable copper-exporting P-type ATPase A; transport protein, metal binding domain, domain SWAP, ATP-BI cell membrane, copper transport; HET: CIT; 2.00A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >2crl_A Copper chaperone for superoxide dismutase; SOD1, familial ALS, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2l3m_A Copper-ION-binding protein; structural genomics, center for structural genomics of infec diseases, csgid, metal binding protein; NMR {Bacillus anthracis} | Back alignment and structure |
|---|
| >2roe_A Heavy metal binding protein; NMR {Thermus thermophilus} PDB: 2rog_A | Back alignment and structure |
|---|
| >2xmm_A SSR2857 protein, ATX1; metal transport, copper homeostasis, chaperone, P-type atpas; 1.65A {Synechocystis SP} PDB: 2xmv_A 1sb6_A 2xmj_A 2xmk_A 2xmt_A 2xmu_A | Back alignment and structure |
|---|
| >1osd_A MERP, hypothetical protein MERP; mercury resistance, metal binding protein, perisplasm, structural genomics; 2.00A {Cupriavidus metallidurans} SCOP: d.58.17.1 PDB: 1afi_A 1afj_A 2hqi_A | Back alignment and structure |
|---|
| >2xmw_A PACS-N, cation-transporting ATPase PACS; hydrolase, Cu(I)-binding, trafficking; 1.80A {Synechocystis SP} PDB: 2gcf_A | Back alignment and structure |
|---|
| >2k2p_A Uncharacterized protein ATU1203; putative metal-binding domain ATU1203, ontario centre for ST proteomics, structural genomics; NMR {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >1mwy_A ZNTA; open-faced beta-sandwich fold, beta-alpha-beta-BETA-alpha- beta, hydrolase; NMR {Escherichia coli} SCOP: d.58.17.1 PDB: 1mwz_A | Back alignment and structure |
|---|
| >1q8l_A Copper-transporting ATPase 1; metal binding protein; NMR {Homo sapiens} SCOP: d.58.17.1 PDB: 1s6o_A 1s6u_A | Back alignment and structure |
|---|
| >1aw0_A Menkes copper-transporting ATPase; copper-binding domain, hydrolase; NMR {Homo sapiens} SCOP: d.58.17.1 PDB: 2aw0_A | Back alignment and structure |
|---|
| >3cjk_B Copper-transporting ATPase 1; HAH1, ATP7B, menkes disease, metal homeostasis, chaperone, ION transport, metal- binding, alternative splicing; 1.80A {Homo sapiens} PDB: 2k1r_A | Back alignment and structure |
|---|
| >1opz_A Potential copper-transporting ATPase; mutation, folding, abbab fold, hydrolase; NMR {Bacillus subtilis} SCOP: d.58.17.1 PDB: 1oq3_A 1oq6_A | Back alignment and structure |
|---|
| >2g9o_A Copper-transporting ATPase 1; menkes disease, solution structure, structural genomics, structural proteomics in europe, spine, hydrolase; NMR {Homo sapiens} PDB: 2ga7_A | Back alignment and structure |
|---|
| >2qif_A Copper chaperone COPZ; tetranuclear Cu(I) cluster; 1.50A {Bacillus subtilis} SCOP: d.58.17.1 PDB: 3i9z_A 1k0v_A 1p8g_A | Back alignment and structure |
|---|
| >1y3j_A Copper-transporting ATPase 1; ferrodoxin-like fold, beta-alpha-beta-BETA-alpha-beta structure, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 1y3k_A | Back alignment and structure |
|---|
| >1fvq_A Copper-transporting ATPase; APO-CCC2A, hydrolase; NMR {Saccharomyces cerevisiae} SCOP: d.58.17.1 PDB: 1fvs_A 2ggp_B | Back alignment and structure |
|---|
| >1kvi_A Copper-transporting ATPase 1; menkes, Cu-protein, hydrolase; NMR {Homo sapiens} SCOP: d.58.17.1 PDB: 1kvj_A | Back alignment and structure |
|---|
