Citrus Sinensis ID: 036329

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------26
MISEIQRNFAKLSQAMGFQRSPSSKQKVKPISKENNDENGGDHSINARTTSNPPDSDTSDASYNSWMVEHPSALDSFDRMIKAAKGKKIAVFLDYDGTLSPIVDDPNRAFMSDEMRAAVREVAKYFPTAIVSGRSREKVKEFVELSNVYYAGSHGMDIQAPPRPVKACEGKYHTLVPGKKGNEVLFQPAKKFLPAIQEIIKELEEETKKIQGARIEDNRFCISVHFRQVREEDYSVLQEKVKAVLRNYPDFDLSEGKK
cHHHHHHHHHHHHHcccccccHHHHHHHHHHHccccccccHHHHHHHHHHcccccccccccccccccccccccccHHHHHHHHHccccEEEEEcccccccccccccccccccHHHHHHHHHHHHHccEEEEccccHHHHHHHHcccccEEEEEccEEEcccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHcccccEEEEcccEEEEEccccccccHHHHHHHHHHHHHHccccEEEcccc
ccHHHHHcHHccccccccccccccccHHcHHHHHHcHHccccHHHHHHHHHcccccccccHHHHHHHHHccHHHHHHHHHHHHHccccEEEEEEccccccccccccccccccHHHHHHHHHHHHHccEEEEEcccHHHHHHHcccccEEEEcccccEEEcccccccccccccccccccccccEEEEccHHHHHHHHHHHHHHHHHHHccccccEEEccEEEEEEEEEcccHHHHHHHHHHHHHHHHHccccccccccc
MISEIQRNFAKLSqamgfqrspsskqkvkpiskenndenggdhsinarttsnppdsdtsdasynswmvehpsaldSFDRMIKAAKGKKIAVFLdydgtlspivddpnrafmSDEMRAAVREVAKYFptaivsgrsrEKVKEFVELSNVyyagshgmdiqapprpvkacegkyhtlvpgkkgnevlfqpAKKFLPAIQEIIKELEEETKKIQGariednrfcISVHFRQVREEDYSVLQEKVKAVLRnypdfdlsegkk
MISEIQRnfaklsqamgfqrspsskqkvkpiskenndenggdhsinarttsnppdsDTSDASYNSWMVEHPSALDSFDRMIKAAKGKKIAVFLDYDGTLSPIVDDPNRAFMSDEMRAAVREVAKYfptaivsgrsrekvKEFVELSNVYyagshgmdiqaPPRPVKACEGKYHTLVPGKKGNEVLFQPAKKFLPAIQEIIKELEEETKKiqgariednrfCISVHFRQVREEDYSVLQEKVKavlrnypdfdlsegkk
MISEIQRNFAKLSQAMGFQRSPSSKQKVKPISKENNDENGGDHSINARTTSNPPDSDTSDASYNSWMVEHPSALDSFDRMIKAAKGKKIAVFLDYDGTLSPIVDDPNRAFMSDEMRAAVREVAKYFPTAIVSGRSREKVKEFVELSNVYYAGSHGMDIQAPPRPVKACEGKYHTLVPGKKGNEVLFQPAKKFLPAIQeiikeleeetkkiQGARIEDNRFCISVHFRQVREEDYSVLQEKVKAVLRNYPDFDLSEGKK
************************************************************************ALDSFDRMIKAAKGKKIAVFLDYDGTLSPIVDDPNRAFMSDEMRAAVREVAKYFPTAIVSGRSREKVKEFVELSNVY********************GKYHTLVPGKKGNEVLFQPAKKFLPAIQEIIKELEEETKKIQGARIEDNRFCISVHFRQVREEDYSVLQEKVKAVLRNYP*********
***********************************NDENGGDHSINA***********************PSALDSFDRMIKAAKGKKIAVFLDYDGTLSPIVDDPNRAFMSDEMRAAVREVAKYFPTAIVSGRSREKVKEFVELSNVYYAGSHGMDIQAPPRPVKACEGKYHTLVPGKKGNEVLFQPAKKFLPAIQEIIKELEEETKKIQGARIEDNRFCISVHFRQVREEDYSVLQEKVKAVLRNYPDFDLSEGK*
MISEIQRNFAKLS***************************GDHSINARTT*********DASYNSWMVEHPSALDSFDRMIKAAKGKKIAVFLDYDGTLSPIVDDPNRAFMSDEMRAAVREVAKYFPTAIVSGRSREKVKEFVELSNVYYAGSHGMDIQAPPRPVKACEGKYHTLVPGKKGNEVLFQPAKKFLPAIQEIIKELEEETKKIQGARIEDNRFCISVHFRQVREEDYSVLQEKVKAVLRNYPDFDLSEGKK
*************************QKVKPISKENNDENGGDHSINARTTSNPPDSDTSDASYNSWMVEHPSALDSFDRMIKAAKGKKIAVFLDYDGTLSPIVDDPNRAFMSDEMRAAVREVAKYFPTAIVSGRSREKVKEFVELSNVYYAGSHGMDIQAPPRPV****GKYHTLV**KKGNEVLFQPAKKFLPAIQEIIKELEEETKKIQGARIEDNRFCISVHFRQVREEDYSVLQEKVKAVLRNYPDFDL*****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MISEIQRNFAKLSQAMGFQRSPSSKQKVKPISKENNDENGGDHSINARTTSNPPDSDTSDASYNSWMVEHPSALDSFDRMIKAAKGKKIAVFLDYDGTLSPIVDDPNRAFMSDEMRAAVREVAKYFPTAIVSGRSREKVKEFVELSNVYYAGSHGMDIQAPPRPVKACEGKYHTLVPGKKGNEVLFQPAKKFLPAxxxxxxxxxxxxxxxxxxxxxDNRFCISVHFRQVREEDYSVLQEKVKAVLRNYPDFDLSEGKK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query258 2.2.26 [Sep-21-2011]
Q9FWQ2382 Probable trehalose-phosph yes no 0.802 0.541 0.535 2e-60
O64896385 Trehalose-phosphate phosp yes no 0.910 0.610 0.455 8e-60
Q7XI41366 Probable trehalose-phosph no no 0.763 0.538 0.557 1e-59
Q6ZAL2370 Probable trehalose-phosph no no 0.713 0.497 0.575 3e-59
Q6H5L4375 Probable trehalose-phosph no no 0.740 0.509 0.545 1e-58
Q9SUW0377 Probable trehalose-phosph no no 0.771 0.527 0.54 4e-58
Q67X99354 Probable trehalose-phosph no no 0.813 0.593 0.511 4e-58
Q9C9S4374 Trehalose-phosphate phosp no no 0.782 0.540 0.504 8e-58
Q0DDI1 500 Probable trehalose-phosph no no 0.779 0.402 0.511 9e-58
Q75WV3371 Probable trehalose-phosph no no 0.751 0.522 0.539 3e-57
>sp|Q9FWQ2|TPP2_ORYSJ Probable trehalose-phosphate phosphatase 2 OS=Oryza sativa subsp. japonica GN=TPP2 PE=1 SV=1 Back     alignment and function desciption
 Score =  232 bits (592), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 113/211 (53%), Positives = 151/211 (71%), Gaps = 4/211 (1%)

Query: 51  SNPPDSDTSDASYNSWMVEHPSALDSFDRMIKAAKGKKIAVFLDYDGTLSPIVDDPNRAF 110
           +N   +D  D  Y +W+V HPSAL SF+ ++  A+GK++A+FLDYDGTLSPIVD+P  A 
Sbjct: 79  ANDVQADELDLLYRNWVVNHPSALTSFEDIVNLARGKRLALFLDYDGTLSPIVDNPENAV 138

Query: 111 MSDEMRAAVREVAKYFPTAIVSGRSREKVKEFVELSNVYYAGSHGMDIQAPPRPVKACEG 170
           MSDEMR+AV+ VA  FPTAI+SGRSR+KV +FV+L+ +YYAGSHGMDI  P R   +  G
Sbjct: 139 MSDEMRSAVKHVASLFPTAIISGRSRDKVFDFVKLTELYYAGSHGMDIMGPVRKSDS-SG 197

Query: 171 KYHTLV--PGKKGNEV-LFQPAKKFLPAIQEIIKELEEETKKIQGARIEDNRFCISVHFR 227
           ++   +     +G EV LFQPA +FLP I E+ K+L E  K I GAR+EDN+FC+SVH+R
Sbjct: 198 QHVECIRSTDSEGKEVNLFQPASEFLPMISEVYKKLSESIKDIDGARMEDNKFCVSVHYR 257

Query: 228 QVREEDYSVLQEKVKAVLRNYPDFDLSEGKK 258
            V   DY  + ++V AVL+NYP   L+ G+K
Sbjct: 258 NVAPHDYGEVHQRVTAVLKNYPCLRLTHGRK 288
Removes the phosphate from trehalose 6-phosphate to produce free trehalose. Trehalose accumulation in plant may improve abiotic stress tolerance.
Oryza sativa subsp. japonica (taxid: 39947)
EC: 3EC: .EC: 1EC: .EC: 3EC: .EC: 1EC: 2
>sp|O64896|TPPA_ARATH Trehalose-phosphate phosphatase A OS=Arabidopsis thaliana GN=TPPA PE=1 SV=1 Back     alignment and function description
>sp|Q7XI41|TPP3_ORYSJ Probable trehalose-phosphate phosphatase 3 OS=Oryza sativa subsp. japonica GN=TPP3 PE=2 SV=1 Back     alignment and function description
>sp|Q6ZAL2|TPP6_ORYSJ Probable trehalose-phosphate phosphatase 6 OS=Oryza sativa subsp. japonica GN=TPP6 PE=2 SV=1 Back     alignment and function description
>sp|Q6H5L4|TPP7_ORYSJ Probable trehalose-phosphate phosphatase 7 OS=Oryza sativa subsp. japonica GN=TPP7 PE=2 SV=2 Back     alignment and function description
>sp|Q9SUW0|TPPG_ARATH Probable trehalose-phosphate phosphatase G OS=Arabidopsis thaliana GN=TPPG PE=2 SV=1 Back     alignment and function description
>sp|Q67X99|TPPE_ARATH Probable trehalose-phosphate phosphatase E OS=Arabidopsis thaliana GN=TPPE PE=2 SV=1 Back     alignment and function description
>sp|Q9C9S4|TPPB_ARATH Trehalose-phosphate phosphatase B OS=Arabidopsis thaliana GN=TPPB PE=1 SV=1 Back     alignment and function description
>sp|Q0DDI1|TPP8_ORYSJ Probable trehalose-phosphate phosphatase 8 OS=Oryza sativa subsp. japonica GN=TPP8 PE=2 SV=3 Back     alignment and function description
>sp|Q75WV3|TPP1_ORYSJ Probable trehalose-phosphate phosphatase 1 OS=Oryza sativa subsp. japonica GN=TPP1 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query258
255545036 365 trehalose-6-phosphate synthase, putative 0.941 0.665 0.680 5e-98
224120642340 predicted protein [Populus trichocarpa] 0.887 0.673 0.668 2e-90
356509287 367 PREDICTED: trehalose-phosphate phosphata 0.984 0.692 0.596 4e-83
356518619343 PREDICTED: trehalose-phosphate phosphata 0.941 0.708 0.614 7e-82
147867192 376 hypothetical protein VITISV_027427 [Viti 0.934 0.640 0.588 2e-81
302143677353 unnamed protein product [Vitis vinifera] 0.934 0.682 0.596 4e-81
225462741 413 PREDICTED: trehalose-phosphate phosphata 0.957 0.598 0.596 1e-79
357463855 366 Trehalose-phosphate phosphatase [Medicag 0.926 0.653 0.599 9e-77
224132948267 predicted protein [Populus trichocarpa] 0.662 0.640 0.682 2e-69
449467003307 PREDICTED: probable trehalose-phosphate 0.740 0.622 0.629 6e-66
>gi|255545036|ref|XP_002513579.1| trehalose-6-phosphate synthase, putative [Ricinus communis] gi|223547487|gb|EEF48982.1| trehalose-6-phosphate synthase, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  363 bits (931), Expect = 5e-98,   Method: Compositional matrix adjust.
 Identities = 177/260 (68%), Positives = 209/260 (80%), Gaps = 17/260 (6%)

Query: 2   ISEIQRNFAKLSQAMGFQRSPSSKQKVKP---ISKENNDENGGDHSINARTTSNPPDSDT 58
           +   ++N AKL+QAM FQR  S+KQK +    I K +N   GG                 
Sbjct: 13  VGMFKKNIAKLNQAMCFQRCSSNKQKSQSGDNIKKASNRITGG--------------CSP 58

Query: 59  SDASYNSWMVEHPSALDSFDRMIKAAKGKKIAVFLDYDGTLSPIVDDPNRAFMSDEMRAA 118
            DA+YNSW+VEHPSAL  FD+M+KAAKGKKI VFLDYDGTLSPIVD+P+ AFMSDEMRAA
Sbjct: 59  RDANYNSWVVEHPSALSLFDQMMKAAKGKKIVVFLDYDGTLSPIVDNPDLAFMSDEMRAA 118

Query: 119 VREVAKYFPTAIVSGRSREKVKEFVELSNVYYAGSHGMDIQAPPRPVKACEGKYHTLVPG 178
           VREVAKYFPTAI+SGRSR+KVKEFV+LSNVYYAGSHGMDI APPRPVK+C+GKY+T+   
Sbjct: 119 VREVAKYFPTAIISGRSRDKVKEFVKLSNVYYAGSHGMDIMAPPRPVKSCDGKYNTITLN 178

Query: 179 KKGNEVLFQPAKKFLPAIQEIIKELEEETKKIQGARIEDNRFCISVHFRQVREEDYSVLQ 238
           KKGNEVLFQPAKKFLPA+Q+I+  L+E+ KKIQGAR+EDNRFC+SVHFRQVREEDY  L+
Sbjct: 179 KKGNEVLFQPAKKFLPAMQKILTALKEKVKKIQGARVEDNRFCVSVHFRQVREEDYGKLE 238

Query: 239 EKVKAVLRNYPDFDLSEGKK 258
           EKVK+VL +YP+F L+ GKK
Sbjct: 239 EKVKSVLEHYPEFHLNWGKK 258

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224120642|ref|XP_002318381.1| predicted protein [Populus trichocarpa] gi|222859054|gb|EEE96601.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356509287|ref|XP_003523382.1| PREDICTED: trehalose-phosphate phosphatase-like [Glycine max] Back     alignment and taxonomy information
>gi|356518619|ref|XP_003527976.1| PREDICTED: trehalose-phosphate phosphatase-like [Glycine max] Back     alignment and taxonomy information
>gi|147867192|emb|CAN79955.1| hypothetical protein VITISV_027427 [Vitis vinifera] Back     alignment and taxonomy information
>gi|302143677|emb|CBI22538.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|225462741|ref|XP_002268007.1| PREDICTED: trehalose-phosphate phosphatase-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|357463855|ref|XP_003602209.1| Trehalose-phosphate phosphatase [Medicago truncatula] gi|355491257|gb|AES72460.1| Trehalose-phosphate phosphatase [Medicago truncatula] Back     alignment and taxonomy information
>gi|224132948|ref|XP_002321449.1| predicted protein [Populus trichocarpa] gi|222868445|gb|EEF05576.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|449467003|ref|XP_004151215.1| PREDICTED: probable trehalose-phosphate phosphatase 4-like [Cucumis sativus] gi|449524326|ref|XP_004169174.1| PREDICTED: probable trehalose-phosphate phosphatase 4-like [Cucumis sativus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query258
UNIPROTKB|Q9FWQ2382 TPP2 "Probable trehalose-phosp 0.802 0.541 0.507 1.3e-52
TAIR|locus:2153082385 ATTPPA [Arabidopsis thaliana ( 0.782 0.524 0.502 2.8e-50
TAIR|locus:2127510377 TPPG "trehalose-6-phosphate ph 0.771 0.527 0.51 4.6e-50
UNIPROTKB|Q75WV3371 TPP1 "Probable trehalose-phosp 0.751 0.522 0.519 1.5e-49
TAIR|locus:2007651369 TPPD "trehalose-6-phosphate ph 0.751 0.525 0.492 1.5e-49
TAIR|locus:2171850370 TPPJ "trehalose-6-phosphate ph 0.887 0.618 0.442 6.7e-49
TAIR|locus:2060390354 TPPE "trehalose-6-phosphate ph 0.961 0.700 0.432 8.5e-49
TAIR|locus:2194704374 TPPB "trehalose-6-phosphate ph 0.771 0.532 0.488 3.7e-48
TAIR|locus:2135272349 TPPH "trehalose-6-phosphate ph 0.968 0.716 0.425 6e-48
TAIR|locus:2135540368 TPPF "trehalose-6-phosphate ph 0.748 0.524 0.49 8.8e-47
UNIPROTKB|Q9FWQ2 TPP2 "Probable trehalose-phosphate phosphatase 2" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
 Score = 545 (196.9 bits), Expect = 1.3e-52, P = 1.3e-52
 Identities = 107/211 (50%), Positives = 143/211 (67%)