| >1cpz_A Protein (COPZ); copper chaperone, metal transport, gene regulation; NMR {Enterococcus hirae} SCOP: d.58.17.1 | Back alignment and structure |
|---|
| >2kt2_A Mercuric reductase; nmera, MERA, HMA domain, mercuric resist metal-binding, oxidoreductase; NMR {Pseudomonas aeruginosa} PDB: 2kt3_A | Back alignment and structure |
|---|
| >1jww_A Potential copper-transporting ATPase; beta-alpha-beta-BETA-alpha-beta, hydrolase; NMR {Bacillus subtilis} SCOP: d.58.17.1 PDB: 2voy_A 1kqk_A | Back alignment and structure |
|---|
| >2kkh_A Putative heavy metal transporter; zinc transport, metal binding, metal selectivity, ferredoxin fold, ATP-binding, hydrolase; NMR {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1yg0_A COP associated protein; open-faced beta-sandwich, missing C-terminal beta-sheet, Met transport; NMR {Helicobacter pylori} | Back alignment and structure |
|---|
| >2ldi_A Zinc-transporting ATPase; metal homeostasis, metallochaperones, hydrolase; NMR {Synechocystis SP} | Back alignment and structure |
|---|
| >2kyz_A Heavy metal binding protein; structural genomics, PSI-biology, protein structure initiative, joint for structural genomics, JCSG; NMR {Thermotoga maritima} | Back alignment and structure |
|---|
| >1yjr_A Copper-transporting ATPase 1; metallochaperone, protein-protein interaction, copper(I), metal homeostasis, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 1yjt_A 1yju_A 1yjv_A | Back alignment and structure |
|---|
| >1p6t_A Potential copper-transporting ATPase; COPA, P-type ATPase, water-soluble region, beta-alpha-beta- beta-alpha-beta fold; NMR {Bacillus subtilis} SCOP: d.58.17.1 d.58.17.1 PDB: 2rml_A | Back alignment and structure |
|---|
| >2ew9_A Copper-transporting ATPase 2; copper trafficking, ferrodoxin-like fold, structural genomics, structural proteomics in europe, spine, hydrolase; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1qup_A Superoxide dismutase 1 copper chaperone; two domains, beta-alpha-beta-BETA-alpha-beta and beta barrel; 1.80A {Saccharomyces cerevisiae} SCOP: b.1.8.1 d.58.17.1 | Back alignment and structure |
|---|
| >2aj0_A Probable cadmium-transporting ATPase; ferrodoxin-like fold, beta-alpha-beta-BETA-alpha-beta, metal binding protein, hydrolase; NMR {Listeria monocytogenes} PDB: 2aj1_A | Back alignment and structure |
|---|
| >2rop_A Copper-transporting ATPase 2; wilson protein, mobility, protein-protein interaction, alternative splicing, ATP-binding, copper transport cytoplasm; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1jk9_B CCS, copper chaperone for superoxide dismutase; protein-protein complex, heterodimer, metallochaperone, amyotrophic lateral sclerosis; 2.90A {Saccharomyces cerevisiae} SCOP: b.1.8.1 d.58.17.1 | Back alignment and structure |
|---|
| >2ew9_A Copper-transporting ATPase 2; copper trafficking, ferrodoxin-like fold, structural genomics, structural proteomics in europe, spine, hydrolase; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1p6t_A Potential copper-transporting ATPase; COPA, P-type ATPase, water-soluble region, beta-alpha-beta- beta-alpha-beta fold; NMR {Bacillus subtilis} SCOP: d.58.17.1 d.58.17.1 PDB: 2rml_A | Back alignment and structure |
|---|