Query:    51 SNPPDSDTSDASYNSWMVEHPSALDSFDRMIKAAKGKKIAVFLDYDGTLSPIVDDPNRAF 110
             +N   +D  D  Y +W+V HPSAL SF+ ++  A+GK++A+FLDYDGTLSPIVD+P  A 
Sbjct:    79 ANDVQADELDLLYRNWVVNHPSALTSFEDIVNLARGKRLALFLDYDGTLSPIVDNPENAV 138

Query:   111 MSDEMRAAVREVAKYFPTAIVSGRSREKVKEFVELSNVYYAGSHGMDIQAPPRPVKACEG 170
             MSDEMR+AV+ VA  FPTAI+SGRSR+KV +FV+L+ +YYAGSHGMDI  P R   +  G
Sbjct:   139 MSDEMRSAVKHVASLFPTAIISGRSRDKVFDFVKLTELYYAGSHGMDIMGPVRKSDS-SG 197

Query:   171 KYHTLVPG--KKGNEV-LFQPAKKFLPAIQXXXXXXXXXXXXXQGARIEDNRFCISVHFR 227
             ++   +     +G EV LFQPA +FLP I               GAR+EDN+FC+SVH+R
Sbjct:   198 QHVECIRSTDSEGKEVNLFQPASEFLPMISEVYKKLSESIKDIDGARMEDNKFCVSVHYR 257

Query:   228 QVREEDYSVLQEKVKAVLRNYPDFDLSEGKK 258
              V   DY  + ++V AVL+NYP   L+ G+K
Sbjct:   258 NVAPHDYGEVHQRVTAVLKNYPCLRLTHGRK 288
GO:0004805 "trehalose-phosphatase activity" evidence=IDA
GO:0005992 "trehalose biosynthetic process" evidence=IDA
TAIR|locus:2153082 ATTPPA [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2127510 TPPG "trehalose-6-phosphate phosphatase G" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q75WV3 TPP1 "Probable trehalose-phosphate phosphatase 1" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
TAIR|locus:2007651 TPPD "trehalose-6-phosphate phosphatase D" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2171850 TPPJ "trehalose-6-phosphate phosphatase J" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2060390 TPPE "trehalose-6-phosphate phosphatase E" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2194704 TPPB "trehalose-6-phosphate phosphatase B" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2135272 TPPH "trehalose-6-phosphate phosphatase H" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2135540 TPPF "trehalose-6-phosphate phosphatase F" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
gw1.XII.661.1
hypothetical protein (269 aa)
(Populus trichocarpa)
Predicted Functional Partners:
gw1.IV.2527.1
trehalose-6-phosphate synthase (769 aa)
• •  •• 0.707
estExt_Genewise1_v1.C_290287
hypothetical protein (662 aa)
• •   • 0.625
estExt_fgenesh4_pg.C_1680018
hypothetical protein (922 aa)
• •   • 0.581

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query258
PLN02580384 PLN02580, PLN02580, trehalose-phosphatase 2e-89
PLN02151354 PLN02151, PLN02151, trehalose-phosphatase 2e-72
PLN03017366 PLN03017, PLN03017, trehalose-phosphatase 7e-71
pfam02358235 pfam02358, Trehalose_PPase, Trehalose-phosphatase 2e-37
COG1877266 COG1877, OtsB, Trehalose-6-phosphatase [Carbohydra 1e-25
TIGR00685244 TIGR00685, T6PP, trehalose-phosphatase 3e-21
PRK14501726 PRK14501, PRK14501, putative bifunctional trehalos 3e-15
TIGR01484204 TIGR01484, HAD-SF-IIB, HAD-superfamily hydrolase, 4e-06
TIGR01662132 TIGR01662, HAD-SF-IIIA, HAD-superfamily hydrolase, 0.004
>gnl|CDD|215317 PLN02580, PLN02580, trehalose-phosphatase Back     alignment and domain information 
 Score =  269 bits (689), Expect = 2e-89
 Identities = 114/227 (50%), Positives = 159/227 (70%), Gaps = 13/227 (5%)

Query: 45  INARTTSNPP------------DSDTSDASYNSWMVEHPSALDSFDRMIKAAKGKKIAVF 92
           ++A  +S+PP             S  +D +Y +WM+++PSAL SF+++   AKGKKIA+F
Sbjct: 64  LDAMKSSSPPRKKLNKDFNVELASPDTDFAYRTWMLKYPSALTSFEQIANFAKGKKIALF 123

Query: 93  LDYDGTLSPIVDDPNRAFMSDEMRAAVREVAKYFPTAIVSGRSREKVKEFVELSNVYYAG 152
           LDYDGTLSPIVDDP+RA MSD MR+AV+ VAKYFPTAI+SGRSR+KV E V L+ +YYAG
Sbjct: 124 LDYDGTLSPIVDDPDRALMSDAMRSAVKNVAKYFPTAIISGRSRDKVYELVGLTELYYAG 183

Query: 153 SHGMDIQAPPRPVKACEGKYHTLVPGKKGNEV-LFQPAKKFLPAIQEIIKELEEETKKIQ 211
           SHGMDI  P R   + +         ++G EV LFQPA +FLP I E+ + L E TK I+
Sbjct: 184 SHGMDIMGPVRESVSNDHPNCIKSTDQQGKEVNLFQPASEFLPMIDEVFRSLVESTKDIK 243

Query: 212 GARIEDNRFCISVHFRQVREEDYSVLQEKVKAVLRNYPDFDLSEGKK 258
           GA++E+++FC+SVH+R V E+++ ++ + V  VL+ YP   L+ G+K
Sbjct: 244 GAKVENHKFCVSVHYRNVDEKNWPLVAQCVHDVLKKYPRLRLTHGRK 290

Length = 384
>gnl|CDD|177812 PLN02151, PLN02151, trehalose-phosphatase Back     alignment and domain information
>gnl|CDD|178591 PLN03017, PLN03017, trehalose-phosphatase Back     alignment and domain information
>gnl|CDD|216992 pfam02358, Trehalose_PPase, Trehalose-phosphatase Back     alignment and domain information
>gnl|CDD|224789 COG1877, OtsB, Trehalose-6-phosphatase [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|233092 TIGR00685, T6PP, trehalose-phosphatase Back     alignment and domain information
>gnl|CDD|184712 PRK14501, PRK14501, putative bifunctional trehalose-6-phosphate synthase/HAD hydrolase subfamily IIB; Provisional Back     alignment and domain information
>gnl|CDD|233434 TIGR01484, HAD-SF-IIB, HAD-superfamily hydrolase, subfamily IIB Back     alignment and domain information
>gnl|CDD|233517 TIGR01662, HAD-SF-IIIA, HAD-superfamily hydrolase, subfamily IIIA Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 258
PLN02580384 trehalose-phosphatase 100.0
PLN02151354 trehalose-phosphatase 100.0
PLN03017366 trehalose-phosphatase 100.0
PLN03064 934 alpha,alpha-trehalose-phosphate synthase (UDP-form 100.0
PLN03063 797 alpha,alpha-trehalose-phosphate synthase (UDP-form 100.0
COG1877266 OtsB Trehalose-6-phosphatase [Carbohydrate transpo 100.0
PF02358235 Trehalose_PPase: Trehalose-phosphatase; InterPro: 100.0
PLN02205 854 alpha,alpha-trehalose-phosphate synthase [UDP-form 99.96
TIGR00685244 T6PP trehalose-phosphatase. At least 18 distinct s 99.96
PRK14501726 putative bifunctional trehalose-6-phosphate syntha 99.95
KOG1050732 consensus Trehalose-6-phosphate synthase component 99.91
PRK10187 266 trehalose-6-phosphate phosphatase; Provisional 99.9
TIGR01484204 HAD-SF-IIB HAD-superfamily hydrolase, subfamily II 99.66
KOG1050 732 consensus Trehalose-6-phosphate synthase component 99.02
TIGR02471236 sucr_syn_bact_C sucrose phosphate synthase, sucros 98.99
PRK10976266 putative hydrolase; Provisional 98.99
PRK01158230 phosphoglycolate phosphatase; Provisional 98.97
PF08282254 Hydrolase_3: haloacid dehalogenase-like hydrolase; 98.96
PRK15126 272 thiamin pyrimidine pyrophosphate hydrolase; Provis 98.94
PRK10513270 sugar phosphate phosphatase; Provisional 98.94
TIGR01487215 SPP-like sucrose-phosphate phosphatase-like hydrol 98.94
PRK10530 272 pyridoxal phosphate (PLP) phosphatase; Provisional 98.93
PLN02423245 phosphomannomutase 98.93
PTZ00174247 phosphomannomutase; Provisional 98.92
PRK03669271 mannosyl-3-phosphoglycerate phosphatase; Reviewed 98.92
TIGR00099256 Cof-subfamily Cof subfamily of IIB subfamily of ha 98.9
COG0561264 Cof Predicted hydrolases of the HAD superfamily [G 98.89
TIGR01482225 SPP-subfamily Sucrose-phosphate phosphatase subfam 98.83
TIGR01485249 SPP_plant-cyano sucrose-6F-phosphate phosphohydrol 98.82
TIGR02463221 MPGP_rel mannosyl-3-phosphoglycerate phosphatase-r 98.8
PLN02887580 hydrolase family protein 98.76
TIGR01486256 HAD-SF-IIB-MPGP mannosyl-3-phosphoglycerate phosph 98.74
PRK12702 302 mannosyl-3-phosphoglycerate phosphatase; Reviewed 98.73
TIGR02461225 osmo_MPG_phos mannosyl-3-phosphoglycerate phosphat 98.72
PRK00192 273 mannosyl-3-phosphoglycerate phosphatase; Reviewed 98.68
PRK14502 694 bifunctional mannosyl-3-phosphoglycerate synthase/ 98.57
PF05116247 S6PP: Sucrose-6F-phosphate phosphohydrolase; Inter 98.38
smart00775157 LNS2 LNS2 domain. This domain is found in Saccharo 98.28
KOG3189252 consensus Phosphomannomutase [Lipid transport and 98.27
cd01427139 HAD_like Haloacid dehalogenase-like hydrolases. Th 98.21
TIGR01689126 EcbF-BcbF capsule biosynthesis phosphatase. Due to 98.11
COG3769274 Predicted hydrolase (HAD superfamily) [General fun 98.06
TIGR01684301 viral_ppase viral phosphatase. These proteins also 97.89
PLN02382 413 probable sucrose-phosphatase 97.83
TIGR01662132 HAD-SF-IIIA HAD-superfamily hydrolase, subfamily I 97.66
TIGR01672237 AphA HAD superfamily (subfamily IIIB) phosphatase, 97.66
TIGR01664166 DNA-3'-Pase DNA 3'-phosphatase. The central phosph 97.55
PHA03398303 viral phosphatase superfamily protein; Provisional 97.48
TIGR01681128 HAD-SF-IIIC HAD-superfamily phosphatase, subfamily 97.47
TIGR01670154 YrbI-phosphatas 3-deoxy-D-manno-octulosonate 8-pho 97.36
TIGR00213176 GmhB_yaeD D,D-heptose 1,7-bisphosphate phosphatase 97.35
TIGR01458257 HAD-SF-IIA-hyp3 HAD-superfamily subfamily IIA hydr 97.18
PRK11009237 aphA acid phosphatase/phosphotransferase; Provisio 97.18
TIGR01457249 HAD-SF-IIA-hyp2 HAD-superfamily subfamily IIA hydr 97.07
PRK09484183 3-deoxy-D-manno-octulosonate 8-phosphate phosphata 97.02
PLN02645 311 phosphoglycolate phosphatase 96.97
PRK10444248 UMP phosphatase; Provisional 96.93
PF08645159 PNK3P: Polynucleotide kinase 3 phosphatase; InterP 96.85
PRK06769173 hypothetical protein; Validated 96.85
TIGR01656147 Histidinol-ppas histidinol-phosphate phosphatase f 96.82
TIGR01663 526 PNK-3'Pase polynucleotide 5'-kinase 3'-phosphatase 96.77
TIGR01452 279 PGP_euk phosphoglycolate/pyridoxal phosphate phosp 96.71
TIGR01261161 hisB_Nterm histidinol-phosphatase. This model desc 96.69
TIGR01668170 YqeG_hyp_ppase HAD superfamily (subfamily IIIA) ph 96.67
PHA02530300 pseT polynucleotide kinase; Provisional 96.67
PF09419168 PGP_phosphatase: Mitochondrial PGP phosphatase; In 96.64
PRK05446 354 imidazole glycerol-phosphate dehydratase/histidino 96.43
PRK08942181 D,D-heptose 1,7-bisphosphate phosphatase; Validate 96.37
PF13344101 Hydrolase_6: Haloacid dehalogenase-like hydrolase; 96.34
PRK13582205 thrH phosphoserine phosphatase; Provisional 96.29
smart00577148 CPDc catalytic domain of ctd-like phosphatases. 96.24
TIGR01533266 lipo_e_P4 5'-nucleotidase, lipoprotein e(P4) famil 96.21
PRK09552219 mtnX 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosp 96.19
TIGR00338219 serB phosphoserine phosphatase SerB. Phosphoserine 96.08
COG1778170 Low specificity phosphatase (HAD superfamily) [Gen 95.99
TIGR01489188 DKMTPPase-SF 2,3-diketo-5-methylthio-1-phosphopent 95.95
COG2179175 Predicted hydrolase of the HAD superfamily [Genera 95.94
TIGR02468 1050 sucrsPsyn_pln sucrose phosphate synthase/possible 95.93
PF03332220 PMM: Eukaryotic phosphomannomutase; InterPro: IPR0 95.91
PLN02954224 phosphoserine phosphatase 95.83
TIGR01460236 HAD-SF-IIA Haloacid Dehalogenase Superfamily Class 95.82
PF03031159 NIF: NLI interacting factor-like phosphatase; Inte 95.76
TIGR01459242 HAD-SF-IIA-hyp4 HAD-superfamily class IIA hydrolas 95.65
TIGR01491201 HAD-SF-IB-PSPlk HAD-superfamily, subfamily-IB PSPa 95.59
TIGR01685174 MDP-1 magnesium-dependent phosphatase-1. This mode 95.56
PRK13288214 pyrophosphatase PpaX; Provisional 95.43
TIGR01488177 HAD-SF-IB Haloacid Dehalogenase superfamily, subfa 95.31
TIGR02726169 phenyl_P_delta phenylphosphate carboxylase, delta 95.27
PRK10826222 2-deoxyglucose-6-phosphatase; Provisional 95.06
TIGR03333214 salvage_mtnX 2-hydroxy-3-keto-5-methylthiopentenyl 95.05
TIGR02245195 HAD_IIID1 HAD-superfamily subfamily IIID hydrolase 95.04
PRK11133322 serB phosphoserine phosphatase; Provisional 94.84
TIGR01675229 plant-AP plant acid phosphatase. This model explic 94.77
COG0241181 HisB Histidinol phosphatase and related phosphatas 94.47
TIGR02251162 HIF-SF_euk Dullard-like phosphatase domain. This d 94.39
TIGR01456 321 CECR5 HAD-superfamily class IIA hydrolase, TIGR014 94.28
TIGR01686 320 FkbH FkbH-like domain. The C-terminal portion of t 94.26
COG0560212 SerB Phosphoserine phosphatase [Amino acid transpo 94.25
PRK13222226 phosphoglycolate phosphatase; Provisional 94.13
TIGR02250156 FCP1_euk FCP1-like phosphatase, phosphatase domain 94.06
PF08235157 LNS2: LNS2 (Lipin/Ned1/Smp2); InterPro: IPR013209 94.0
TIGR03351220 PhnX-like phosphonatase-like hydrolase. This clade 93.96
PLN03243260 haloacid dehalogenase-like hydrolase; Provisional 93.9
PRK13225273 phosphoglycolate phosphatase; Provisional 93.89
PRK08238 479 hypothetical protein; Validated 93.88
TIGR01680275 Veg_Stor_Prot vegetative storage protein. The prot 93.87
PF06888234 Put_Phosphatase: Putative Phosphatase; InterPro: I 93.75
COG0647269 NagD Predicted sugar phosphatases of the HAD super 93.72
COG0637221 Predicted phosphatase/phosphohexomutase [General f 93.6
TIGR02137203 HSK-PSP phosphoserine phosphatase/homoserine phosp 93.54
PTZ00445219 p36-lilke protein; Provisional 93.36
COG0546220 Gph Predicted phosphatases [General function predi 93.23
PF12689169 Acid_PPase: Acid Phosphatase; InterPro: IPR010036 93.02
PF03767229 Acid_phosphat_B: HAD superfamily, subfamily IIIB ( 92.56
PLN02940 382 riboflavin kinase 92.34
PRK11590211 hypothetical protein; Provisional 91.97
PLN02575381 haloacid dehalogenase-like hydrolase 91.86
PF06941191 NT5C: 5' nucleotidase, deoxy (Pyrimidine), cytosol 91.71
TIGR01548197 HAD-SF-IA-hyp1 haloacid dehalogenase superfamily, 91.29
PRK10725188 fructose-1-P/6-phosphogluconate phosphatase; Provi 90.6
TIGR02252203 DREG-2 REG-2-like, HAD superfamily (subfamily IA) 90.15
TIGR02253221 CTE7 HAD superfamily (subfamily IA) hydrolase, TIG 89.72
TIGR01990185 bPGM beta-phosphoglucomutase. The enzyme from L. l 89.7
PRK11587218 putative phosphatase; Provisional 89.7
TIGR01493175 HAD-SF-IA-v2 Haloacid dehalogenase superfamily, su 89.44
COG4087152 Soluble P-type ATPase [General function prediction 89.24
TIGR02009185 PGMB-YQAB-SF beta-phosphoglucomutase family hydrol 88.9
TIGR01545210 YfhB_g-proteo haloacid dehalogenase superfamily, s 88.42
PHA02597197 30.2 hypothetical protein; Provisional 88.41
PLN02770248 haloacid dehalogenase-like hydrolase family protei 88.39
PRK10748238 flavin mononucleotide phosphatase; Provisional 88.16
TIGR01993184 Pyr-5-nucltdase pyrimidine 5'-nucleotidase. These 87.94
KOG3120256 consensus Predicted haloacid dehalogenase-like hyd 87.56
TIGR01422253 phosphonatase phosphonoacetaldehyde hydrolase. Thi 87.43
TIGR01549154 HAD-SF-IA-v1 haloacid dehalogenase superfamily, su 86.98
PRK14988224 GMP/IMP nucleotidase; Provisional 86.35
PRK13226229 phosphoglycolate phosphatase; Provisional 86.09
TIGR02254224 YjjG/YfnB HAD superfamily (subfamily IA) hydrolase 85.98
COG4359220 Uncharacterized conserved protein [Function unknow 85.8
PLN02779286 haloacid dehalogenase-like hydrolase family protei 85.62
PRK13478267 phosphonoacetaldehyde hydrolase; Provisional 85.59
TIGR01454205 AHBA_synth_RP 3-amino-5-hydroxybenoic acid synthes 85.08
PRK13223272 phosphoglycolate phosphatase; Provisional 84.72
PRK10563221 6-phosphogluconate phosphatase; Provisional 84.11
PRK09449224 dUMP phosphatase; Provisional 83.97
PF12710192 HAD: haloacid dehalogenase-like hydrolase; PDB: 3P 83.62
TIGR01544277 HAD-SF-IE haloacid dehalogenase superfamily, subfa 83.32
TIGR01449213 PGP_bact 2-phosphoglycolate phosphatase, prokaryot 82.53
TIGR01490202 HAD-SF-IB-hyp1 HAD-superfamily subfamily IB hydrol 82.5
TIGR01428198 HAD_type_II 2-haloalkanoic acid dehalogenase, type 82.42
TIGR02247211 HAD-1A3-hyp Epoxide hydrolase N-terminal domain-li 81.89
TIGR01509183 HAD-SF-IA-v3 haloacid dehalogenase superfamily, su 81.18
PF11019252 DUF2608: Protein of unknown function (DUF2608); In 80.13
>PLN02580 trehalose-phosphatase Back     alignment and domain information 
Probab=100.00  E-value=4.6e-44  Score=338.37  Aligned_cols=200  Identities=53%  Similarity=0.921  Sum_probs=177.6