| >2rop_A Copper-transporting ATPase 2; wilson protein, mobility, protein-protein interaction, alternative splicing, ATP-binding, copper transport cytoplasm; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3j09_A COPA, copper-exporting P-type ATPase A; copper transporter, adenosine triphosph archaeal proteins, cation transport proteins; 10.00A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >3bpd_A Uncharacterized protein; heptamer, Mg+2 ION, PSI-2, NYSGXRC, structural genom protein structure initiative; 2.80A {Archaeoglobus fulgidus dsm 4304} SCOP: d.58.61.1 | Back alignment and structure |
|---|
| >2raq_A Conserved protein MTH889; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; 3.11A {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: d.58.61.1 | Back alignment and structure |
|---|
| >2x3d_A SSO6206; unknown function; 2.70A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >3lvj_C Sulfurtransferase TUSA; protein-protein complex, structural genomics, montreal-kings bacterial structural genomics initiative, BSGI; HET: PLP; 2.44A {Escherichia coli} SCOP: d.68.3.3 PDB: 3lvk_B* 1dcj_A | Back alignment and structure |
|---|
| >1jdq_A TM006 protein, hypothetical protein TM0983; structural genomics; NMR {Thermotoga maritima} SCOP: d.68.3.3 | Back alignment and structure |
|---|
| >3cq1_A Putative uncharacterized protein TTHB138; DTDP-4-keto-L-rhamnose reductase, plasmid, oxidoreductase, structural genomics, NPPSFA; 1.90A {Thermus thermophilus} PDB: 2cu6_A 3cq2_A 3cq3_A* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 149 | ||||
| d1qupa2 | 72 | d.58.17.1 (A:2-73) Copper chaperone for superoxide | 1e-13 | |
| d1cc8a_ | 72 | d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX | 3e-13 | |
| d1fe0a_ | 66 | d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX | 1e-11 | |
| d1osda_ | 72 | d.58.17.1 (A:) Mercuric ion binding protein MerP { | 7e-11 | |
| d1sb6a_ | 64 | d.58.17.1 (A:) Copper chaperone {Synechocystis sp. | 1e-10 | |
| d2ggpb1 | 72 | d.58.17.1 (B:1-72) Copper transporter domain ccc2a | 3e-09 | |
| d1kvja_ | 79 | d.58.17.1 (A:) Menkes copper-transporting ATPase { | 7e-09 | |
| d1cpza_ | 68 | d.58.17.1 (A:) Copper chaperone {Enterococcus hira | 1e-08 | |
| d1p6ta2 | 79 | d.58.17.1 (A:73-151) Potential copper-translocatin | 1e-08 | |
| d1mwza_ | 73 | d.58.17.1 (A:) Metal ion-transporting ATPase ZntA, | 6e-08 | |
| d2aw0a_ | 72 | d.58.17.1 (A:) Menkes copper-transporting ATPase { | 9e-08 | |
| d1p6ta1 | 72 | d.58.17.1 (A:1-72) Potential copper-translocating | 9e-08 | |
| d2qifa1 | 69 | d.58.17.1 (A:1-69) Copper chaperone {Bacillus subt | 5e-07 | |
| d1q8la_ | 84 | d.58.17.1 (A:) Menkes copper-transporting ATPase { | 3e-06 |
| >d1qupa2 d.58.17.1 (A:2-73) Copper chaperone for superoxide dismutase, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 72 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Ferredoxin-like superfamily: HMA, heavy metal-associated domain family: HMA, heavy metal-associated domain domain: Copper chaperone for superoxide dismutase, N-terminal domain species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]
Score = 60.2 bits (146), Expect = 1e-13
Identities = 15/61 (24%), Positives = 31/61 (50%)
Query: 33 LKVRMDCDGCELKVKNAVSSLSGVKSVEINRKQQKVSVTGYVEANKVLKKAKSTGKRAEI 92
+ M C+ C +K + ++ G+ S+ + +QQ +SV V + ++ ++ GK A I