Q ss_pred             CCchhhhhhhhhCCCCCccHHHHHHHhccCCEEEEEecCCccCCCCCCCCCccCCHHHHHHHHHHHhhCCEEEEecCChh
Q 036329           58 TSDASYNSWMVEHPSALDSFDRMIKAAKGKKIAVFLDYDGTLSPIVDDPNRAFMSDEMRAAVREVAKYFPTAIVSGRSRE  137 (258)
Q Consensus        58 ~~~~~~~~w~~~~p~~l~~~~~i~~~~~~k~~ll~lD~DGTL~~~~~~p~~~~~~~~~~~aL~~L~~~~~V~IvSGR~~~  137 (258)
                      ..+.+|.+||.+||+||.+|+.|.++.++++++|||||||||+||+++|+.+.++++++++|++|+++++|+|||||+++
T Consensus        89 ~~~~~~~~~~~~~p~al~~~~~~~~~~~~k~~~LfLDyDGTLaPIv~~Pd~A~~s~~~~~aL~~La~~~~VAIVSGR~~~  168 (384)
T PLN02580         89 DTDFAYRTWMLKYPSALTSFEQIANFAKGKKIALFLDYDGTLSPIVDDPDRALMSDAMRSAVKNVAKYFPTAIISGRSRD  168 (384)
T ss_pred             cchHHHHHHHHhCcHHHHHHHHHHHHhhcCCeEEEEecCCccCCCCCCcccccCCHHHHHHHHHHhhCCCEEEEeCCCHH
Confidence            45889999999999999999999999889999999999999999999999999999999999999999899999999999


Q ss_pred             hHHHHhcccCceEEccCCccccCCCCCCc-cccCccccccCC-CCCCcccccccccCchHHHHHHHHHHHHHhccCceEE
Q 036329          138 KVKEFVELSNVYYAGSHGMDIQAPPRPVK-ACEGKYHTLVPG-KKGNEVLFQPAKKFLPAIQEIIKELEEETKKIQGARI  215 (258)
Q Consensus       138 ~l~~~~~~~~l~lig~hG~~i~~p~g~~~-~~W~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~v~~~L~~~~~r~pGs~V  215 (258)
                      ++++++++++++|+|+||++++.|.+... ..|.. |....+ .+++++.++++.+++++++++.+.|.++++++||++|
T Consensus       169 ~L~~~l~~~~l~laGsHG~e~~~p~~~~~~~~~~~-~~~~~~~~g~~~~~~~~a~~~~~~i~~v~~~l~e~~~~~pGs~V  247 (384)
T PLN02580        169 KVYELVGLTELYYAGSHGMDIMGPVRESVSNDHPN-CIKSTDQQGKEVNLFQPASEFLPMIDEVFRSLVESTKDIKGAKV  247 (384)
T ss_pred             HHHHHhCCCCccEEEeCCceeecCCCCcccccccc-cccccccccccccccccchhhhhhHHHHHHHHHHHhccCCCCEE
Confidence            99999999999999999999998765321 24543 222222 3444556778778888889999999999999999999


Q ss_pred             EecCceEEEEcCCCChhcHHHHHHHHHHHHhhCCCcEEeCCCC
Q 036329          216 EDNRFCISVHFRQVREEDYSVLQEKVKAVLRNYPDFDLSEGKK  258 (258)
Q Consensus       216 E~K~~sla~HYR~a~~~~~~~~~~~~~~~l~~~p~l~l~~GKk  258 (258)
                      |+|++||+||||+|+++.++.+++.++.+++.+|++++++||+
T Consensus       248 E~K~~svavHYR~a~~~~~~~~~~~l~~~l~~~~~l~v~~Gk~  290 (384)
T PLN02580        248 ENHKFCVSVHYRNVDEKNWPLVAQCVHDVLKKYPRLRLTHGRK  290 (384)
T ss_pred             EecCcEEEEEeCCCCchHHHHHHHHHHHHHHhCCceEEEeCCe
Confidence            9999999999999999988999999999999999999999985