Sbjct: 10 YAIPMHCENCVNDIKACLKNVPGINSLNFDIEQQIMSVESSVAPSTIINTLRNCGKDAII 69
Query: 93 W 93
Sbjct: 70 R 70
|
| >d1cc8a_ d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 72 | Back information, alignment and structure |
|---|
| >d1fe0a_ d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX1) {Human (Homo sapiens), HAH1 [TaxId: 9606]} Length = 66 | Back information, alignment and structure |
|---|
| >d1osda_ d.58.17.1 (A:) Mercuric ion binding protein MerP {Ralstonia metallidurans CH34 [TaxId: 266264]} Length = 72 | Back information, alignment and structure |
|---|
| >d1sb6a_ d.58.17.1 (A:) Copper chaperone {Synechocystis sp. pcc 6803, Scatx1 [TaxId: 1148]} Length = 64 | Back information, alignment and structure |
|---|
| >d2ggpb1 d.58.17.1 (B:1-72) Copper transporter domain ccc2a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 72 | Back information, alignment and structure |
|---|
| >d1kvja_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} Length = 79 | Back information, alignment and structure |
|---|
| >d1cpza_ d.58.17.1 (A:) Copper chaperone {Enterococcus hirae [TaxId: 1354]} Length = 68 | Back information, alignment and structure |
|---|
| >d1p6ta2 d.58.17.1 (A:73-151) Potential copper-translocating P-type ATPase CopA (YvgX) {Bacillus subtilis [TaxId: 1423]} Length = 79 | Back information, alignment and structure |
|---|
| >d1mwza_ d.58.17.1 (A:) Metal ion-transporting ATPase ZntA, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 73 | Back information, alignment and structure |
|---|
| >d2aw0a_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} Length = 72 | Back information, alignment and structure |
|---|
| >d1p6ta1 d.58.17.1 (A:1-72) Potential copper-translocating P-type ATPase CopA (YvgX) {Bacillus subtilis [TaxId: 1423]} Length = 72 | Back information, alignment and structure |
|---|
| >d2qifa1 d.58.17.1 (A:1-69) Copper chaperone {Bacillus subtilis, CopZ [TaxId: 1423]} Length = 69 | Back information, alignment and structure |
|---|
| >d1q8la_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} Length = 84 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 149 | |||
| d1fe0a_ | 66 | ATX1 metallochaperone protein (ATOX1) {Human (Homo | 99.7 | |
| d1qupa2 | 72 | Copper chaperone for superoxide dismutase, N-termi | 99.69 | |
| d1cc8a_ | 72 | ATX1 metallochaperone protein (ATOX1) {Baker's yea | 99.68 | |
| d2ggpb1 | 72 | Copper transporter domain ccc2a {Baker's yeast (Sa | 99.61 | |
| d1osda_ | 72 | Mercuric ion binding protein MerP {Ralstonia metal | 99.61 | |
| d1sb6a_ | 64 | Copper chaperone {Synechocystis sp. pcc 6803, Scat | 99.6 | |
| d2qifa1 | 69 | Copper chaperone {Bacillus subtilis, CopZ [TaxId: | 99.59 | |
| d1cpza_ | 68 | Copper chaperone {Enterococcus hirae [TaxId: 1354] | 99.59 | |
| d1kvja_ | 79 | Menkes copper-transporting ATPase {Human (Homo sap | 99.58 | |
| d2aw0a_ | 72 | Menkes copper-transporting ATPase {Human (Homo sap | 99.57 | |
| d1q8la_ | 84 | Menkes copper-transporting ATPase {Human (Homo sap | 99.54 | |
| d1p6ta1 | 72 | Potential copper-translocating P-type ATPase CopA | 99.54 | |
| d1p6ta2 | 79 | Potential copper-translocating P-type ATPase CopA | 99.53 | |
| d1mwza_ | 73 | Metal ion-transporting ATPase ZntA, N-terminal dom | 99.51 | |