>PLN02151 trehalose-phosphatase Back     alignment and domain information
>PLN03017 trehalose-phosphatase Back     alignment and domain information
>PLN03064 alpha,alpha-trehalose-phosphate synthase (UDP-forming); Provisional Back     alignment and domain information
>PLN03063 alpha,alpha-trehalose-phosphate synthase (UDP-forming); Provisional Back     alignment and domain information
>COG1877 OtsB Trehalose-6-phosphatase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF02358 Trehalose_PPase: Trehalose-phosphatase; InterPro: IPR003337 Trehalose-phosphatases 3 Back     alignment and domain information
>PLN02205 alpha,alpha-trehalose-phosphate synthase [UDP-forming] Back     alignment and domain information
>TIGR00685 T6PP trehalose-phosphatase Back     alignment and domain information
>PRK14501 putative bifunctional trehalose-6-phosphate synthase/HAD hydrolase subfamily IIB; Provisional Back     alignment and domain information
>KOG1050 consensus Trehalose-6-phosphate synthase component TPS1 and related subunits [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK10187 trehalose-6-phosphate phosphatase; Provisional Back     alignment and domain information
>TIGR01484 HAD-SF-IIB HAD-superfamily hydrolase, subfamily IIB Back     alignment and domain information
>KOG1050 consensus Trehalose-6-phosphate synthase component TPS1 and related subunits [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR02471 sucr_syn_bact_C sucrose phosphate synthase, sucrose phosphatase-like domain, bacterial Back     alignment and domain information
>PRK10976 putative hydrolase; Provisional Back     alignment and domain information
>PRK01158 phosphoglycolate phosphatase; Provisional Back     alignment and domain information
>PF08282 Hydrolase_3: haloacid dehalogenase-like hydrolase; InterPro: IPR013200 The Haloacid Dehydrogenase (HAD) superfamily includes phosphatases, phosphonatases, P-type ATPases, beta-phosphoglucomutases, phosphomannomutases, and dehalogenases, which are involved in a variety of cellular processes ranging from amino acid biosynthesis to detoxification [] Back     alignment and domain information
>PRK15126 thiamin pyrimidine pyrophosphate hydrolase; Provisional Back     alignment and domain information
>PRK10513 sugar phosphate phosphatase; Provisional Back     alignment and domain information
>TIGR01487 SPP-like sucrose-phosphate phosphatase-like hydrolase, Archaeal Back     alignment and domain information
>PRK10530 pyridoxal phosphate (PLP) phosphatase; Provisional Back     alignment and domain information
>PLN02423 phosphomannomutase Back     alignment and domain information
>PTZ00174 phosphomannomutase; Provisional Back     alignment and domain information
>PRK03669 mannosyl-3-phosphoglycerate phosphatase; Reviewed Back     alignment and domain information
>TIGR00099 Cof-subfamily Cof subfamily of IIB subfamily of haloacid dehalogenase superfamily Back     alignment and domain information
>COG0561 Cof Predicted hydrolases of the HAD superfamily [General function prediction only] Back     alignment and domain information
>TIGR01482 SPP-subfamily Sucrose-phosphate phosphatase subfamily Back     alignment and domain information
>TIGR01485 SPP_plant-cyano sucrose-6F-phosphate phosphohydrolase Back     alignment and domain information
>TIGR02463 MPGP_rel mannosyl-3-phosphoglycerate phosphatase-related protein Back     alignment and domain information
>PLN02887 hydrolase family protein Back     alignment and domain information
>TIGR01486 HAD-SF-IIB-MPGP mannosyl-3-phosphoglycerate phosphatase family Back     alignment and domain information
>PRK12702 mannosyl-3-phosphoglycerate phosphatase; Reviewed Back     alignment and domain information
>TIGR02461 osmo_MPG_phos mannosyl-3-phosphoglycerate phosphatase Back     alignment and domain information
>PRK00192 mannosyl-3-phosphoglycerate phosphatase; Reviewed Back     alignment and domain information
>PRK14502 bifunctional mannosyl-3-phosphoglycerate synthase/mannosyl-3 phosphoglycerate phosphatase; Provisional Back     alignment and domain information
>PF05116 S6PP: Sucrose-6F-phosphate phosphohydrolase; InterPro: IPR006380 This family of sequences represent sucrose phosphate phosphohydrolase (SPP) from plants and cyanobacteria [] Back     alignment and domain information
>smart00775 LNS2 LNS2 domain Back     alignment and domain information
>KOG3189 consensus Phosphomannomutase [Lipid transport and metabolism] Back     alignment and domain information
>cd01427 HAD_like Haloacid dehalogenase-like hydrolases Back     alignment and domain information
>TIGR01689 EcbF-BcbF capsule biosynthesis phosphatase Back     alignment and domain information
>COG3769 Predicted hydrolase (HAD superfamily) [General function prediction only] Back     alignment and domain information
>TIGR01684 viral_ppase viral phosphatase Back     alignment and domain information
>PLN02382 probable sucrose-phosphatase Back     alignment and domain information
>TIGR01662 HAD-SF-IIIA HAD-superfamily hydrolase, subfamily IIIA Back     alignment and domain information
>TIGR01672 AphA HAD superfamily (subfamily IIIB) phosphatase, TIGR01672 Back     alignment and domain information
>TIGR01664 DNA-3'-Pase DNA 3'-phosphatase Back     alignment and domain information
>PHA03398 viral phosphatase superfamily protein; Provisional Back     alignment and domain information
>TIGR01681 HAD-SF-IIIC HAD-superfamily phosphatase, subfamily IIIC Back     alignment and domain information
>TIGR01670 YrbI-phosphatas 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase, YrbI family Back     alignment and domain information
>TIGR00213 GmhB_yaeD D,D-heptose 1,7-bisphosphate phosphatase Back     alignment and domain information
>TIGR01458 HAD-SF-IIA-hyp3 HAD-superfamily subfamily IIA hydrolase, TIGR01458 Back     alignment and domain information
>PRK11009 aphA acid phosphatase/phosphotransferase; Provisional Back     alignment and domain information
>TIGR01457 HAD-SF-IIA-hyp2 HAD-superfamily subfamily IIA hydrolase, TIGR01457 Back     alignment and domain information
>PRK09484 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase; Provisional Back     alignment and domain information
>PLN02645 phosphoglycolate phosphatase Back     alignment and domain information
>PRK10444 UMP phosphatase; Provisional Back     alignment and domain information
>PF08645 PNK3P: Polynucleotide kinase 3 phosphatase; InterPro: IPR013954 Polynucleotide kinase 3 phosphatases play a role in the repair of single breaks in DNA induced by DNA-damaging agents such as gamma radiation and camptothecin [] Back     alignment and domain information
>PRK06769 hypothetical protein; Validated Back     alignment and domain information
>TIGR01656 Histidinol-ppas histidinol-phosphate phosphatase family domain Back     alignment and domain information
>TIGR01663 PNK-3'Pase polynucleotide 5'-kinase 3'-phosphatase Back     alignment and domain information
>TIGR01452 PGP_euk phosphoglycolate/pyridoxal phosphate phosphatase family Back     alignment and domain information
>TIGR01261 hisB_Nterm histidinol-phosphatase Back     alignment and domain information
>TIGR01668 YqeG_hyp_ppase HAD superfamily (subfamily IIIA) phosphatase, TIGR01668 Back     alignment and domain information
>PHA02530 pseT polynucleotide kinase; Provisional Back     alignment and domain information
>PF09419 PGP_phosphatase: Mitochondrial PGP phosphatase; InterPro: IPR010021 This group of hypothetical proteins is a part of the IIIA subfamily of the haloacid dehalogenase (HAD) superfamily of hydrolases Back     alignment and domain information
>PRK05446 imidazole glycerol-phosphate dehydratase/histidinol phosphatase; Provisional Back     alignment and domain information
>PRK08942 D,D-heptose 1,7-bisphosphate phosphatase; Validated Back     alignment and domain information
>PF13344 Hydrolase_6: Haloacid dehalogenase-like hydrolase; PDB: 2HO4_B 1YV9_A 1WVI_B 3EPR_A 2P27_A 2OYC_A 2CFT_A 2P69_A 2CFS_A 2CFR_A Back     alignment and domain information
>PRK13582 thrH phosphoserine phosphatase; Provisional Back     alignment and domain information
>smart00577 CPDc catalytic domain of ctd-like phosphatases Back     alignment and domain information
>TIGR01533 lipo_e_P4 5'-nucleotidase, lipoprotein e(P4) family Back     alignment and domain information
>PRK09552 mtnX 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase; Reviewed Back     alignment and domain information
>TIGR00338 serB phosphoserine phosphatase SerB Back     alignment and domain information
>COG1778 Low specificity phosphatase (HAD superfamily) [General function prediction only] Back     alignment and domain information
>TIGR01489 DKMTPPase-SF 2,3-diketo-5-methylthio-1-phosphopentane phosphatase Back     alignment and domain information
>COG2179 Predicted hydrolase of the HAD superfamily [General function prediction only] Back     alignment and domain information
>TIGR02468 sucrsPsyn_pln sucrose phosphate synthase/possible sucrose phosphate phosphatase, plant Back     alignment and domain information
>PF03332 PMM: Eukaryotic phosphomannomutase; InterPro: IPR005002 This enzyme (5 Back     alignment and domain information
>PLN02954 phosphoserine phosphatase Back     alignment and domain information
>TIGR01460 HAD-SF-IIA Haloacid Dehalogenase Superfamily Class (subfamily) IIA Back     alignment and domain information
>PF03031 NIF: NLI interacting factor-like phosphatase; InterPro: IPR004274 The function of this domain is unclear Back     alignment and domain information
>TIGR01459 HAD-SF-IIA-hyp4 HAD-superfamily class IIA hydrolase, TIGR01459 Back     alignment and domain information
>TIGR01491 HAD-SF-IB-PSPlk HAD-superfamily, subfamily-IB PSPase-like hydrolase, archaeal Back     alignment and domain information
>TIGR01685 MDP-1 magnesium-dependent phosphatase-1 Back     alignment and domain information
>PRK13288 pyrophosphatase PpaX; Provisional Back     alignment and domain information
>TIGR01488 HAD-SF-IB Haloacid Dehalogenase superfamily, subfamily IB, phosphoserine phosphatase-like Back     alignment and domain information
>TIGR02726 phenyl_P_delta phenylphosphate carboxylase, delta subunit Back     alignment and domain information
>PRK10826 2-deoxyglucose-6-phosphatase; Provisional Back     alignment and domain information
>TIGR03333 salvage_mtnX 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase Back     alignment and domain information
>TIGR02245 HAD_IIID1 HAD-superfamily subfamily IIID hydrolase, TIGR02245 Back     alignment and domain information
>PRK11133 serB phosphoserine phosphatase; Provisional Back     alignment and domain information
>TIGR01675 plant-AP plant acid phosphatase Back     alignment and domain information
>COG0241 HisB Histidinol phosphatase and related phosphatases [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR02251 HIF-SF_euk Dullard-like phosphatase domain Back     alignment and domain information
>TIGR01456 CECR5 HAD-superfamily class IIA hydrolase, TIGR01456, CECR5 Back     alignment and domain information
>TIGR01686 FkbH FkbH-like domain Back     alignment and domain information
>COG0560 SerB Phosphoserine phosphatase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK13222 phosphoglycolate phosphatase; Provisional Back     alignment and domain information
>TIGR02250 FCP1_euk FCP1-like phosphatase, phosphatase domain Back     alignment and domain information
>PF08235 LNS2: LNS2 (Lipin/Ned1/Smp2); InterPro: IPR013209 This domain is found in Saccharomyces cerevisiae (Baker's yeast) protein SMP2, proteins with an N-terminal lipin domain (IPR007651 from INTERPRO) and phosphatidylinositol transfer proteins [] Back     alignment and domain information
>TIGR03351 PhnX-like phosphonatase-like hydrolase Back     alignment and domain information
>PLN03243 haloacid dehalogenase-like hydrolase; Provisional Back     alignment and domain information
>PRK13225 phosphoglycolate phosphatase; Provisional Back     alignment and domain information
>PRK08238 hypothetical protein; Validated Back     alignment and domain information
>TIGR01680 Veg_Stor_Prot vegetative storage protein Back     alignment and domain information
>PF06888 Put_Phosphatase: Putative Phosphatase; InterPro: IPR016965 This group represents phosphatases related to PHOSPHO1 and PHOSPHO2 [] Back     alignment and domain information
>COG0647 NagD Predicted sugar phosphatases of the HAD superfamily [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG0637 Predicted phosphatase/phosphohexomutase [General function prediction only] Back     alignment and domain information
>TIGR02137 HSK-PSP phosphoserine phosphatase/homoserine phosphotransferase bifunctional protein Back     alignment and domain information
>PTZ00445 p36-lilke protein; Provisional Back     alignment and domain information
>COG0546 Gph Predicted phosphatases [General function prediction only] Back     alignment and domain information
>PF12689 Acid_PPase: Acid Phosphatase; InterPro: IPR010036 This entry represents two closely related clades of sequences from eukaryotes and archaea Back     alignment and domain information
>PF03767 Acid_phosphat_B: HAD superfamily, subfamily IIIB (Acid phosphatase); InterPro: IPR005519 This family of class B acid phosphatases also contains a number of vegetative storage proteins (VPS25) Back     alignment and domain information
>PLN02940 riboflavin kinase Back     alignment and domain information
>PRK11590 hypothetical protein; Provisional Back     alignment and domain information
>PLN02575 haloacid dehalogenase-like hydrolase Back     alignment and domain information
>PF06941 NT5C: 5' nucleotidase, deoxy (Pyrimidine), cytosolic type C protein (NT5C); InterPro: IPR010708 This family consists of several 5' nucleotidase, deoxy (Pyrimidine), and cytosolic type C (NT5C) proteins Back     alignment and domain information
>TIGR01548 HAD-SF-IA-hyp1 haloacid dehalogenase superfamily, subfamily IA hydrolase, TIGR01548 Back     alignment and domain information
>PRK10725 fructose-1-P/6-phosphogluconate phosphatase; Provisional Back     alignment and domain information
>TIGR02252 DREG-2 REG-2-like, HAD superfamily (subfamily IA) hydrolase Back     alignment and domain information
>TIGR02253 CTE7 HAD superfamily (subfamily IA) hydrolase, TIGR02253 Back     alignment and domain information
>TIGR01990 bPGM beta-phosphoglucomutase Back     alignment and domain information
>PRK11587 putative phosphatase; Provisional Back     alignment and domain information
>TIGR01493 HAD-SF-IA-v2 Haloacid dehalogenase superfamily, subfamily IA, variant 2 with 3rd motif like haloacid dehalogenase Back     alignment and domain information
>COG4087 Soluble P-type ATPase [General function prediction only] Back     alignment and domain information
>TIGR02009 PGMB-YQAB-SF beta-phosphoglucomutase family hydrolase Back     alignment and domain information
>TIGR01545 YfhB_g-proteo haloacid dehalogenase superfamily, subfamily IF hydrolase, YfhB Back     alignment and domain information
>PHA02597 30 Back     alignment and domain information
>PLN02770 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>PRK10748 flavin mononucleotide phosphatase; Provisional Back     alignment and domain information
>TIGR01993 Pyr-5-nucltdase pyrimidine 5'-nucleotidase Back     alignment and domain information
>KOG3120 consensus Predicted haloacid dehalogenase-like hydrolase [General function prediction only] Back     alignment and domain information
>TIGR01422 phosphonatase phosphonoacetaldehyde hydrolase Back     alignment and domain information
>TIGR01549 HAD-SF-IA-v1 haloacid dehalogenase superfamily, subfamily IA, variant 1 with third motif having Dx(3-4)D or Dx(3-4)E Back     alignment and domain information
>PRK14988 GMP/IMP nucleotidase; Provisional Back     alignment and domain information
>PRK13226 phosphoglycolate phosphatase; Provisional Back     alignment and domain information
>TIGR02254 YjjG/YfnB HAD superfamily (subfamily IA) hydrolase, TIGR02254 Back     alignment and domain information
>COG4359 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PLN02779 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>PRK13478 phosphonoacetaldehyde hydrolase; Provisional Back     alignment and domain information
>TIGR01454 AHBA_synth_RP 3-amino-5-hydroxybenoic acid synthesis related protein Back     alignment and domain information
>PRK13223 phosphoglycolate phosphatase; Provisional Back     alignment and domain information
>PRK10563 6-phosphogluconate phosphatase; Provisional Back     alignment and domain information
>PRK09449 dUMP phosphatase; Provisional Back     alignment and domain information
>PF12710 HAD: haloacid dehalogenase-like hydrolase; PDB: 3P96_A 3N28_A 3FVV_A 1RKU_A 1RKV_A 1Y8A_A 2FEA_B 3KD3_B Back     alignment and domain information
>TIGR01544 HAD-SF-IE haloacid dehalogenase superfamily, subfamily IE hydrolase, TIGR01544 Back     alignment and domain information
>TIGR01449 PGP_bact 2-phosphoglycolate phosphatase, prokaryotic Back     alignment and domain information
>TIGR01490 HAD-SF-IB-hyp1 HAD-superfamily subfamily IB hydrolase, TIGR01490 Back     alignment and domain information
>TIGR01428 HAD_type_II 2-haloalkanoic acid dehalogenase, type II Back     alignment and domain information
>TIGR02247 HAD-1A3-hyp Epoxide hydrolase N-terminal domain-like phosphatase Back     alignment and domain information
>TIGR01509 HAD-SF-IA-v3 haloacid dehalogenase superfamily, subfamily IA, variant 3 with third motif having DD or ED Back     alignment and domain information
>PF11019 DUF2608: Protein of unknown function (DUF2608); InterPro: IPR022565 This family is conserved in Bacteria Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query258
1u02_A239 Crystal Structure Of Trehalose-6-Phosphate Phosphat 9e-07
>pdb|1U02|A Chain A, Crystal Structure Of Trehalose-6-Phosphate Phosphatase Related Protein Length = 239 Back     alignment and structure 
Iteration: 1

 Score = 50.4 bits (119), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 22/65 (33%), Positives = 42/65 (64%), Gaps = 2/65 (3%)
Query: 91  VFLDYDGTLSPIVDDPNRAFMSDEMRAAVREVAKYFPTAIVSGRSREKVKEF--VELSNV 148
           +FLDYDGTL PI+ +P  ++    + + + ++ + F T IV+GRS E++  F  ++++ +
Sbjct: 4   IFLDYDGTLVPIIXNPEESYADAGLLSLISDLKERFDTYIVTGRSPEEISRFLPLDINXI 63
Query: 149 YYAGS 153
            Y G+
Sbjct: 64  CYHGA 68

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query258
1u02_A239 Trehalose-6-phosphate phosphatase related protein; 1e-52
2amy_A246 PMM 2, phosphomannomutase 2; HS.459855, HS.313504, 1e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-05
2fue_A262 PMM 1, PMMH-22, phosphomannomutase 1; enzyme-produ 2e-05
3f9r_A246 Phosphomannomutase; trypanosome glycobiology struc 4e-04
>1u02_A Trehalose-6-phosphate phosphatase related protein; structural genomics, PSI; 1.92A {Thermoplasma acidophilum} SCOP: c.108.1.15 Length = 239 Back     alignment and structure
 Score =  170 bits (432), Expect = 1e-52
 Identities = 36/169 (21%), Positives = 68/169 (40%), Gaps = 21/169 (12%)

Query: 90  AVFLDYDGTLSPIVDDPNRAFMSDEMRAAVREVAKYFPTAIVSGRSREKVKEFVELSNVY 149
            +FLDYDGTL PI+ +P  ++    + + + ++ + F T IV+GRS E++  F+ L ++ 
Sbjct: 3   LIFLDYDGTLVPIIMNPEESYADAGLLSLISDLKERFDTYIVTGRSPEEISRFLPL-DIN 61

Query: 150 YAGSHGMDIQAPPRPVKACEGKYHTLVPGKKGNEVLFQPAKKFLPAIQEIIKELEEETKK 209
               HG   +                     G  V    + +FL     I ++       
Sbjct: 62  MICYHGACSKIN-------------------GQIVYNNGSDRFLGVFDRIYEDTRSWVSD 102