| d3bpda1 | 91 | Uncharacterized protein AF1549 {Archaeoglobus fulg | 89.47 | |
| d2raqa1 | 93 | Uncharacterized protein MTH889 {Methanobacterium t | 89.15 | |
| d1jdqa_ | 98 | Hypothetical protein TM0983 {Thermotoga maritima [ | 82.54 | |
| d1dcja_ | 81 | SirA {Escherichia coli [TaxId: 562]} | 81.72 |
| >d1fe0a_ d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX1) {Human (Homo sapiens), HAH1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Ferredoxin-like superfamily: HMA, heavy metal-associated domain family: HMA, heavy metal-associated domain domain: ATX1 metallochaperone protein (ATOX1) species: Human (Homo sapiens), HAH1 [TaxId: 9606]
Probab=99.70 E-value=4.1e-17 Score=102.13 Aligned_cols=64 Identities=27% Similarity=0.467 Sum_probs=61.1
Q ss_pred EEEEEEcCcChhHHHHHHHHHhCCCCeeEEEEecCCCEEEEEecCCHHHHHHHHHhcCCceEEcc
Q 036289 30 TVDLKVRMDCDGCELKVKNAVSSLSGVKSVEINRKQQKVSVTGYVEANKVLKKAKSTGKRAEIWP 94 (149)
Q Consensus 30 ~v~l~Vgm~C~~C~~kV~k~L~~~~GV~~v~vdl~~~~v~V~g~~~~~~I~~~I~~~G~~a~~~~ 94 (149)
+++|+|+|+|.+|+.+|+++|++++|+ ++++|+.+++++|.+++++++|+++|+++||++++++
T Consensus 2 k~ef~V~M~C~~C~~~I~~aL~~~~gv-~v~v~~~~~~v~V~~~~~~~~i~~~I~~~Gy~a~lig 65 (66)
T d1fe0a_ 2 KHEFSVDMTCGGCAEAVSRVLNKLGGV-KYDIDLPNKKVCIESEHSMDTLLATLKKTGKTVSYLG 65 (66)
T ss_dssp EEEEEECCCSHHHHHHHHHHHHHHCSE-EEEEETTTTEEEEEESSCHHHHHHHHHTTTSCEEEEE
T ss_pred CEEEEEccCchHHHHHHHHHHhcCCCc-EEEEEcCCCEEEEEeeCCHHHHHHHHHHhCCeEEEee
Confidence 568999999999999999999999998 6999999999999999999999999999999999875
|
| >d1qupa2 d.58.17.1 (A:2-73) Copper chaperone for superoxide dismutase, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1cc8a_ d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2ggpb1 d.58.17.1 (B:1-72) Copper transporter domain ccc2a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1osda_ d.58.17.1 (A:) Mercuric ion binding protein MerP {Ralstonia metallidurans CH34 [TaxId: 266264]} | Back information, alignment and structure |
|---|
| >d1sb6a_ d.58.17.1 (A:) Copper chaperone {Synechocystis sp. pcc 6803, Scatx1 [TaxId: 1148]} | Back information, alignment and structure |
|---|
| >d2qifa1 d.58.17.1 (A:1-69) Copper chaperone {Bacillus subtilis, CopZ [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1cpza_ d.58.17.1 (A:) Copper chaperone {Enterococcus hirae [TaxId: 1354]} | Back information, alignment and structure |
|---|
| >d1kvja_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2aw0a_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1q8la_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p6ta1 d.58.17.1 (A:1-72) Potential copper-translocating P-type ATPase CopA (YvgX) {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1p6ta2 d.58.17.1 (A:73-151) Potential copper-translocating P-type ATPase CopA (YvgX) {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1mwza_ d.58.17.1 (A:) Metal ion-transporting ATPase ZntA, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d3bpda1 d.58.61.1 (A:1-91) Uncharacterized protein AF1549 {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d2raqa1 d.58.61.1 (A:3-95) Uncharacterized protein MTH889 {Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1jdqa_ d.68.3.3 (A:) Hypothetical protein TM0983 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1dcja_ d.68.3.3 (A:) SirA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|