Query: 210 IQGARIEDNRFCISVHFRQVREEDYSVLQEKVKAVLRNYPDFDLSEGKK 258
             G RI      +  H   +  +    L+ +++ + R +   +   GK 
Sbjct: 103 FPGLRIYRKNLAVLYHLGLMGADMKPKLRSRIEEIARIFG-VETYYGKM 150
>2amy_A PMM 2, phosphomannomutase 2; HS.459855, HS.313504, BC008310, phosphatase, PFAM PF03332, H superfamily, jaecken disease; 2.09A {Homo sapiens} SCOP: c.108.1.10 PDB: 2q4r_A Length = 246 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2fue_A PMM 1, PMMH-22, phosphomannomutase 1; enzyme-product complex, protein glycosyl carbohydrate-deficient glycoprotein syndrome; HET: MSE M1P; 1.75A {Homo sapiens} SCOP: c.108.1.10 PDB: 2fuc_A* Length = 262 Back     alignment and structure
>3f9r_A Phosphomannomutase; trypanosome glycobiology structural genomics, isomerase, structural genomics consortium, SGC; 1.85A {Trypanosoma brucei} PDB: 2i54_A* 2i55_A* Length = 246 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query258
1u02_A239 Trehalose-6-phosphate phosphatase related protein; 99.65
2amy_A246 PMM 2, phosphomannomutase 2; HS.459855, HS.313504, 99.13
2fue_A262 PMM 1, PMMH-22, phosphomannomutase 1; enzyme-produ 99.1
3pgv_A285 Haloacid dehalogenase-like hydrolase; structural g 99.05
3f9r_A246 Phosphomannomutase; trypanosome glycobiology struc 99.03
1xvi_A275 MPGP, YEDP, putative mannosyl-3-phosphoglycerate p 98.98
3dao_A283 Putative phosphatse; structural genomics, joint ce 98.98
1rkq_A 282 Hypothetical protein YIDA; two domain structure wi 98.97
3dnp_A 290 Stress response protein YHAX; structural PSI-2, pr 98.96
1l6r_A227 Hypothetical protein TA0175; structural genomics, 98.96
2b30_A301 Pvivax hypothetical protein; SGPP, structural geno 98.94
1nf2_A268 Phosphatase; structural proteomics, HAD NEW fold, 98.94
1rlm_A271 Phosphatase; HAD family, rossman fold, hydrolase; 98.91
3r4c_A268 Hydrolase, haloacid dehalogenase-like hydrolase; h 98.87
4dw8_A 279 Haloacid dehalogenase-like hydrolase; HAD, putativ 98.87
2zos_A249 MPGP, mannosyl-3-phosphoglycerate phosphatase; hal 98.86
3mpo_A 279 Predicted hydrolase of the HAD superfamily; SGX, P 98.84
1nrw_A 288 Hypothetical protein, haloacid dehalogenase-like h 98.83
1wr8_A231 Phosphoglycolate phosphatase; alpha / beta core do 98.83
3fzq_A 274 Putative hydrolase; YP_001086940.1, putative haloa 98.8
1s2o_A244 SPP, sucrose-phosphatase; phosphohydrolase, HAD su 98.78
3zx4_A259 MPGP, mannosyl-3-phosphoglycerate phosphatase; hyd 98.75
3l7y_A304 Putative uncharacterized protein SMU.1108C; hydrol 98.75
2rbk_A261 Putative uncharacterized protein; HAD-like phospha 98.73
2pq0_A258 Hypothetical conserved protein GK1056; hyopthetica 98.7
3gyg_A289 NTD biosynthesis operon putative hydrolase NTDB; P 98.6
2obb_A142 Hypothetical protein; structural genomics, PSI-2, 98.47
3qgm_A268 P-nitrophenyl phosphatase (PHO2); structural genom 98.14
1xpj_A126 Hypothetical protein; structural genomics, MCSG, p 98.13
3pdw_A266 Uncharacterized hydrolase YUTF; structural genomic 98.06
2wm8_A187 MDP-1, magnesium-dependent phosphatase 1; haloacid 98.03
3epr_A264 Hydrolase, haloacid dehalogenase-like family; stru 98.01
3l8h_A179 Putative haloacid dehalogenase-like hydrolase; HAD 97.99
2oda_A196 Hypothetical protein pspto_2114; haloacid dehaloge 97.92
2i33_A258 Acid phosphatase; HAD superfamily, hydrolase; 1.57 97.88
1k1e_A180 Deoxy-D-mannose-octulosonate 8-phosphate phosphat; 97.87
2p9j_A162 Hypothetical protein AQ2171; secsg, riken, PSI, st 97.84
1vjr_A271 4-nitrophenylphosphatase; TM1742, structural genom 97.79
2pr7_A137 Haloacid dehalogenase/epoxide hydrolase family; NP 97.75
2r8e_A188 3-deoxy-D-manno-octulosonate 8-phosphate phosphata 97.59
2gmw_A211 D,D-heptose 1,7-bisphosphate phosphatase; Zn-bindi 97.58
1zjj_A263 Hypothetical protein PH1952; alpha/beta hydrolase 97.52
3zvl_A 416 Bifunctional polynucleotide phosphatase/kinase; hy 97.4
2c4n_A250 Protein NAGD; nucleotide phosphatase, HAD superfam 97.39
2oyc_A 306 PLP phosphatase, pyridoxal phosphate phosphatase; 97.39
3e8m_A164 Acylneuraminate cytidylyltransferase; 2-keto-3-deo 97.37
3ib6_A189 Uncharacterized protein; structural genomics, unkn 97.34
2b82_A211 APHA, class B acid phosphatase; DDDD acid phosphat 97.33
2fpr_A176 Histidine biosynthesis bifunctional protein HISB; 97.26
2x4d_A271 HLHPP, phospholysine phosphohistidine inorganic py 97.23
2o2x_A218 Hypothetical protein; structural genomics, joint c 97.17
3nvb_A387 Uncharacterized protein; protein FKBH, protein fkb 97.12
3mmz_A176 Putative HAD family hydrolase; structural genomics 97.11
2hx1_A 284 Predicted sugar phosphatases of the HAD superfamil 97.09
2ho4_A259 Haloacid dehalogenase-like hydrolase domain contai 97.08
1yv9_A264 Hydrolase, haloacid dehalogenase family; hypotheti 97.01
3n07_A195 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; 97.01
2i7d_A193 5'(3')-deoxyribonucleotidase, cytosolic type; hydr 96.93
3n1u_A191 Hydrolase, HAD superfamily, subfamily III A; struc 96.84
3mn1_A189 Probable YRBI family phosphatase; structural genom 96.8
3ewi_A168 N-acylneuraminate cytidylyltransferase; beta barre 96.78
1y8a_A 332 Hypothetical protein AF1437; structural genomics, 96.78
3fvv_A232 Uncharacterized protein; unknown function, structu 96.72
3pct_A260 Class C acid phosphatase; hydrolase, outer membran 96.68
3ocu_A262 Lipoprotein E; hydrolase, outer membrane; HET: NMN 96.63
2no4_A240 (S)-2-haloacid dehalogenase IVA; HAD superfamily, 96.49
3ij5_A211 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; 96.22
2hhl_A195 CTD small phosphatase-like protein; CTD phosphatas 96.15
4eze_A317 Haloacid dehalogenase-like hydrolase; magnesium bi 96.14
2ght_A181 Carboxy-terminal domain RNA polymerase II polypept 96.05
3m1y_A217 Phosphoserine phosphatase (SERB); NYSGXRC, PSI II, 95.97
3m9l_A205 Hydrolase, haloacid dehalogenase-like family; HAD 95.96
3kc2_A 352 Uncharacterized protein YKR070W; HAD-like, mitocho 95.96
3um9_A230 Haloacid dehalogenase, type II; haloacid dehalogen 95.94
1nnl_A225 L-3-phosphoserine phosphatase; PSP, HPSP, phospho- 95.88
1qq5_A253 Protein (L-2-haloacid dehalogenase); hydrolase; 1. 95.84
3umb_A233 Dehalogenase-like hydrolase; 2.20A {Ralstonia sola 95.81
1zrn_A232 L-2-haloacid dehalogenase; hydrolase; 1.83A {Pseud 95.8
4as2_A327 Phosphorylcholine phosphatase; hydrolase, HAD supe 95.78
2w43_A201 Hypothetical 2-haloalkanoic acid dehalogenase; hyd 95.76
3nuq_A282 Protein SSM1, putative nucleotide phosphatase; sup 95.68
3skx_A280 Copper-exporting P-type ATPase B; P1B-ATPase, ATP 95.6
3kbb_A216 Phosphorylated carbohydrates phosphatase TM_1254; 95.52
1rku_A206 Homoserine kinase; phosphoserine phosphatase, phos 95.48
3vay_A230 HAD-superfamily hydrolase; rossmann fold, haloacid 95.43
3kd3_A219 Phosphoserine phosphohydrolase-like protein; csgid 95.4
3iru_A277 Phoshonoacetaldehyde hydrolase like protein; phosp 95.21
2hcf_A234 Hydrolase, haloacid dehalogenase-like family; NP_6 95.13
3u26_A234 PF00702 domain protein; structural genomics, PSI-b 95.06
3kzx_A231 HAD-superfamily hydrolase, subfamily IA, variant; 95.03
2fea_A236 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate 94.97
2pke_A251 Haloacid delahogenase-like family hydrolase; NP_63 94.9
3ddh_A234 Putative haloacid dehalogenase-like family hydrol; 94.05
3p96_A415 Phosphoserine phosphatase SERB; ssgcid, structural 93.98
1ltq_A301 Polynucleotide kinase; phosphatase, alpha/beta, P- 93.98
3d6j_A225 Putative haloacid dehalogenase-like hydrolase; str 93.87
2go7_A207 Hydrolase, haloacid dehalogenase-like family; stru 93.87
2wf7_A221 Beta-PGM, beta-phosphoglucomutase; transition stat 93.58
3qle_A204 TIM50P; chaperone, mitochondrion, preprotein trans 93.55
1te2_A226 Putative phosphatase; structural genomics, phospha 93.5
4ex6_A237 ALNB; modified rossman fold, phosphatase, magnesiu 93.5
2pib_A216 Phosphorylated carbohydrates phosphatase TM_1254; 93.48
2fi1_A190 Hydrolase, haloacid dehalogenase-like family; stru 93.4
2om6_A235 Probable phosphoserine phosphatase; rossmann fold, 93.31
3e58_A214 Putative beta-phosphoglucomutase; structu genomics 93.18
3mc1_A226 Predicted phosphatase, HAD family; PSI2, NYSGXRC, 92.97
2fdr_A229 Conserved hypothetical protein; SAD, structural ge 92.95
3cnh_A200 Hydrolase family protein; NP_295428.1, predicted h 92.92
1swv_A267 Phosphonoacetaldehyde hydrolase; HAD enzyme superf 92.9
3i28_A 555 Epoxide hydrolase 2; aromatic hydrocarbons catabol 92.86
3qxg_A243 Inorganic pyrophosphatase; hydrolase, magnesium bi 92.79
1l7m_A211 Phosphoserine phosphatase; rossmann fold, four-hel 92.76
3dv9_A247 Beta-phosphoglucomutase; structural genomics, APC6 92.76
3ed5_A238 YFNB; APC60080, bacillus subtilis subsp. subtilis 92.65
3nas_A233 Beta-PGM, beta-phosphoglucomutase; PSI, structural 92.43
3a1c_A287 Probable copper-exporting P-type ATPase A; ATP-bin 92.22
3qnm_A240 Haloacid dehalogenase-like hydrolase; structural g 92.21
3umg_A254 Haloacid dehalogenase; defluorinase, hydrolase; 2. 92.19
3umc_A254 Haloacid dehalogenase; HY; 2.15A {Pseudomonas aeru 92.14
3shq_A320 UBLCP1; phosphatase, hydrolase; 1.96A {Drosophila 92.13
1q92_A197 5(3)-deoxyribonucleotidase; alpha-beta rossman fol 92.03
2ah5_A210 COG0546: predicted phosphatases; MCSG, structural 91.96
3l5k_A250 Protein GS1, haloacid dehalogenase-like hydrolase 91.92
3s6j_A233 Hydrolase, haloacid dehalogenase-like family; stru 91.68
3ef0_A 372 RNA polymerase II subunit A C-terminal domain phos 91.64
2hoq_A241 Putative HAD-hydrolase PH1655; haloacid dehalogena 91.25
3smv_A240 S-(-)-azetidine-2-carboxylate hydrolase; haloacid 91.09
4fe3_A297 Cytosolic 5'-nucleotidase 3; substrate complex, HA 91.01
3sd7_A240 Putative phosphatase; structural genomics, haloaci 90.83
2hdo_A209 Phosphoglycolate phosphatase; NP_784602.1, structu 90.83
4eek_A259 Beta-phosphoglucomutase-related protein; hydrolase 90.79
4ap9_A201 Phosphoserine phosphatase; hydrolase, haloacid deh 90.37
2hi0_A240 Putative phosphoglycolate phosphatase; YP_619066.1 90.21
2p11_A231 Hypothetical protein; putative haloacid dehalogena 90.19
2b0c_A206 Putative phosphatase; alpha-D-glucose-1-phosphate, 89.91
2hsz_A243 Novel predicted phosphatase; structural genomics, 89.5
2nyv_A222 Pgpase, PGP, phosphoglycolate phosphatase; structu 89.22
2i6x_A211 Hydrolase, haloacid dehalogenase-like family; HAD 88.86
3bwv_A180 Putative 5'(3')-deoxyribonucleotidase; NP_764060.1 88.69
2zg6_A220 Putative uncharacterized protein ST2620, probable 88.62
4dcc_A229 Putative haloacid dehalogenase-like hydrolase; mag 88.47
3k1z_A263 Haloacid dehalogenase-like hydrolase domain-conta 88.09
2qlt_A275 (DL)-glycerol-3-phosphatase 1; APC7326, RHR2P, sac 87.85
4gib_A250 Beta-phosphoglucomutase; rossmann fold, HAD-like, 87.61
2gfh_A260 Haloacid dehalogenase-like hydrolase domain conta; 86.96
4g9b_A243 Beta-PGM, beta-phosphoglucomutase; HAD, putative p 86.71
3rfu_A736 Copper efflux ATPase; alpha helical, CPC, CXXC, AT 86.59
3n28_A335 Phosphoserine phosphatase; HAD family hydrolase, s 85.91
2g80_A253 Protein UTR4; YEL038W, UTR4 protein (unknown trans 82.86
1yns_A261 E-1 enzyme; hydrolase fold; HET: HPO; 1.70A {Homo 82.53
>1u02_A Trehalose-6-phosphate phosphatase related protein; structural genomics, PSI; 1.92A {Thermoplasma acidophilum} SCOP: c.108.1.15 Back     alignment and structure
Probab=99.65  E-value=6.9e-16  Score=134.60  Aligned_cols=123  Identities=24%  Similarity=0.453  Sum_probs=91.8

Q ss_pred             EEEEEecCCccCCCCCCCCCccCCHHHHHHHHHHHhhCCEEEEecCChhhHHHHhcccCceEEccCCccccCCCCCCccc
Q 036329           89 IAVFLDYDGTLSPIVDDPNRAFMSDEMRAAVREVAKYFPTAIVSGRSREKVKEFVELSNVYYAGSHGMDIQAPPRPVKAC  168 (258)
Q Consensus        89 ~ll~lD~DGTL~~~~~~p~~~~~~~~~~~aL~~L~~~~~V~IvSGR~~~~l~~~~~~~~l~lig~hG~~i~~p~g~~~~~  168 (258)
                      ++||+|+||||++...+|+...++++++++|++|++...|+|+|||+...+..++... +++||+||+.+.. .+..  .
T Consensus         2 kli~~DlDGTLl~~~~~~~~~~i~~~~~~al~~l~~~g~v~iaTGR~~~~~~~~~~~l-~~~I~~nGa~i~~-~~~~--~   77 (239)
T 1u02_A            2 SLIFLDYDGTLVPIIMNPEESYADAGLLSLISDLKERFDTYIVTGRSPEEISRFLPLD-INMICYHGACSKI-NGQI--V   77 (239)
T ss_dssp             CEEEEECBTTTBCCCSCGGGCCCCHHHHHHHHHHHHHSEEEEECSSCHHHHHHHSCSS-CEEEEGGGTEEEE-TTEE--E
T ss_pred             eEEEEecCCCCcCCCCCcccCCCCHHHHHHHHHHhcCCCEEEEeCCCHHHHHHHhccc-hheEEECCEEEee-CCee--e
Confidence            5899999999999766666778999999999999986689999999999999988744 7899999999986 3421  0


Q ss_pred             cCccccccCCCCCCcccccccccCchHHHHHHHHHHHHHhccCceEEEecCceEEEEcCCCCh
Q 036329          169 EGKYHTLVPGKKGNEVLFQPAKKFLPAIQEIIKELEEETKKIQGARIEDNRFCISVHFRQVRE  231 (258)
Q Consensus       169 W~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~~L~~~~~r~pGs~VE~K~~sla~HYR~a~~  231 (258)
                      |.                .+.....++-.++...+..++++.+|+.++.+..++.+||+.+++
T Consensus        78 ~~----------------~~~~~~~~l~~~~~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~  124 (239)
T 1u02_A           78 YN----------------NGSDRFLGVFDRIYEDTRSWVSDFPGLRIYRKNLAVLYHLGLMGA  124 (239)
T ss_dssp             EC----------------TTGGGGHHHHHHHHHHHTTHHHHSTTCEEEEETTEEEEECTTSCS
T ss_pred             ec----------------ccccccchhhHHHHHHHHHHHhhCCCcEEEecCCEEEEEcCCCCh
Confidence            10                000000122233344444455667899999999999999998765
>2amy_A PMM 2, phosphomannomutase 2; HS.459855, HS.313504, BC008310, phosphatase, PFAM PF03332, H superfamily, jaecken disease; 2.09A {Homo sapiens} SCOP: c.108.1.10 PDB: 2q4r_A Back     alignment and structure
>2fue_A PMM 1, PMMH-22, phosphomannomutase 1; enzyme-product complex, protein glycosyl carbohydrate-deficient glycoprotein syndrome; HET: MSE M1P; 1.75A {Homo sapiens} SCOP: c.108.1.10 PDB: 2fuc_A* Back     alignment and structure
>3pgv_A Haloacid dehalogenase-like hydrolase; structural genomics, joint center for structural genomics, J protein structure initiative; HET: EPE; 2.39A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3f9r_A Phosphomannomutase; trypanosome glycobiology structural genomics, isomerase, structural genomics consortium, SGC; 1.85A {Trypanosoma brucei} SCOP: c.108.1.0 PDB: 2i54_A* 2i55_A* Back     alignment and structure
>1xvi_A MPGP, YEDP, putative mannosyl-3-phosphoglycerate phosphatase; hypothetical protein, conserved protein, phophatase-like domain; HET: 1PE PG4 PGE; 2.26A {Escherichia coli K12} SCOP: c.108.1.10 Back     alignment and structure
>3dao_A Putative phosphatse; structural genomics, joint center for S genomics, JCSG, protein structure initiative, PSI-2, hydrol; HET: MSE 1PE CIT; 1.80A {Eubacterium rectale} Back     alignment and structure
>1rkq_A Hypothetical protein YIDA; two domain structure with beta-alpha sandwich. stucture contains A magnesium ION., PSI, protein structure initiative; 1.40A {Escherichia coli} SCOP: c.108.1.10 Back     alignment and structure
>3dnp_A Stress response protein YHAX; structural PSI-2, protein structure initiative, midwest center for STR genomics, MCSG, unknown function; HET: MSE; 1.85A {Bacillus subtilis} SCOP: c.108.1.0 Back     alignment and structure
>1l6r_A Hypothetical protein TA0175; structural genomics, putative hydrolas midwest center for structural genomics, MCSG, PSI; 1.40A {Thermoplasma acidophilum} SCOP: c.108.1.10 PDB: 1kyt_A Back     alignment and structure
>2b30_A Pvivax hypothetical protein; SGPP, structural genomics, PSI, protein structure initiative; 2.70A {Plasmodium vivax} SCOP: c.108.1.10 Back     alignment and structure
>1nf2_A Phosphatase; structural proteomics, HAD NEW fold, structural genomics, BSGC structure funded by NIH structure initiative, PSI; 2.20A {Thermotoga maritima} SCOP: c.108.1.10 Back     alignment and structure
>1rlm_A Phosphatase; HAD family, rossman fold, hydrolase; 1.90A {Escherichia coli} SCOP: c.108.1.10 PDB: 1rlt_A 1rlo_A* 2hf2_A Back     alignment and structure
>3r4c_A Hydrolase, haloacid dehalogenase-like hydrolase; haloalkanoate dehalogenase enzyme superfamily, phosphohydrol hydrolase; 1.82A {Bacteroides thetaiotaomicron} SCOP: c.108.1.0 Back     alignment and structure
>4dw8_A Haloacid dehalogenase-like hydrolase; HAD, putative phosphatase, enzyme function initiative, EFI, structural genomics; 1.50A {Bacteroides thetaiotaomicron} PDB: 3niw_A 4dwo_A Back     alignment and structure
>2zos_A MPGP, mannosyl-3-phosphoglycerate phosphatase; haloacid dehalogenase like hydrolase, mannosylglycerate, cytoplasm, hydrolase, magnesium; 1.70A {Pyrococcus horikoshii} PDB: 1wzc_A Back     alignment and structure
>3mpo_A Predicted hydrolase of the HAD superfamily; SGX, PSI, structural genomics, protein structure initiative; 2.90A {Lactobacillus brevis} SCOP: c.108.1.0 Back     alignment and structure
>1nrw_A Hypothetical protein, haloacid dehalogenase-like hydrolase; structural genomics, PSI, protein structure initiative; 1.70A {Bacillus subtilis} SCOP: c.108.1.10 Back     alignment and structure
>1wr8_A Phosphoglycolate phosphatase; alpha / beta core domain, HAD superfamily, structural genomi structural genomics/proteomics initiative, RSGI; 1.60A {Pyrococcus horikoshii} SCOP: c.108.1.10 Back     alignment and structure
>3fzq_A Putative hydrolase; YP_001086940.1, putative haloacid dehalogenase-like hydrolas structural genomics, joint center for structural genomics; HET: MSE; 2.10A {Clostridium difficile} SCOP: c.108.1.0 Back     alignment and structure
>1s2o_A SPP, sucrose-phosphatase; phosphohydrolase, HAD superfamily, cyanobacteria; 1.40A {Synechocystis SP} SCOP: c.108.1.10 PDB: 1tj3_A 1tj4_A* 1tj5_A* 1u2s_A* 1u2t_A* 2b1q_A* 2b1r_A* 2d2v_A* Back     alignment and structure
>3zx4_A MPGP, mannosyl-3-phosphoglycerate phosphatase; hydrolase, haloalkanoid acid dehalogenase-like phosphatase, crystallographic snapshot; HET: 2M8; 1.74A {Thermus thermophilus} PDB: 3zty_A 3zu6_A* 3ztw_A* 3zw7_A* 3zwd_A* 3zwk_A 3zup_A* 3zx5_A* Back     alignment and structure
>3l7y_A Putative uncharacterized protein SMU.1108C; hydrolase; 2.00A {Streptococcus mutans} Back     alignment and structure
>2rbk_A Putative uncharacterized protein; HAD-like phosphatase, unknown function; 1.00A {Bacteroides thetaiotaomicron} SCOP: c.108.1.10 PDB: 1ymq_A 2rb5_A 2rav_A 2rar_A Back     alignment and structure
>2pq0_A Hypothetical conserved protein GK1056; hyopthetical protein, structural genomics, unknown function; 2.60A {Geobacillus kaustophilus} PDB: 2qyh_A Back     alignment and structure
>3gyg_A NTD biosynthesis operon putative hydrolase NTDB; PF05116, PF08282, MCSG, PSI-2, haloacid dehalogenase-like HY structural genomics; 2.45A {Bacillus subtilis subsp} Back     alignment and structure
>2obb_A Hypothetical protein; structural genomics, PSI-2, PR structure initiative, midwest center for structural genomic unknown function; 2.20A {Bacteroides thetaiotaomicron} SCOP: c.108.1.25 Back     alignment and structure
>3qgm_A P-nitrophenyl phosphatase (PHO2); structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE; 2.00A {Archaeoglobus fulgidus} SCOP: c.108.1.0 Back     alignment and structure
>1xpj_A Hypothetical protein; structural genomics, MCSG, protein STR initiative, PSI, midwest center for structural genomics, UN function; HET: TLA; 2.30A {Vibrio cholerae} SCOP: c.108.1.18 Back     alignment and structure
>3pdw_A Uncharacterized hydrolase YUTF; structural genomics, PSI2, NYSGXRC, protein structure initia YORK SGX research center for structural genomics; 1.60A {Bacillus subtilis} SCOP: c.108.1.0 Back     alignment and structure
>2wm8_A MDP-1, magnesium-dependent phosphatase 1; haloacid dehalogenase, protein phosphatase, hydrolase, magne metal-binding; 1.75A {Homo sapiens} PDB: 1u7o_A 1u7p_A Back     alignment and structure
>3epr_A Hydrolase, haloacid dehalogenase-like family; structural genomics, unknown function, HAD superfamily hydro PSI-2; 1.55A {Streptococcus agalactiae serogroup V} SCOP: c.108.1.14 PDB: 1ys9_A 1wvi_A 1ydf_A Back     alignment and structure
>3l8h_A Putative haloacid dehalogenase-like hydrolase; HAD superfamily, GMHB, D-glycero-D-manno-heptose-1, 7-bispho phosphatase; HET: FX1; 1.68A {Bordetella bronchiseptica} Back     alignment and structure
>2oda_A Hypothetical protein pspto_2114; haloacid dehalogenase, phosphonoacetaldehyde hydrolase, protein binding; HET: EPE; 1.90A {Pseudomonas syringae PV} Back     alignment and structure
>2i33_A Acid phosphatase; HAD superfamily, hydrolase; 1.57A {Bacillus anthracis} PDB: 2i34_A Back     alignment and structure
>1k1e_A Deoxy-D-mannose-octulosonate 8-phosphate phosphat; structural genomics, KDO 8-P phosphatase, structure function project, S2F; HET: MES; 1.67A {Haemophilus influenzae RD} SCOP: c.108.1.5 PDB: 1j8d_A* Back     alignment and structure
>2p9j_A Hypothetical protein AQ2171; secsg, riken, PSI, structural GENO protein structure initiative, southeast collaboratory for S genomics; 2.40A {Aquifex aeolicus} Back     alignment and structure
>1vjr_A 4-nitrophenylphosphatase; TM1742, structural genomics, JCSG, protein structure initiative, joint center for structural G hydrolase; 2.40A {Thermotoga maritima} SCOP: c.108.1.14 PDB: 1pw5_A* Back     alignment and structure
>2pr7_A Haloacid dehalogenase/epoxide hydrolase family; NP_599989.1, uncharacterized protein, structural genomics; 1.44A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>2r8e_A 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase; YRBI, divalent metal, HAD superfamily, KDO 8-P, hydrolase; 1.40A {Escherichia coli O6} PDB: 2r8x_A 2r8y_A 2r8z_A 3hyc_A 3i6b_A* Back     alignment and structure
>2gmw_A D,D-heptose 1,7-bisphosphate phosphatase; Zn-binding protein, hydrolase; 1.50A {Escherichia coli} SCOP: c.108.1.19 PDB: 3esq_A 3esr_A 3l1u_A 3l1v_A 3l8e_A 3l8f_A 3l8g_A* Back     alignment and structure
>1zjj_A Hypothetical protein PH1952; alpha/beta hydrolase fold, HAD superfamily, structural genom riken structural genomics/proteomics initiative; 1.85A {Pyrococcus horikoshii} Back     alignment and structure
>3zvl_A Bifunctional polynucleotide phosphatase/kinase; hydrolase-transferase complex, base excision repair, BER, non-homologous END-joining, NHEJ; 1.65A {Mus musculus} PDB: 3zvm_A* 3zvn_A* 1yj5_A 3u7e_B* 3u7f_B* 3u7h_B* 3u7g_A* Back     alignment and structure
>2c4n_A Protein NAGD; nucleotide phosphatase, HAD superfamily, UMP phosphatase, carbohydrate metabolism, hydrolase; 1.8A {Escherichia coli} SCOP: c.108.1.14 Back     alignment and structure
>2oyc_A PLP phosphatase, pyridoxal phosphate phosphatase; structural genomics, NYSGXRC, NEW YORK SGX research center for structural genomics, PSI-2; 1.72A {Homo sapiens} PDB: 2p27_A 2p69_A* 2cft_A* 2cfs_A 2cfr_A* Back     alignment and structure
>3e8m_A Acylneuraminate cytidylyltransferase; 2-keto-3-deoxynononic acid 9-phosphate phosphohydrolase, nucleotidyltransferase; HET: PEG PG4 EDO PGE; 1.10A {Bacteroides thetaiotaomicron} PDB: 3e84_A 3e81_A* Back     alignment and structure
>3ib6_A Uncharacterized protein; structural genomics, unknown function, PSI-2, protein struct initiative; 2.20A {Listeria monocytogenes} Back     alignment and structure
>2b82_A APHA, class B acid phosphatase; DDDD acid phosphatase, metallo-ENZ hydrolase; HET: ADN; 1.25A {Escherichia coli} SCOP: c.108.1.12 PDB: 2b8j_A* 2hf7_A 1rmt_A* 1n9k_A 1rmq_A 1n8n_A* 1rmy_A* 2g1a_A* 3cz4_A 2heg_A* 1z5g_A 1z5u_A* 1z88_A 2aut_A Back     alignment and structure
>2fpr_A Histidine biosynthesis bifunctional protein HISB; histidinola phosphate phosphatase, bifunctional enzyme structural genomics; 1.70A {Escherichia coli} SCOP: c.108.1.19 PDB: 2fps_A 2fpu_A* 2fpx_A 2fpw_A* Back     alignment and structure
>2x4d_A HLHPP, phospholysine phosphohistidine inorganic pyrophos phosphatase; hydrolase; 1.92A {Homo sapiens} Back     alignment and structure
>2o2x_A Hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, hydrolase; 1.50A {Mesorhizobium loti} SCOP: c.108.1.19 Back     alignment and structure
>3mmz_A Putative HAD family hydrolase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 1.84A {Streptomyces avermitilis} Back     alignment and structure
>2hx1_A Predicted sugar phosphatases of the HAD superfamily; ZP_00311070.1, possible sugar phosphatase, structural genomics; HET: MSE EPE; 2.10A {Cytophaga hutchinsonii} Back     alignment and structure
>2ho4_A Haloacid dehalogenase-like hydrolase domain containing 2; HDHD2, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; 2.20A {Mus musculus} PDB: 3hlt_A Back     alignment and structure
>1yv9_A Hydrolase, haloacid dehalogenase family; hypothetical protein, struc genomics, PSI, protein structure initiative; 2.80A {Enterococcus faecalis} SCOP: c.108.1.14 Back     alignment and structure
>3n07_A 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; structural genomics, phosphatase, PSI-2, protein structure initiative; HET: MSE; 1.76A {Vibrio cholerae} Back     alignment and structure
>2i7d_A 5'(3')-deoxyribonucleotidase, cytosolic type; hydrolase; HET: DUR; 1.20A {Homo sapiens} PDB: 2jar_A* 2jao_A* Back     alignment and structure
>3n1u_A Hydrolase, HAD superfamily, subfamily III A; structural genomics, PSI-2; 1.80A {Legionella pneumophila} SCOP: c.108.1.0 Back     alignment and structure
>3mn1_A Probable YRBI family phosphatase; structural genomics, PSI, protein structure initiative, NYSG phosphatase; 1.80A {Pseudomonas syringae PV} PDB: 3nrj_A Back     alignment and structure
>3ewi_A N-acylneuraminate cytidylyltransferase; beta barrel, HAD-like, rossmannoid fold, nucleotidyltransferase, nucleus; 1.90A {Mus musculus} Back     alignment and structure
>1y8a_A Hypothetical protein AF1437; structural genomics, protein structu initiative, PSI, midwest center for structural genomics; 1.40A {Archaeoglobus fulgidus} SCOP: c.108.1.24 Back     alignment and structure
>3fvv_A Uncharacterized protein; unknown function, structural genomics, PSI,MCSG, protein STR initiative, midwest center for structural genomics; 2.10A {Bordetella pertussis} Back     alignment and structure
>3pct_A Class C acid phosphatase; hydrolase, outer membrane; 1.85A {Pasteurella multocida} Back     alignment and structure
>3ocu_A Lipoprotein E; hydrolase, outer membrane; HET: NMN; 1.35A {Haemophilus influenzae} PDB: 3ocv_A* 3ocw_A* 3ocx_A* 3ocz_A* 3ocy_A* 3sf0_A* 2hlk_A 2hll_A 3et4_A 3et5_A Back     alignment and structure
>2no4_A (S)-2-haloacid dehalogenase IVA; HAD superfamily, rossman fold, hydrol; 1.93A {Burkholderia cepacia} PDB: 2no5_A* Back     alignment and structure
>3ij5_A 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; IDP022 hydrolase, lipopolysaccharide biosynthesis, magnesium, STRU genomics; 1.95A {Yersinia pestis} Back     alignment and structure
>2hhl_A CTD small phosphatase-like protein; CTD phosphatase, keggins anion, structural genomics, PSI, protein structure initiative; HET: KEG; 2.10A {Homo sapiens} Back     alignment and structure
>4eze_A Haloacid dehalogenase-like hydrolase; magnesium binding site, enzyme function initiativ; 2.27A {Salmonella enterica subsp} Back     alignment and structure
>2ght_A Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1; protein-peptide complex, HAD superfamily, hydrolase; HET: SEP; 1.80A {Homo sapiens} PDB: 2ghq_A* 3pgl_A* 1t9z_A* 1ta0_A* 3l0c_A 3l0y_A 3l0b_A* 2q5e_A Back     alignment and structure
>3m1y_A Phosphoserine phosphatase (SERB); NYSGXRC, PSI II, phophoserine phosphatase, protein structure initiative, structural genomics; 2.40A {Helicobacter pylori} SCOP: c.108.1.0 Back     alignment and structure
>3m9l_A Hydrolase, haloacid dehalogenase-like family; HAD family hydrolase, structural genomics, PSI, protein structure initiative; HET: MSE; 1.60A {Pseudomonas fluorescens} PDB: 2ybd_A* 3r09_A* Back     alignment and structure
>3kc2_A Uncharacterized protein YKR070W; HAD-like, mitochondral protein, PSI, MCSG, structural genomi protein structure initiative; HET: MSE; 1.55A {Saccharomyces cerevisiae} PDB: 3rf6_A* Back     alignment and structure
>3um9_A Haloacid dehalogenase, type II; haloacid dehalogenase-like hydrolase protein superfamily, defluorinase, hydrolase; 2.19A {Polaromonas SP} Back     alignment and structure
>1nnl_A L-3-phosphoserine phosphatase; PSP, HPSP, phospho-aspartyl, hydrolase; 1.53A {Homo sapiens} SCOP: c.108.1.4 PDB: 1l8l_A* 1l8o_A Back     alignment and structure
>1qq5_A Protein (L-2-haloacid dehalogenase); hydrolase; 1.52A {Xanthobacter autotrophicus} SCOP: c.108.1.1 PDB: 1qq6_A* 1qq7_A* 1aq6_A Back     alignment and structure
>3umb_A Dehalogenase-like hydrolase; 2.20A {Ralstonia solanacearum} Back     alignment and structure
>1zrn_A L-2-haloacid dehalogenase; hydrolase; 1.83A {Pseudomonas SP} SCOP: c.108.1.1 PDB: 1zrm_A 1jud_A 1qh9_A Back     alignment and structure
>4as2_A Phosphorylcholine phosphatase; hydrolase, HAD superfamily, alkylammonium compounds; HET: BTB; 2.12A {Pseudomonas aeruginosa} PDB: 4as3_A* Back     alignment and structure
>2w43_A Hypothetical 2-haloalkanoic acid dehalogenase; hydrolase, metabolic process; HET: MES; 1.66A {Sulfolobus tokodaii} PDB: 2w11_A Back     alignment and structure
>3nuq_A Protein SSM1, putative nucleotide phosphatase; suppresses the 6-AU sensitivity of transcription elongation II; 1.70A {Saccharomyces cerevisiae} PDB: 3onn_A 3opx_A* Back     alignment and structure
>3skx_A Copper-exporting P-type ATPase B; P1B-ATPase, ATP binding domain, copper(II) transporter, MEMB protein, hydrolase; 1.59A {Archaeoglobus fulgidus} PDB: 3sky_A* Back     alignment and structure
>3kbb_A Phosphorylated carbohydrates phosphatase TM_1254; hydrolase, arbohydrate metabolism, COBA magnesium, manganese, metal-binding, nickel; HET: MSE GOL; 1.74A {Thermotoga maritima MSB8} Back     alignment and structure
>1rku_A Homoserine kinase; phosphoserine phosphatase, phosphoserine:homoserine phosphotransferase, THRH, phosphoserine phosphoryl donor; 1.47A {Pseudomonas aeruginosa} SCOP: c.108.1.11 PDB: 1rkv_A Back     alignment and structure
>3vay_A HAD-superfamily hydrolase; rossmann fold, haloacid dehalogenase; 1.98A {Pseudomonas syringae PV} Back     alignment and structure
>3kd3_A Phosphoserine phosphohydrolase-like protein; csgid, niaid, S genomics, national institute of allergy and infectious DISE (niaid); 1.70A {Francisella tularensis subsp} Back     alignment and structure
>3iru_A Phoshonoacetaldehyde hydrolase like protein; phosphonoacetaldehyde hydrolase like P structural genomics, PSI-2, protein structure initiative; 2.30A {Oleispira antarctica} SCOP: c.108.1.0 Back     alignment and structure
>2hcf_A Hydrolase, haloacid dehalogenase-like family; NP_662590.1, ST genomics, PSI-2, protein structure initiative; 1.80A {Chlorobaculum tepidum} SCOP: c.108.1.6 Back     alignment and structure
>3u26_A PF00702 domain protein; structural genomics, PSI-biology, northeast structural genom consortium, NESG, unknown function; 1.59A {Pyrococcus horikoshii} SCOP: c.108.1.1 PDB: 1x42_A Back     alignment and structure
>3kzx_A HAD-superfamily hydrolase, subfamily IA, variant; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ehrlich chaffeensis; 1.90A {Ehrlichia chaffeensis} Back     alignment and structure
>2fea_A 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase; 2633731, structural genomics, joint center for structural GE JCSG; HET: MSE; 2.00A {Bacillus subtilis} SCOP: c.108.1.20 Back     alignment and structure
>2pke_A Haloacid delahogenase-like family hydrolase; NP_639141.1, ST genomics, joint center for structural genomics, JCSG; 1.81A {Xanthomonas campestris PV} Back     alignment and structure
>3ddh_A Putative haloacid dehalogenase-like family hydrol; hydrolase, HAD superfamily, ST genomics, PSI-2, protein structure initiative; 2.00A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3p96_A Phosphoserine phosphatase SERB; ssgcid, structural genomics, structural genomics center for infectious disease, hydrolas; 2.05A {Mycobacterium avium} Back     alignment and structure
>1ltq_A Polynucleotide kinase; phosphatase, alpha/beta, P-loop, transferase; HET: ADP; 2.33A {Enterobacteria phage T4} SCOP: c.108.1.9 c.37.1.1 PDB: 1rc8_A* 1rpz_A* 1rrc_A* 2ia5_A Back     alignment and structure
>3d6j_A Putative haloacid dehalogenase-like hydrolase; structural genomics, PSI-2, protein structure initiative; 2.00A {Bacteroides fragilis nctc 9343} Back     alignment and structure
>2go7_A Hydrolase, haloacid dehalogenase-like family; structural genomics, joint center for structural genomics, J protein structure initiative; 2.10A {Streptococcus pneumoniae} SCOP: c.108.1.6 Back     alignment and structure
>2wf7_A Beta-PGM, beta-phosphoglucomutase; transition state analogue, haloacid dehalogenase superfamily, isomerase, phosphotransferase; HET: G7P; 1.05A {Lactococcus lactis} PDB: 1o03_A* 1z4n_A* 1z4o_A* 1zol_A 2wf5_A* 2wf6_A* 1o08_A* 2wf8_A* 2wf9_A* 2wfa_A 2whe_A 1lvh_A* 3fm9_A Back     alignment and structure
>3qle_A TIM50P; chaperone, mitochondrion, preprotein translocation; HET: 1PE; 1.83A {Saccharomyces cerevisiae EC1118} Back     alignment and structure
>1te2_A Putative phosphatase; structural genomics, phosphates, PSI, protein S initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.76A {Escherichia coli} SCOP: c.108.1.6 Back     alignment and structure
>4ex6_A ALNB; modified rossman fold, phosphatase, magnesium binding, hydro; 1.25A {Streptomyces SP} PDB: 4ex7_A Back     alignment and structure
>2fi1_A Hydrolase, haloacid dehalogenase-like family; structural genomics, haloacid dehalogenase-like F PSI, protein structure initiative; 1.40A {Streptococcus pneumoniae} SCOP: c.108.1.3 Back     alignment and structure
>2om6_A Probable phosphoserine phosphatase; rossmann fold, B-hairpin, four-helix bundle, structural GENO NPPSFA; 2.20A {Pyrococcus horikoshii} Back     alignment and structure
>3e58_A Putative beta-phosphoglucomutase; structu genomics, PSI-2, protein structure initiative, midwest CENT structural genomics; 1.86A {Streptococcus thermophilus lmg 18311} Back     alignment and structure
>3mc1_A Predicted phosphatase, HAD family; PSI2, NYSGXRC, structural genomics, protein structure initiative; 1.93A {Clostridium acetobutylicum} SCOP: c.108.1.0 Back     alignment and structure
>2fdr_A Conserved hypothetical protein; SAD, structural genomics, agrobacter tumefaciens, HAD-superfamily hydrolase; 2.00A {Agrobacterium tumefaciens str} SCOP: c.108.1.6 Back     alignment and structure
>3cnh_A Hydrolase family protein; NP_295428.1, predicted hydrolase of haloacid dehalogenase-LI superfamily; HET: MSE PG4; 1.66A {Deinococcus radiodurans R1} Back     alignment and structure
>1swv_A Phosphonoacetaldehyde hydrolase; HAD enzyme superfamily, phosphonotase, metal binding; 2.30A {Bacillus cereus} SCOP: c.108.1.3 PDB: 1sww_A 2iof_A* 2ioh_A 1rql_A 1rqn_A 2iof_K* 1rdf_A 1fez_A Back     alignment and structure
>3i28_A Epoxide hydrolase 2; aromatic hydrocarbons catabolism, detoxification, magnesium, metal-binding, peroxisome; HET: 34N; 1.95A {Homo sapiens} PDB: 1s8o_A* 1zd2_P* 1vj5_A* 1zd4_A* 1zd5_A* 3i1y_A* 1zd3_A* 3koo_A* 3otq_A* 4hai_A* 1cqz_A 1cr6_A* 1ek1_A* 1ek2_A* 3ans_A* 3ant_A* 3pdc_A* Back     alignment and structure
>3qxg_A Inorganic pyrophosphatase; hydrolase, magnesium binding site, NEW YORK research center for structural genomics; HET: TLA; 1.24A {Bacteroides thetaiotaomicron} PDB: 3qu2_A* 3qx7_A 3quq_A* 3r9k_A 3qut_A 3qu9_A* 3qu7_A 3qu5_A 3qyp_A 3quc_A 3qub_A 3qu4_A Back     alignment and structure
>1l7m_A Phosphoserine phosphatase; rossmann fold, four-helix bundle, B-hairpin, structural genomics, BSGC structure funded by NIH; 1.48A {Methanocaldococcus jannaschii} SCOP: c.108.1.4 PDB: 1f5s_A 1l7n_A 1l7p_A* 1l7o_A* 1j97_A* Back     alignment and structure
>3dv9_A Beta-phosphoglucomutase; structural genomics, APC60149, PSI- protein structure initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.72A {Bacteroides vulgatus} Back     alignment and structure
>3ed5_A YFNB; APC60080, bacillus subtilis subsp. subtilis STR. 168, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.72A {Bacillus subtilis} PDB: 3i76_A Back     alignment and structure
>3nas_A Beta-PGM, beta-phosphoglucomutase; PSI, structural genomics, protein structure initiative, NEW research center for structural genomics; 3.00A {Bacillus subtilis} Back     alignment and structure
>3a1c_A Probable copper-exporting P-type ATPase A; ATP-binding, cell membrane, copper transport, hydrolase, ION transport, magnesium, membrane; HET: ACP; 1.85A {Archaeoglobus fulgidus} PDB: 3a1d_A* 3a1e_A* 2b8e_A 2voy_J 2voy_I Back     alignment and structure
>3qnm_A Haloacid dehalogenase-like hydrolase; structural genomics, PSI-2, protein structure initiative; 1.70A {Bacteroides thetaiotaomicron} SCOP: c.108.1.0 Back     alignment and structure
>3umg_A Haloacid dehalogenase; defluorinase, hydrolase; 2.25A {Rhodococcus jostii} Back     alignment and structure
>3umc_A Haloacid dehalogenase; HY; 2.15A {Pseudomonas aeruginosa} Back     alignment and structure
>3shq_A UBLCP1; phosphatase, hydrolase; 1.96A {Drosophila melanogaster} Back     alignment and structure
>1q92_A 5(3)-deoxyribonucleotidase; alpha-beta rossman fold, hydrolase; HET: DRM; 1.40A {Homo sapiens} SCOP: c.108.1.8 PDB: 1mh9_A* 1q91_A* 1z4m_A* 1z4i_A* 1z4j_A* 1z4l_A* 1z4k_A* 1z4p_X* 1z4q_A* 2jau_A* 2jaw_A* 3u19_A* 3u13_A 4e88_A Back     alignment and structure
>2ah5_A COG0546: predicted phosphatases; MCSG, structural genomics, hydrola haloacid dehalogenase-like, PSI; 1.74A {Streptococcus pneumoniae} SCOP: c.108.1.6 Back     alignment and structure
>3l5k_A Protein GS1, haloacid dehalogenase-like hydrolase domain- containing protein 1A; HDHD1A, haloacid dehalogenase-like hydrolase domain containing 1A; 2.00A {Homo sapiens} Back     alignment and structure
>3s6j_A Hydrolase, haloacid dehalogenase-like family; structural genomics, PSI-2; 2.20A {Pseudomonas syringae PV} Back     alignment and structure
>3ef0_A RNA polymerase II subunit A C-terminal domain phosphatase; CTD, FCPH, BRCT, hydrolase, ALF4, transition state analog, cobalt, magnesium; 2.10A {Schizosaccharomyces pombe} Back     alignment and structure
>2hoq_A Putative HAD-hydrolase PH1655; haloacid dehalogenase, structural genomics, NPPSFA, national on protein structural and functional analyses; 1.70A {Pyrococcus horikoshii} Back     alignment and structure
>3smv_A S-(-)-azetidine-2-carboxylate hydrolase; haloacid dehalogenase superfamily, L-azetidine-2- carboxylate; HET: GOL; 1.38A {Pseudomonas} Back     alignment and structure
>4fe3_A Cytosolic 5'-nucleotidase 3; substrate complex, HAD-like, protein binding; HET: U5P; 1.74A {Mus musculus} PDB: 2g09_A* 2bdu_A* 2g08_A 2g06_A* 2g0a_A* 2q4t_A* 2g07_A* 2jga_A 2vkq_A 2cn1_A Back     alignment and structure
>3sd7_A Putative phosphatase; structural genomics, haloacid dehalogenase-like hydrolase, H center for structural genomics of infectious diseases; HET: PGE; 1.70A {Clostridium difficile} Back     alignment and structure
>2hdo_A Phosphoglycolate phosphatase; NP_784602.1, structur genomics, PSI-2, protein structure initiative, joint center structural genomics; HET: MSE; 1.50A {Lactobacillus plantarum} SCOP: c.108.1.6 Back     alignment and structure
>4eek_A Beta-phosphoglucomutase-related protein; hydrolase, magnesium binding site, enzyme function initiativ; 1.60A {Deinococcus radiodurans} PDB: 4eel_A* 4een_A Back     alignment and structure
>4ap9_A Phosphoserine phosphatase; hydrolase, haloacid dehalogenase superfamily, NDSB; HET: 1PS; 1.78A {Thermococcus onnurineus} PDB: 4b6j_A Back     alignment and structure
>2hi0_A Putative phosphoglycolate phosphatase; YP_619066.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.51A {Lactobacillus delbrueckii} Back     alignment and structure
>2p11_A Hypothetical protein; putative haloacid dehalogenase-like hydrolase, structural GE joint center for structural genomics, JCSG; 2.20A {Burkholderia xenovorans} Back     alignment and structure
>2b0c_A Putative phosphatase; alpha-D-glucose-1-phosphate, structural genomic protein structure initiative, midwest center for structural genomics, MCSG; HET: G1P; 2.00A {Escherichia coli} SCOP: c.108.1.2 Back     alignment and structure
>2hsz_A Novel predicted phosphatase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: UNL; 1.90A {Haemophilus somnus 129PT} SCOP: c.108.1.6 Back     alignment and structure
>2nyv_A Pgpase, PGP, phosphoglycolate phosphatase; structural genomics, PSI-2, protein structure initiative; 2.10A {Aquifex aeolicus} PDB: 2yy6_A Back     alignment and structure
>2i6x_A Hydrolase, haloacid dehalogenase-like family; HAD superfamily, struct genomics, PSI-2, protein structure initiative; HET: MSE; 2.40A {Porphyromonas gingivalis} Back     alignment and structure
>3bwv_A Putative 5'(3')-deoxyribonucleotidase; NP_764060.1, deoxyribonucleotidase-like protein; HET: MSE; 1.55A {Staphylococcus epidermidis} Back     alignment and structure
>2zg6_A Putative uncharacterized protein ST2620, probable 2-haloalkanoic; probable 2-haloalkanoic acid dehalogenase, hydrolase, structural genomics; 2.40A {Sulfolobus tokodaii} Back     alignment and structure
>4dcc_A Putative haloacid dehalogenase-like hydrolase; magnesium binding site, enzyme function initiativ; 1.65A {Bacteroides thetaiotaomicron} PDB: 4dfd_A 4f71_A 4f72_A Back     alignment and structure
>3k1z_A Haloacid dehalogenase-like hydrolase domain-conta protein 3; HDHD3, haloacid dehalogenase-like hydrolase domain containin structural genomics; 1.55A {Homo sapiens} Back     alignment and structure
>2qlt_A (DL)-glycerol-3-phosphatase 1; APC7326, RHR2P, saccharom cerevisiae, structural genomics, PSI-2, protein structure initiative; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>4gib_A Beta-phosphoglucomutase; rossmann fold, HAD-like, structural genomics, center for structural genomics of infectious DISE csgid, isomerase; 2.27A {Clostridium difficile} Back     alignment and structure
>2gfh_A Haloacid dehalogenase-like hydrolase domain conta; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 1.90A {Mus musculus} SCOP: c.108.1.6 PDB: 2w4m_A Back     alignment and structure
>4g9b_A Beta-PGM, beta-phosphoglucomutase; HAD, putative phosphoglucomutase, enzyme function initiative structural genomics, isomerase; 1.70A {Escherichia coli} Back     alignment and structure
>3rfu_A Copper efflux ATPase; alpha helical, CPC, CXXC, ATP-binding, hydrolase, ION transp magnesium, Cu+, membrane, metal-binding; 3.20A {Legionella pneumophila subsp} Back     alignment and structure
>3n28_A Phosphoserine phosphatase; HAD family hydrolase, structural genomics, PSI, protein STRU initiative, nysgrc; 2.30A {Vibrio cholerae} Back     alignment and structure
>2g80_A Protein UTR4; YEL038W, UTR4 protein (unknown transcript 4 protein), struct genomics, PSI, protein structure initiative; 2.28A {Saccharomyces cerevisiae} SCOP: c.108.1.22 Back     alignment and structure
>1yns_A E-1 enzyme; hydrolase fold; HET: HPO; 1.70A {Homo sapiens} SCOP: c.108.1.22 PDB: 1zs9_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 258
d1u02a_229 c.108.1.15 (A:) Trehalose-6-phosphate phosphatase 7e-20
d2amya1243 c.108.1.10 (A:4-246) Phosphomannomutase 2 {Human ( 5e-06
d1s2oa1244 c.108.1.10 (A:1-244) Sucrose-phosphatase Slr0953 { 2e-05
d2fuea1244 c.108.1.10 (A:13-256) Phosphomannomutase 1 {Human 2e-04
d1nf2a_267 c.108.1.10 (A:) Hypothetical protein TM0651 {Therm 2e-04
d2rbka1260 c.108.1.10 (A:2-261) Sugar-phosphate phosphatase B 8e-04
d2b30a1 283 c.108.1.10 (A:18-300) PFL1270w orthologue {Plasmod 8e-04
d1oeyj_105 d.15.2.2 (J:) Neutrophil cytosol factor 4 (p40phox 0.002
d1rkqa_ 271 c.108.1.10 (A:) Hypothetical protein YidA {Escheri 0.002
d1l6ra_225 c.108.1.10 (A:) Phosphoglycolate phosphatase, PGPa 0.003
d1xvia_232 c.108.1.10 (A:) Putative mannosyl-3-phosphoglycera 0.004
>d1u02a_ c.108.1.15 (A:) Trehalose-6-phosphate phosphatase related protein {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 229 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: HAD-like
superfamily: HAD-like
family: Trehalose-phosphatase
domain: Trehalose-6-phosphate phosphatase related protein
species: Archaeon Thermoplasma acidophilum [TaxId: 2303]

 Score = 83.1 bits (204), Expect = 7e-20
 Identities = 34/159 (21%), Positives = 64/159 (40%), Gaps = 20/159 (12%)

Query: 91  VFLDYDGTLSPIVDDPNRAFMSDEMRAAVREVAKYFPTAIVSGRSREKVKEFVELSNVYY 150
           +FLDYDGTL PI+ +P  ++    + + + ++ + F T IV+GRS E++  F+ L ++  
Sbjct: 3   IFLDYDGTLVPIIMNPEESYADAGLLSLISDLKERFDTYIVTGRSPEEISRFLPL-DINM 61

Query: 151 AGSHGMDIQAPPRPVKACEGKYHTLVPGKKGNEVLFQPAKKFLPAIQEIIKELEEETKKI 210
              HG                         G  V    + +FL     I ++        
Sbjct: 62  ICYHGA-------------------CSKINGQIVYNNGSDRFLGVFDRIYEDTRSWVSDF 102

Query: 211 QGARIEDNRFCISVHFRQVREEDYSVLQEKVKAVLRNYP 249
            G RI      +  H   +  +    L+ +++ + R + 
Sbjct: 103 PGLRIYRKNLAVLYHLGLMGADMKPKLRSRIEEIARIFG 141
>d2amya1 c.108.1.10 (A:4-246) Phosphomannomutase 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 243 Back     information, alignment and structure
>d1s2oa1 c.108.1.10 (A:1-244) Sucrose-phosphatase Slr0953 {Synechocystis sp. pcc 6803 [TaxId: 1148]} Length = 244 Back     information, alignment and structure
>d2fuea1 c.108.1.10 (A:13-256) Phosphomannomutase 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 244 Back     information, alignment and structure
>d1nf2a_ c.108.1.10 (A:) Hypothetical protein TM0651 {Thermotoga maritima [TaxId: 2336]} Length = 267 Back     information, alignment and structure
>d2rbka1 c.108.1.10 (A:2-261) Sugar-phosphate phosphatase BT4131 {Bacteroides thetaiotaomicron [TaxId: 818]} Length = 260 Back     information, alignment and structure
>d2b30a1 c.108.1.10 (A:18-300) PFL1270w orthologue {Plasmodium vivax [TaxId: 5855]} Length = 283 Back     information, alignment and structure
>d1oeyj_ d.15.2.2 (J:) Neutrophil cytosol factor 4 (p40phox component of NADPH oxidase) {Human (Homo sapiens) [TaxId: 9606]} Length = 105 Back     information, alignment and structure
>d1rkqa_ c.108.1.10 (A:) Hypothetical protein YidA {Escherichia coli [TaxId: 562]} Length = 271 Back     information, alignment and structure
>d1l6ra_ c.108.1.10 (A:) Phosphoglycolate phosphatase, PGPase {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 225 Back     information, alignment and structure
>d1xvia_ c.108.1.10 (A:) Putative mannosyl-3-phosphoglycerate phosphatase MPGP (YedP) {Escherichia coli [TaxId: 562]} Length = 232 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query258
d1u02a_229 Trehalose-6-phosphate phosphatase related protein 99.77
d1xvia_232 Putative mannosyl-3-phosphoglycerate phosphatase M 99.08
d1nf2a_267 Hypothetical protein TM0651 {Thermotoga maritima [ 99.05
d1rkqa_271 Hypothetical protein YidA {Escherichia coli [TaxId 99.02
d1wr8a_230 Phosphoglycolate phosphatase, PGPase {Pyrococcus h 99.01
d1nrwa_ 285 Hypothetical protein YwpJ {Bacillus subtilis [TaxI 99.0
d2rbka1260 Sugar-phosphate phosphatase BT4131 {Bacteroides th 98.99
d1rlma_269 Sugar phosphatase SupH (YbiV) {Escherichia coli [T 98.99
d1wzca1243 Putative mannosyl-3-phosphoglycerate phosphatase M 98.92
d2amya1243 Phosphomannomutase 2 {Human (Homo sapiens) [TaxId: 98.89
d2b30a1283 PFL1270w orthologue {Plasmodium vivax [TaxId: 5855 98.89
d1s2oa1244 Sucrose-phosphatase Slr0953 {Synechocystis sp. pcc 98.85
d1l6ra_225 Phosphoglycolate phosphatase, PGPase {Archaeon The 98.77
d2fuea1244 Phosphomannomutase 1 {Human (Homo sapiens) [TaxId: 98.66
d1ltqa1149 Polynucleotide kinase, phosphatase domain {Bacteri 98.24
d2obba1122 Hypothetical protein BT0820 {Bacteroides thetaiota 97.59
d1xpja_124 Hypothetical protein VC0232 {Vibrio cholerae [TaxI 97.55
d2fpwa1161 Histidine biosynthesis bifunctional protein HisB, 97.54
d1yj5a1195 5' polynucleotide kinase-3' phosphatase, middle do 97.43
d1u7pa_164 Magnesium-dependent phosphatase-1, Mdp1 {Mouse (Mu 97.38
d2gmwa1182 D,D-heptose 1,7-bisphosphate phosphatase GmhB {Esc 97.28
d2o2xa1209 Hypothetical protein Mll2559 {Mesorhizobium loti [ 97.2
d2c4na1250 NagD {Escherichia coli [TaxId: 562]} 96.94
d1yv9a1253 Putative hydrolase EF1188 {Enterococcus faecalis [ 96.94
d1vjra_261 Hypothetical protein TM1742 {Thermotoga maritima [ 96.86
d1rkua_206 Homoserine kinase ThrH {Pseudomonas aeruginosa [Ta 96.84
d2feaa1226 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate 96.62
d1wvia_253 Putative phosphatase SMU.1415c {Streptococcus muta 96.44
d2hdoa1207 Phosphoglycolate phosphatase {Lactobacillus planta 96.2
d2hcfa1228 Hypothetical protein CT1708 {Chlorobium tepidum [T 96.17
d2hsza1224 Phosphoglycolate phosphatase Gph {Haemophilus somn 95.83
d1te2a_218 Phosphatase YniC {Escherichia coli [TaxId: 562]} 95.77
d1swva_257 Phosphonoacetaldehyde hydrolase {Bacillus cereus [ 95.5
d1nnla_217 Phosphoserine phosphatase {Human (Homo sapiens) [T 95.5
d2go7a1204 Hypothetical protein SP2064 {Streptococcus pneumon 95.38
d2gfha1247 N-acylneuraminate-9-phosphatase NANP {Mouse (Mus m 95.24
d1j97a_210 Phosphoserine phosphatase {Archaeon Methanococcus 94.81
d1zs9a1253 E-1 enzyme {Human(Homo sapiens) [TaxId: 9606]} 94.57
d2fi1a1187 Putative hydrolase SP0805 {Streptococcus pneumonia 94.56
d2ah5a1210 predicted phosphatase SP0104 {Streptococcus pneumo 94.51
d2b82a1209 Class B acid phosphatase, AphA {Escherichia coli [ 93.88
d1ta0a_181 Carboxy-terminal domain RNA polymerase II polypept 93.63
d1k1ea_177 Probable phosphatase YrbI {Haemophilus influenzae, 92.64
d2b8ea1135 Cation-transporting ATPase {Archaeon Archaeoglobus 90.58
d1q92a_195 5'(3')-deoxyribonucleotidase (dNT-2) {Human (Homo 90.3
d2bdua1291 Cytosolic 5'-nucleotidase III {Mouse (Mus musculus 90.18
d2g80a1225 Protein UTR4 {Baker's yeast (Saccharomyces cerevis 90.07
d1qq5a_245 L-2-Haloacid dehalogenase, HAD {Xanthobacter autot 88.3
d1o08a_221 beta-Phosphoglucomutase {Lactococcus lactis [TaxId 86.79
d2b0ca1197 Putative phosphatase YihX {Escherichia coli [TaxId 86.65
d1cr6a1222 Epoxide hydrolase, N-terminal domain {Mouse (Mus m 85.78
d1zrna_220 L-2-Haloacid dehalogenase, HAD {Pseudomonas sp., s 85.63
d1wpga2168 Calcium ATPase, catalytic domain P {Rabbit (Orycto 85.32
d1x42a1230 Hypothetical protein PH0459 {Archaeon Pyrococcus h 85.05
d2fdra1222 Hypothetical protein Atu0790 {Agrobacterium tumefa 85.0
d1zd3a1225 Epoxide hydrolase, N-terminal domain {Human (Homo 82.81
>d1u02a_ c.108.1.15 (A:) Trehalose-6-phosphate phosphatase related protein {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: HAD-like
superfamily: HAD-like
family: Trehalose-phosphatase
domain: Trehalose-6-phosphate phosphatase related protein
species: Archaeon Thermoplasma acidophilum [TaxId: 2303]

Probab=99.77  E-value=1.2e-18  Score=144.40  Aligned_cols=147  Identities=24%  Similarity=0.429  Sum_probs=122.1

Q ss_pred             EEEEecCCccCCCCCCCCCccCCHHHHHHHHHHHhhCCEEEEecCChhhHHHHhcccCceEEccCCccccCCCCCCcccc
Q 036329           90 AVFLDYDGTLSPIVDDPNRAFMSDEMRAAVREVAKYFPTAIVSGRSREKVKEFVELSNVYYAGSHGMDIQAPPRPVKACE  169 (258)
Q Consensus        90 ll~lD~DGTL~~~~~~p~~~~~~~~~~~aL~~L~~~~~V~IvSGR~~~~l~~~~~~~~l~lig~hG~~i~~p~g~~~~~W  169 (258)
                      |||||+||||+++..+|+...++++++++|++|++...|+|+|||+...+...++. ..+++|+||+.+..++...   +
T Consensus         2 Li~~DlDGTL~~~~~~~~~~~i~~~~~~~l~~l~~~~~v~i~TGR~~~~l~~~~~~-~~~~~~~ng~~~~~~~~~~---~   77 (229)
T d1u02a_           2 LIFLDYDGTLVPIIMNPEESYADAGLLSLISDLKERFDTYIVTGRSPEEISRFLPL-DINMICYHGACSKINGQIV---Y   77 (229)
T ss_dssp             EEEEECBTTTBCCCSCGGGCCCCHHHHHHHHHHHHHSEEEEECSSCHHHHHHHSCS-SCEEEEGGGTEEEETTEEE---E
T ss_pred             EEEEEecCCCCCCCCChhhCCCCHHHHHHHHHHhhCCCEEEEcCCCHHHhhhhcCc-cccEEecCeEEEecCCcee---e
Confidence            79999999999999889999999999999999998888999999999999887764 3468999999887654421   1


Q ss_pred             CccccccCCCCCCcccccccccCchHHHHHHHHHHHHHhccCceEEEecCceEEEEcCCCChhcHHHHHHHHHHHHhhCC
Q 036329          170 GKYHTLVPGKKGNEVLFQPAKKFLPAIQEIIKELEEETKKIQGARIEDNRFCISVHFRQVREEDYSVLQEKVKAVLRNYP  249 (258)
Q Consensus       170 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~~L~~~~~r~pGs~VE~K~~sla~HYR~a~~~~~~~~~~~~~~~l~~~p  249 (258)
                                      ..+......+++++.+.+.......+|...+.+.+++.+||+.............+..++..++
T Consensus        78 ----------------~~~~~~~~~~~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~  141 (229)
T d1u02a_          78 ----------------NNGSDRFLGVFDRIYEDTRSWVSDFPGLRIYRKNLAVLYHLGLMGADMKPKLRSRIEEIARIFG  141 (229)
T ss_dssp             ----------------CTTGGGGHHHHHHHHHHHTTHHHHSTTCEEEEETTEEEEECTTSCSTTHHHHHHHHHHHHHHHT
T ss_pred             ----------------ecchhhhHHHHHHHHHHhHHhhcccCCceecccccceeeeehhhhhhhHHHHHHHHHHHhhcCC
Confidence                            1223345678899999999999999999999999999999999998887888888888877754


Q ss_pred             CcEEeCCC
Q 036329          250 DFDLSEGK  257 (258)
Q Consensus       250 ~l~l~~GK  257 (258)
                       +.+..|.
T Consensus       142 -~~~~~~~  148 (229)
T d1u02a_         142 -VETYYGK  148 (229)
T ss_dssp             -CEEEECS
T ss_pred             -eEEEeec
Confidence             5555553
>d1xvia_ c.108.1.10 (A:) Putative mannosyl-3-phosphoglycerate phosphatase MPGP (YedP) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nf2a_ c.108.1.10 (A:) Hypothetical protein TM0651 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1rkqa_ c.108.1.10 (A:) Hypothetical protein YidA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wr8a_ c.108.1.10 (A:) Phosphoglycolate phosphatase, PGPase {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1nrwa_ c.108.1.10 (A:) Hypothetical protein YwpJ {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2rbka1 c.108.1.10 (A:2-261) Sugar-phosphate phosphatase BT4131 {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d1rlma_ c.108.1.10 (A:) Sugar phosphatase SupH (YbiV) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wzca1 c.108.1.10 (A:1-243) Putative mannosyl-3-phosphoglycerate phosphatase MPGP (YedP) {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2amya1 c.108.1.10 (A:4-246) Phosphomannomutase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b30a1 c.108.1.10 (A:18-300) PFL1270w orthologue {Plasmodium vivax [TaxId: 5855]} Back     information, alignment and structure
>d1s2oa1 c.108.1.10 (A:1-244) Sucrose-phosphatase Slr0953 {Synechocystis sp. pcc 6803 [TaxId: 1148]} Back     information, alignment and structure
>d1l6ra_ c.108.1.10 (A:) Phosphoglycolate phosphatase, PGPase {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d2fuea1 c.108.1.10 (A:13-256) Phosphomannomutase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ltqa1 c.108.1.9 (A:153-301) Polynucleotide kinase, phosphatase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d2obba1 c.108.1.25 (A:1-122) Hypothetical protein BT0820 {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d1xpja_ c.108.1.18 (A:) Hypothetical protein VC0232 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d2fpwa1 c.108.1.19 (A:3-163) Histidine biosynthesis bifunctional protein HisB, phosphatase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yj5a1 c.108.1.9 (A:144-338) 5' polynucleotide kinase-3' phosphatase, middle domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1u7pa_ c.108.1.17 (A:) Magnesium-dependent phosphatase-1, Mdp1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2gmwa1 c.108.1.19 (A:24-205) D,D-heptose 1,7-bisphosphate phosphatase GmhB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2o2xa1 c.108.1.19 (A:8-216) Hypothetical protein Mll2559 {Mesorhizobium loti [TaxId: 381]} Back     information, alignment and structure
>d2c4na1 c.108.1.14 (A:1-250) NagD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yv9a1 c.108.1.14 (A:4-256) Putative hydrolase EF1188 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1vjra_ c.108.1.14 (A:) Hypothetical protein TM1742 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1rkua_ c.108.1.11 (A:) Homoserine kinase ThrH {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2feaa1 c.108.1.20 (A:2-227) 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase MtnX {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1wvia_ c.108.1.14 (A:) Putative phosphatase SMU.1415c {Streptococcus mutans [TaxId: 1309]} Back     information, alignment and structure
>d2hdoa1 c.108.1.6 (A:1-207) Phosphoglycolate phosphatase {Lactobacillus plantarum [TaxId: 1590]} Back     information, alignment and structure
>d2hcfa1 c.108.1.6 (A:2-229) Hypothetical protein CT1708 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d2hsza1 c.108.1.6 (A:1-224) Phosphoglycolate phosphatase Gph {Haemophilus somnus [TaxId: 731]} Back     information, alignment and structure
>d1te2a_ c.108.1.6 (A:) Phosphatase YniC {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1swva_ c.108.1.3 (A:) Phosphonoacetaldehyde hydrolase {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1nnla_ c.108.1.4 (A:) Phosphoserine phosphatase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2go7a1 c.108.1.6 (A:3-206) Hypothetical protein SP2064 {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d2gfha1 c.108.1.6 (A:1-247) N-acylneuraminate-9-phosphatase NANP {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1j97a_ c.108.1.4 (A:) Phosphoserine phosphatase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1zs9a1 c.108.1.22 (A:4-256) E-1 enzyme {Human(Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fi1a1 c.108.1.3 (A:4-190) Putative hydrolase SP0805 {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d2ah5a1 c.108.1.6 (A:1-210) predicted phosphatase SP0104 {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d2b82a1 c.108.1.12 (A:4-212) Class B acid phosphatase, AphA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ta0a_ c.108.1.16 (A:) Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1, NRAMP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k1ea_ c.108.1.5 (A:) Probable phosphatase YrbI {Haemophilus influenzae, HI1679 [TaxId: 727]} Back     information, alignment and structure
>d2b8ea1 c.108.1.7 (A:416-434,A:548-663) Cation-transporting ATPase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1q92a_ c.108.1.8 (A:) 5'(3')-deoxyribonucleotidase (dNT-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bdua1 c.108.1.21 (A:7-297) Cytosolic 5'-nucleotidase III {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2g80a1 c.108.1.22 (A:17-241) Protein UTR4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qq5a_ c.108.1.1 (A:) L-2-Haloacid dehalogenase, HAD {Xanthobacter autotrophicus [TaxId: 280]} Back     information, alignment and structure
>d1o08a_ c.108.1.6 (A:) beta-Phosphoglucomutase {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d2b0ca1 c.108.1.2 (A:8-204) Putative phosphatase YihX {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1cr6a1 c.108.1.2 (A:4-225) Epoxide hydrolase, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zrna_ c.108.1.1 (A:) L-2-Haloacid dehalogenase, HAD {Pseudomonas sp., strain YL [TaxId: 306]} Back     information, alignment and structure
>d1wpga2 c.108.1.7 (A:344-360,A:600-750) Calcium ATPase, catalytic domain P {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1x42a1 c.108.1.1 (A:1-230) Hypothetical protein PH0459 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2fdra1 c.108.1.6 (A:3-224) Hypothetical protein Atu0790 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1zd3a1 c.108.1.2 (A:2-224) Epoxide hydrolase, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure