Citrus Sinensis ID: 036391

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------39
MSKKIPLDIIADIFCRQPVKSLLRFRCVSKTCCSLIDSQDFIKLHLNHSITTRSNRRLILKAAYFLTLTLGIGVQPHHHPLNIGSGTEVLGSCNGLIALCNSVQELALFNPSTRKLKTLPLPPCFVGFPSAFIFYGFGQDKSNDDYKLVRVLHFKGNDGEDVEVEVEVYSLKINSWRRISNLPRFLRDFYDYLYHSLFRKGYGVLAGGALHWVSPKSSTRSVIMAFNLVAKEFYQLPLPDSVNVSYANVHVDVGSLEGCLCVFCFYNLVYVDMWMMKEHAVKESWTKLISVQEPTPTRSFLFLRPLGYSRNGVKLLLEVRREKLVWFDLETNSLRTVKIDTHGLDFVDTEICMASLVPLSDAGGGCGGGINGMKRRNLEEKEKIHKKKR
ccccccHHHHHHHHHcccccccEEEEEcccccHHHcccHHHHHHHHccccccccccEEEEEEcccccccccccccccccccccccccEEEEEEccEEEEEEccccEEEEccccccEEEcccccccccccccEEEEEEEEEcccccEEEEEEEEEEcccccccEEEEEEEEcccccEEEEcccccccccccccccccccccccEEEEcccEEEEEEccccccEEEEEEccccEEEEEccccccccccccEEEEEEEEccEEEEEEEEcccEEEEEEEEEccccccEEEEEEEccccccccccccEEEEEEEcccEEEEEEEccEEEEEEccccEEEEEEEcccccccEEEEEEEccccccccccccccccccccccccHHHHHHHHHccc
ccccccHHHHHHHHHHccHHHHHHHHHHHHHHHHHHcccHHHHHHHHHccccccEEEEEEEcccccccccccccccccccccccccEEEEEcccEEEEEEcccccEEEEccccccEEEEccccccccccccEEEEEEEEccccccEEEEEEEEEccccccccEEEEEEEEcccccEEEEEcccccccccccccccccccccccEEEEEEEEEEEEccccccEEEEEEcccccccccccccccccccccEEEEEEEEccEEEEEEEccccEEEEEEEEcccccEEEEEEEEEccccccccccEEEEEEEEEcccEEEEEEcccEEEEEEccccEEEEEEEcccccccccEEEEEccEEEccccccccccccccHHHHHHHHHHHHHHccc
MSKKIPLDIIADIFCRqpvksllrfrcvsktccslidsqDFIKLHLNHSITTRSNRRLILKAAYFLTLTlgigvqphhhplnigsgtevlGSCNGLIALCNSVQelalfnpstrklktlplppcfvgfpsafifygfgqdksnddyKLVRVLHfkgndgedvEVEVEVYSLKINSWRRISNLPRFLRDFYDYLYHSLFRKgygvlaggalhwvspksstrSVIMAFNLVAKefyqlplpdsvnvsyANVHvdvgslegclCVFCFYNLVYVDMWMMKEHAVKESWTKLIsvqeptptrsflflrplgysrnGVKLLLEVRREKLVWFDletnslrtvkidthgldfvdtEICMaslvplsdagggcgggingmkrrnLEEKEKIHKKKR
mskkipldiiadifcrqpVKSLLRFRCVSKTCCSLIDSQDFIKLHLNHSITTRSNRRLILKAAYFLTLTLGIGVQPHHHPLNIGSGTEVLGSCNGLIALCNSVQELALFNPSTRKLKTLPLPPCFVGFPSAFIFYGFGQDKSNDDYKLVRVLHfkgndgedvevEVEVYSlkinswrrisnlpRFLRDFYDYLYHSLFRKGYGVLAGGALHWVSPKSSTRSVIMAFNLVAKEFYQLPLPDSVNVSYANVHVDVGSLEGCLCVFCFYNLVYVDMWMMKEHAVKESWTKLISvqeptptrsflflrplgysrNGVKLLLEVRREKLVwfdletnslrtvkidtHGLDFVDTEICMASLvplsdagggcgggingmkrrnleekekihkkkr
MSKKIPLDIIADIFCRQPVKSLLRFRCVSKTCCSLIDSQDFIKLHLNHSITTRSNRRLILKAAYFLTLTLGIGVQPHHHPLNIGSGTEVLGSCNGLIALCNSVQELALFNPSTRKLKTLPLPPCFVGFPSAFIFYGFGQDKSNDDYKLVRVLHFKGNDGedvevevevYSLKINSWRRISNLPRFLRDFYDYLYHSLFRKGYGVLAGGALHWVSPKSSTRSVIMAFNLVAKEFYQLPLPDSVNVSYANVHVDVGSLEGCLCVFCFYNLVYVDMWMMKEHAVKESWTKLISVQEPTPTRSFLFLRPLGYSRNGVKLLLEVRREKLVWFDLETNSLRTVKIDTHGLDFVDTEICMASLVPLSDAgggcgggingMKRRNLEEKEKIHKKKR
****IPLDIIADIFCRQPVKSLLRFRCVSKTCCSLIDSQDFIKLHLNHSITTRSNRRLILKAAYFLTLTLGIGVQPHHHPLNIGSGTEVLGSCNGLIALCNSVQELALFNPSTRKLKTLPLPPCFVGFPSAFIFYGFGQDKSNDDYKLVRVLHFKGNDGEDVEVEVEVYSLKINSWRRISNLPRFLRDFYDYLYHSLFRKGYGVLAGGALHWVSPKSSTRSVIMAFNLVAKEFYQLPLPDSVNVSYANVHVDVGSLEGCLCVFCFYNLVYVDMWMMKEHAVKESWTKLISVQEPTPTRSFLFLRPLGYSRNGVKLLLEVRREKLVWFDLETNSLRTVKIDTHGLDFVDTEICMASLVPLSDAGGGCGGGI*******************
MSKKIPLDIIADIFCRQPVKSLLRFRCVSKTCCSLIDSQDFIKLHLNHSITTRSNRRLILKAAYFLTLTLGIGVQPHHHPLNIGSGTEVLGSCNGLIALCNSVQELALFNPSTRKLKTLPLPPCFVGFPSAFIFYGFGQDKSNDDYKLVRVLHFKGNDGEDVEVEVEVYSLKINSWRRISNLPRFLRDFYDYLYHSLFRKGYGVLAGGALHWVSPKSSTRSVIMAFNLVAKEFYQLPLPDSVNVSYANVHVDVGSLEGCLCVFCFYNLVYVDMWMMKEHAVKESWTKLISVQEPTPTRSFLFLRPLGYSRNGVKLLLEVRREKLVWFDLETNSLRTVKIDTHGLDFVDTEICMASLVPLSD****************************
MSKKIPLDIIADIFCRQPVKSLLRFRCVSKTCCSLIDSQDFIKLHLNHSITTRSNRRLILKAAYFLTLTLGIGVQPHHHPLNIGSGTEVLGSCNGLIALCNSVQELALFNPSTRKLKTLPLPPCFVGFPSAFIFYGFGQDKSNDDYKLVRVLHFKGNDGEDVEVEVEVYSLKINSWRRISNLPRFLRDFYDYLYHSLFRKGYGVLAGGALHWVSPKSSTRSVIMAFNLVAKEFYQLPLPDSVNVSYANVHVDVGSLEGCLCVFCFYNLVYVDMWMMKEHAVKESWTKLISVQEPTPTRSFLFLRPLGYSRNGVKLLLEVRREKLVWFDLETNSLRTVKIDTHGLDFVDTEICMASLVPLSDAGGGCGGGINGMKRRNLE**********
**KKIPLDIIADIFCRQPVKSLLRFRCVSKTCCSLIDSQDFIKLHLNHSITTRSNRRLILKAAYFLTLTLGIGVQPHHHPLNIGSGTEVLGSCNGLIALCNSVQELALFNPSTRKLKTLPLPPCFVGFPSAFIFYGFGQDKSNDDYKLVRVLHFKGNDGEDVEVEVEVYSLKINSWRRISNLPRFLRDFYDYLYHSLFRKGYGVLAGGALHWVSPKSSTRSVIMAFNLVAKEFYQLPLPDSVNVSYANVHVDVGSLEGCLCVFCFYNLVYVDMWMMKEHAVKESWTKLISVQEPTPTRSFLFLRPLGYSRNGVKLLLEVRREKLVWFDLETNSLRTVKIDTHGLDFVDTEICMASLVPLSD****************************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSKKIPLDIIADIFCRQPVKSLLRFRCVSKTCCSLIDSQDFIKLHLNHSITTRSNRRLILKAAYFLTLTLGIGVQPHHHPLNIGSGTEVLGSCNGLIALCNSVQELALFNPSTRKLKTLPLPPCFVGFPSAFIFYGFGQDKSNDDYKLVRVLHFKGNDGEDVEVEVEVYSLKINSWRRISNLPRFLRDFYDYLYHSLFRKGYGVLAGGALHWVSPKSSTRSVIMAFNLVAKEFYQLPLPDSVNVSYANVHVDVGSLEGCLCVFCFYNLVYVDMWMMKEHAVKESWTKLISVQEPTPTRSFLFLRPLGYSRNGVKLLLEVRREKLVWFDLETNSLRTVKIDTHGLDFVDTEICMASLVPLSDAGGGCGGGINGMKRRNLEEKEKIHKKKR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query389 2.2.26 [Sep-21-2011]
Q9SU30413 F-box protein CPR30 OS=Ar yes no 0.956 0.900 0.402 2e-81
Q9SUY0402 F-box protein At4g22390 O no no 0.912 0.883 0.382 7e-62
Q8GXC7427 F-box/kelch-repeat protei no no 0.807 0.735 0.311 6e-34
Q9LIR8364 F-box/kelch-repeat protei no no 0.755 0.807 0.288 1e-23
Q9SFC7417 F-box protein At3g07870 O no no 0.712 0.664 0.28 2e-21
Q9LPW2416 Putative F-box/kelch-repe no no 0.665 0.622 0.227 2e-13
Q3E7D1403 F-box protein At2g40925 O no no 0.827 0.799 0.243 2e-13
Q9FGS3357 Putative F-box protein At no no 0.735 0.801 0.234 4e-13
Q9LU24360 Putative F-box protein At no no 0.542 0.586 0.296 1e-12
Q2V414436 F-box/LRR-repeat protein no no 0.812 0.724 0.255 1e-12
>sp|Q9SU30|CPR30_ARATH F-box protein CPR30 OS=Arabidopsis thaliana GN=CPR30 PE=1 SV=2 Back     alignment and function desciption
 Score =  302 bits (774), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 162/402 (40%), Positives = 248/402 (61%), Gaps = 30/402 (7%)

Query: 5   IPLDIIADIFCRQPVKSLLRFRCVSKTCCSLIDSQDFIKLHLNHSITTRSNRRLILKAA- 63
           IP+DI+ DIF R P K+L+R R +SK C  LI+  DFI+ HL+  + T  +  ++L+ A 
Sbjct: 4   IPMDIVNDIFLRLPAKTLVRCRALSKPCYHLINDPDFIESHLHRVLQTGDHLMILLRGAL 63

Query: 64  --YFLTLTLGIGVQPHHHPLNIGSGTEVLGSCNGLIALCNSVQELALFNPSTRKLKTLPL 121
             Y + L     V    HP+  G  TEV GS NGLI L NS  +LA+FNPSTR++  LP 
Sbjct: 64  RLYSVDLDSLDSVSDVEHPMKRGGPTEVFGSSNGLIGLSNSPTDLAVFNPSTRQIHRLP- 122

Query: 122 PPCFVGFPSA-----FIFYGFGQDKSNDDYKLVRVLHFKGNDGEDV----EVEVEVYSLK 172
            P  +  P       ++FYG G D  +DDYK+VR++ FK +  +++      EV+V+SLK
Sbjct: 123 -PSSIDLPDGSSTRGYVFYGLGYDSVSDDYKVVRMVQFKIDSEDELGCSFPYEVKVFSLK 181

Query: 173 INSWRRISNLPRFLRDFYDYLYHSLFRKGYGVLAGGALHWVSPKSSTRSVIMAFNLVAK- 231
            NSW+RI ++   ++  + + YH L+R+GYGVLAG +LHWV P+   R  ++AFNL+ + 
Sbjct: 182 KNSWKRIESVASSIQLLFYFYYHLLYRRGYGVLAGNSLHWVLPR---RPGLIAFNLIVRF 238

Query: 232 -----EFYQLPLPDSVNVSYANVHVDVGSLEGCLCVFCFYNLVYVDMWMMKEHAVKESWT 286
                EF  +  P++V     ++ +D+G L+GCLC+ C Y+  YVD+WMMKE+ V++SWT
Sbjct: 239 DLALEEFEIVRFPEAVANGNVDIQMDIGVLDGCLCLMCNYDQSYVDVWMMKEYNVRDSWT 298

Query: 287 KLISVQEPTPTRSFLFLRPLGYSRNGVKLLLEVRREKLVWFDLETNSLRTVKIDTHGLDF 346
           K+ +VQ+P   +SF ++RPL YS++  K+LLE+   KLVWFDLE+  + T++I      +
Sbjct: 299 KVFTVQKPKSVKSFSYMRPLVYSKDKKKVLLELNNTKLVWFDLESKKMSTLRIKDCPSSY 358

Query: 347 VDTEICMASLVPLSDAGGGCGGGINGMKRRNLEEKEKIHKKK 388
              E+ ++SLV       GC G +N +K R  ++ ++  + K
Sbjct: 359 -SAELVVSSLVL------GCKGDLNNIKYRKEQQAKEAREAK 393
Component of SCF(ASK-cullin-F-box) E3 ubiquitin ligase complexes, which may mediate the ubiquitination and subsequent proteasomal degradation of target proteins (By similarity). Regulates negatively both salicylic acid (SA)-dependent and SA-independent defense signaling.
Arabidopsis thaliana (taxid: 3702)
>sp|Q9SUY0|FB244_ARATH F-box protein At4g22390 OS=Arabidopsis thaliana GN=At4g22390 PE=2 SV=3 Back     alignment and function description
>sp|Q8GXC7|FBK50_ARATH F-box/kelch-repeat protein At3g06240 OS=Arabidopsis thaliana GN=At3g06240 PE=2 SV=1 Back     alignment and function description
>sp|Q9LIR8|FBK67_ARATH F-box/kelch-repeat protein At3g23880 OS=Arabidopsis thaliana GN=At3g23880 PE=2 SV=1 Back     alignment and function description
>sp|Q9SFC7|FB135_ARATH F-box protein At3g07870 OS=Arabidopsis thaliana GN=At3g07870 PE=2 SV=1 Back     alignment and function description
>sp|Q9LPW2|FBK2_ARATH Putative F-box/kelch-repeat protein At1g12870 OS=Arabidopsis thaliana GN=At1g12870 PE=4 SV=2 Back     alignment and function description
>sp|Q3E7D1|FB131_ARATH F-box protein At2g40925 OS=Arabidopsis thaliana GN=At2g40925 PE=2 SV=1 Back     alignment and function description
>sp|Q9FGS3|FB287_ARATH Putative F-box protein At5g50220 OS=Arabidopsis thaliana GN=At5g50220 PE=4 SV=1 Back     alignment and function description
>sp|Q9LU24|FB145_ARATH Putative F-box protein At3g16210 OS=Arabidopsis thaliana GN=At3g16210 PE=4 SV=1 Back     alignment and function description
>sp|Q2V414|FBL37_ARATH F-box/LRR-repeat protein At2g40920 OS=Arabidopsis thaliana GN=At2g40920 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query389
30682162413 F-box protein CPR30 [Arabidopsis thalian 0.956 0.900 0.402 2e-79
110738553413 hypothetical protein [Arabidopsis thalia 0.956 0.900 0.402 2e-79
4725955408 putative protein [Arabidopsis thaliana] 0.956 0.911 0.402 2e-79
224137296419 predicted protein [Populus trichocarpa] 0.966 0.897 0.433 2e-79
255583935395 conserved hypothetical protein [Ricinus 0.966 0.951 0.451 2e-78
297809553414 F-box family protein [Arabidopsis lyrata 0.956 0.898 0.394 3e-76
224089631400 predicted protein [Populus trichocarpa] 0.961 0.935 0.421 1e-75
297799772406 hypothetical protein ARALYDRAFT_329378 [ 0.953 0.913 0.403 7e-75
224053103408 predicted protein [Populus trichocarpa] 0.953 0.909 0.423 8e-70
255583943389 ubiquitin-protein ligase, putative [Rici 0.930 0.930 0.403 3e-67
>gi|30682162|ref|NP_192993.2| F-box protein CPR30 [Arabidopsis thaliana] gi|145333023|ref|NP_001078377.1| F-box protein CPR30 [Arabidopsis thaliana] gi|142989747|sp|Q9SU30.2|CPR30_ARATH RecName: Full=F-box protein CPR30; AltName: Full=Protein CONSTITUTIVE EXPRESSER OF PR GENES 30 gi|332657747|gb|AEE83147.1| F-box protein CPR30 [Arabidopsis thaliana] gi|332657748|gb|AEE83148.1| F-box protein CPR30 [Arabidopsis thaliana] Back     alignment and taxonomy information
 Score =  302 bits (774), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 162/402 (40%), Positives = 248/402 (61%), Gaps = 30/402 (7%)

Query: 5   IPLDIIADIFCRQPVKSLLRFRCVSKTCCSLIDSQDFIKLHLNHSITTRSNRRLILKAA- 63
           IP+DI+ DIF R P K+L+R R +SK C  LI+  DFI+ HL+  + T  +  ++L+ A 
Sbjct: 4   IPMDIVNDIFLRLPAKTLVRCRALSKPCYHLINDPDFIESHLHRVLQTGDHLMILLRGAL 63

Query: 64  --YFLTLTLGIGVQPHHHPLNIGSGTEVLGSCNGLIALCNSVQELALFNPSTRKLKTLPL 121
             Y + L     V    HP+  G  TEV GS NGLI L NS  +LA+FNPSTR++  LP 
Sbjct: 64  RLYSVDLDSLDSVSDVEHPMKRGGPTEVFGSSNGLIGLSNSPTDLAVFNPSTRQIHRLP- 122

Query: 122 PPCFVGFPSA-----FIFYGFGQDKSNDDYKLVRVLHFKGNDGEDV----EVEVEVYSLK 172
            P  +  P       ++FYG G D  +DDYK+VR++ FK +  +++      EV+V+SLK
Sbjct: 123 -PSSIDLPDGSSTRGYVFYGLGYDSVSDDYKVVRMVQFKIDSEDELGCSFPYEVKVFSLK 181

Query: 173 INSWRRISNLPRFLRDFYDYLYHSLFRKGYGVLAGGALHWVSPKSSTRSVIMAFNLVAK- 231
            NSW+RI ++   ++  + + YH L+R+GYGVLAG +LHWV P+   R  ++AFNL+ + 
Sbjct: 182 KNSWKRIESVASSIQLLFYFYYHLLYRRGYGVLAGNSLHWVLPR---RPGLIAFNLIVRF 238

Query: 232 -----EFYQLPLPDSVNVSYANVHVDVGSLEGCLCVFCFYNLVYVDMWMMKEHAVKESWT 286
                EF  +  P++V     ++ +D+G L+GCLC+ C Y+  YVD+WMMKE+ V++SWT
Sbjct: 239 DLALEEFEIVRFPEAVANGNVDIQMDIGVLDGCLCLMCNYDQSYVDVWMMKEYNVRDSWT 298

Query: 287 KLISVQEPTPTRSFLFLRPLGYSRNGVKLLLEVRREKLVWFDLETNSLRTVKIDTHGLDF 346
           K+ +VQ+P   +SF ++RPL YS++  K+LLE+   KLVWFDLE+  + T++I      +
Sbjct: 299 KVFTVQKPKSVKSFSYMRPLVYSKDKKKVLLELNNTKLVWFDLESKKMSTLRIKDCPSSY 358

Query: 347 VDTEICMASLVPLSDAGGGCGGGINGMKRRNLEEKEKIHKKK 388
              E+ ++SLV       GC G +N +K R  ++ ++  + K
Sbjct: 359 -SAELVVSSLVL------GCKGDLNNIKYRKEQQAKEAREAK 393

Source: Arabidopsis thaliana

Species: Arabidopsis thaliana

Genus: Arabidopsis

Family: Brassicaceae

Order: Brassicales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|110738553|dbj|BAF01202.1| hypothetical protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|4725955|emb|CAB41726.1| putative protein [Arabidopsis thaliana] gi|7267958|emb|CAB78299.1| putative protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|224137296|ref|XP_002322522.1| predicted protein [Populus trichocarpa] gi|222867152|gb|EEF04283.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255583935|ref|XP_002532715.1| conserved hypothetical protein [Ricinus communis] gi|223527542|gb|EEF29664.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
>gi|297809553|ref|XP_002872660.1| F-box family protein [Arabidopsis lyrata subsp. lyrata] gi|297318497|gb|EFH48919.1| F-box family protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|224089631|ref|XP_002308788.1| predicted protein [Populus trichocarpa] gi|222854764|gb|EEE92311.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|297799772|ref|XP_002867770.1| hypothetical protein ARALYDRAFT_329378 [Arabidopsis lyrata subsp. lyrata] gi|297313606|gb|EFH44029.1| hypothetical protein ARALYDRAFT_329378 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|224053103|ref|XP_002297705.1| predicted protein [Populus trichocarpa] gi|222844963|gb|EEE82510.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255583943|ref|XP_002532719.1| ubiquitin-protein ligase, putative [Ricinus communis] gi|223527546|gb|EEF29668.1| ubiquitin-protein ligase, putative [Ricinus communis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query389
TAIR|locus:2135615413 CPR1 "AT4G12560" [Arabidopsis 0.899 0.847 0.413 3.2e-72
TAIR|locus:2127465402 AT4G22390 "AT4G22390" [Arabido 0.881 0.853 0.382 3.5e-59
TAIR|locus:2082410427 AT3G06240 "AT3G06240" [Arabido 0.570 0.519 0.354 3.2e-36
TAIR|locus:2076196364 AT3G23880 "AT3G23880" [Arabido 0.760 0.813 0.293 4.6e-25
TAIR|locus:2077452417 AT3G07870 "AT3G07870" [Arabido 0.717 0.669 0.293 2.3e-21
TAIR|locus:504955955403 AT2G40925 "AT2G40925" [Arabido 0.832 0.803 0.252 1.8e-13
TAIR|locus:2058470449 AT2G40910 "AT2G40910" [Arabido 0.830 0.719 0.247 4.5e-12
TAIR|locus:2100524390 AT3G52320 "AT3G52320" [Arabido 0.812 0.810 0.252 1.2e-11
TAIR|locus:2075591360 AT3G47150 "AT3G47150" [Arabido 0.375 0.405 0.361 1.2e-11
TAIR|locus:2119787411 AT4G19940 "AT4G19940" [Arabido 0.832 0.788 0.236 3.9e-11
TAIR|locus:2135615 CPR1 "AT4G12560" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 730 (262.0 bits), Expect = 3.2e-72, P = 3.2e-72
 Identities = 152/368 (41%), Positives = 227/368 (61%)

Query:     5 IPLDIIADIFCRQPVKSLLRFRCVSKTCCSLIDSQDFIKLHLNHSITTRSNRRLILKAA- 63
             IP+DI+ DIF R P K+L+R R +SK C  LI+  DFI+ HL+  + T  +  ++L+ A 
Sbjct:     4 IPMDIVNDIFLRLPAKTLVRCRALSKPCYHLINDPDFIESHLHRVLQTGDHLMILLRGAL 63

Query:    64 --YFLTLTLGIGVQPHHHPLNIGSGTEVLGSCNGLIALCNSVQELALFNPSTRKLKTLPL 121
               Y + L     V    HP+  G  TEV GS NGLI L NS  +LA+FNPSTR++  LP 
Sbjct:    64 RLYSVDLDSLDSVSDVEHPMKRGGPTEVFGSSNGLIGLSNSPTDLAVFNPSTRQIHRLP- 122

Query:   122 PPCFVGFPSA-----FIFYGFGQDKSNDDYKLVRVLHFK--GND--GXXXXXXXXXYSLK 172
              P  +  P       ++FYG G D  +DDYK+VR++ FK    D  G         +SLK
Sbjct:   123 -PSSIDLPDGSSTRGYVFYGLGYDSVSDDYKVVRMVQFKIDSEDELGCSFPYEVKVFSLK 181

Query:   173 INSWRRISNLPRFLRDFYDYLYHSLFRKGYGVLAGGALHWVSPKSS---TRSVIMAFNLV 229
              NSW+RI ++   ++  + + YH L+R+GYGVLAG +LHWV P+       ++I+ F+L 
Sbjct:   182 KNSWKRIESVASSIQLLFYFYYHLLYRRGYGVLAGNSLHWVLPRRPGLIAFNLIVRFDLA 241

Query:   230 AKEFYQLPLPDSVNVSYANVHVDVGSLEGCLCVFCFYNLVYVDMWMMKEHAVKESWTKLI 289
              +EF  +  P++V     ++ +D+G L+GCLC+ C Y+  YVD+WMMKE+ V++SWTK+ 
Sbjct:   242 LEEFEIVRFPEAVANGNVDIQMDIGVLDGCLCLMCNYDQSYVDVWMMKEYNVRDSWTKVF 301

Query:   290 SVQEPTPTRSFLFLRPLGYSRNGVKLLLEVRREKLVWFDLETNSLRTVKIDTHGLDFVDT 349
             +VQ+P   +SF ++RPL YS++  K+LLE+   KLVWFDLE+  + T++I      +   
Sbjct:   302 TVQKPKSVKSFSYMRPLVYSKDKKKVLLELNNTKLVWFDLESKKMSTLRIKDCPSSY-SA 360

Query:   350 EICMASLV 357
             E+ ++SLV
Sbjct:   361 ELVVSSLV 368
GO:0003674 "molecular_function" evidence=ND
GO:0005737 "cytoplasm" evidence=ISM;IDA
GO:0005515 "protein binding" evidence=IPI
GO:0005634 "nucleus" evidence=IDA
GO:0031348 "negative regulation of defense response" evidence=IMP
GO:0042177 "negative regulation of protein catabolic process" evidence=IMP
TAIR|locus:2127465 AT4G22390 "AT4G22390" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2082410 AT3G06240 "AT3G06240" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2076196 AT3G23880 "AT3G23880" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2077452 AT3G07870 "AT3G07870" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:504955955 AT2G40925 "AT2G40925" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2058470 AT2G40910 "AT2G40910" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2100524 AT3G52320 "AT3G52320" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2075591 AT3G47150 "AT3G47150" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2119787 AT4G19940 "AT4G19940" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9SU30CPR30_ARATHNo assigned EC number0.40290.95620.9007yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query389
TIGR01640230 TIGR01640, F_box_assoc_1, F-box protein interactio 2e-21
pfam0064648 pfam00646, F-box, F-box domain 7e-06
smart0025641 smart00256, FBOX, A Receptor for Ubiquitination Ta 1e-05
>gnl|CDD|233502 TIGR01640, F_box_assoc_1, F-box protein interaction domain Back     alignment and domain information 
 Score = 91.7 bits (228), Expect = 2e-21
 Identities = 62/251 (24%), Positives = 108/251 (43%), Gaps = 29/251 (11%)

Query: 90  LGSCNGLIALCNSVQELALFNPSTRKLKTLPLPPCFVGFPSAFIFYGFGQDKSNDDYKLV 149
           +  C+GLI   +  + L ++NPST + + LP P            Y  G D     YK  
Sbjct: 1   VVPCDGLIC-FSYGKRLVVWNPSTGQSRWLPTPKSRRSNK-ESDTYFLGYDPIEKQYK-- 56

Query: 150 RVLHFKGNDGEDVEVEVEVYSLKINSWRRISNLPRFLRDFYDYLYHSLFRKGYGVLAGGA 209
            VL F    G   + E +VY+L  NSWR I              +H L  +  GV   G 
Sbjct: 57  -VLCFSDRSGNRNQSEHQVYTLGSNSWRTIEC---------SPPHHPLKSR--GVCINGV 104

Query: 210 LHWV--SPKSSTRSVIMAFNLVAKEFY---QLPLPDSVNVSYANVHVDVGSLEGCLCVFC 264
           L+++  + K++    I++F++ ++ F     LP  +S +V Y    + + + +G L V  
Sbjct: 105 LYYLAYTLKTNPDYFIVSFDVSSERFKEFIPLPCGNSDSVDY----LSLINYKGKLAVLK 160

Query: 265 FYNLVY-VDMWMMKEHAVKESWTKLISVQEPTPTRSFLFLRPLGYSRNGVKLLL-EVRRE 322
                   D+W++ + A K+ W+KL +V  P            G++  G  +L  E    
Sbjct: 161 QKKDTNNFDLWVLND-AGKQEWSKLFTVPIPPLPDLVDDNFLSGFTDKGEIVLCCEDENP 219

Query: 323 KLVW-FDLETN 332
             ++ +++  N
Sbjct: 220 FYIFYYNVGEN 230

This model describes a large family of plant domains, with several hundred members in Arabidopsis thaliana. Most examples are found C-terminal to an F-box (pfam00646), a 60 amino acid motif involved in ubiquitination of target proteins to mark them for degradation. Two-hybid experiments support the idea that most members are interchangeable F-box subunits of SCF E3 complexes. Some members have two copies of this domain. Length = 230
>gnl|CDD|201368 pfam00646, F-box, F-box domain Back     alignment and domain information
>gnl|CDD|197608 smart00256, FBOX, A Receptor for Ubiquitination Targets Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 389
TIGR01640230 F_box_assoc_1 F-box protein interaction domain. Th 100.0
PF07734164 FBA_1: F-box associated; InterPro: IPR006527 This 99.72
PF08268129 FBA_3: F-box associated domain; InterPro: IPR01318 99.66
PLN03215373 ascorbic acid mannose pathway regulator 1; Provisi 99.53
PHA02713557 hypothetical protein; Provisional 99.37
KOG4441571 consensus Proteins containing BTB/POZ and Kelch do 99.27
PHA02713557 hypothetical protein; Provisional 99.26
KOG4441571 consensus Proteins containing BTB/POZ and Kelch do 99.21
PHA03098534 kelch-like protein; Provisional 99.19
PHA02790480 Kelch-like protein; Provisional 99.16
PLN02153341 epithiospecifier protein 99.12
PLN02193470 nitrile-specifier protein 99.01
TIGR03548323 mutarot_permut cyclically-permuted mutatrotase fam 99.0
PF1293747 F-box-like: F-box-like; PDB: 1P22_A 2OVP_B 2OVR_B 98.97
TIGR03547346 muta_rot_YjhT mutatrotase, YjhT family. Members of 98.97
PF0064648 F-box: F-box domain; InterPro: IPR001810 The F-box 98.86
PLN02153341 epithiospecifier protein 98.85
PHA03098534 kelch-like protein; Provisional 98.83
PRK14131376 N-acetylneuraminic acid mutarotase; Provisional 98.76
PHA02790480 Kelch-like protein; Provisional 98.73
smart0025641 FBOX A Receptor for Ubiquitination Targets. 98.72
PLN02193470 nitrile-specifier protein 98.67
TIGR03548323 mutarot_permut cyclically-permuted mutatrotase fam 98.3
PRK14131376 N-acetylneuraminic acid mutarotase; Provisional 98.28
TIGR03547346 muta_rot_YjhT mutatrotase, YjhT family. Members of 98.27
KOG1230 521 consensus Protein containing repeated kelch motifs 98.14
KOG4693392 consensus Uncharacterized conserved protein, conta 98.13
KOG0281499 consensus Beta-TrCP (transducin repeats containing 97.83
KOG4693392 consensus Uncharacterized conserved protein, conta 97.44
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 97.36
KOG0379 482 consensus Kelch repeat-containing proteins [Genera 97.1
KOG0379482 consensus Kelch repeat-containing proteins [Genera 96.83
KOG2997366 consensus F-box protein FBX9 [General function pre 96.71
KOG1230 521 consensus Protein containing repeated kelch motifs 96.63
PF1396450 Kelch_6: Kelch motif 96.54
PF0134447 Kelch_1: Kelch motif; InterPro: IPR006652 Kelch is 95.24
PF07250243 Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterP 94.88
KOG0274537 consensus Cdc4 and related F-box and WD-40 protein 94.18
PF0764649 Kelch_2: Kelch motif; InterPro: IPR011498 Kelch is 93.86
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 93.2
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 93.18
smart0061247 Kelch Kelch domain. 93.04
PF07893342 DUF1668: Protein of unknown function (DUF1668); In 93.03
PF0134447 Kelch_1: Kelch motif; InterPro: IPR006652 Kelch is 92.67
PF1341849 Kelch_4: Galactose oxidase, central domain; PDB: 2 91.98
PF07893342 DUF1668: Protein of unknown function (DUF1668); In 91.64
smart00284255 OLF Olfactomedin-like domains. 91.03
PF1396450 Kelch_6: Kelch motif 90.57
PF07762131 DUF1618: Protein of unknown function (DUF1618); In 90.37
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 89.11
PRK11138394 outer membrane biogenesis protein BamB; Provisiona 88.06
PF0764649 Kelch_2: Kelch motif; InterPro: IPR011498 Kelch is 87.5
KOG2055514 consensus WD40 repeat protein [General function pr 86.2
PLN02772 398 guanylate kinase 86.18
COG4257353 Vgb Streptogramin lyase [Defense mechanisms] 85.79
TIGR01640230 F_box_assoc_1 F-box protein interaction domain. Th 85.69
smart0061247 Kelch Kelch domain. 84.85
COG3055381 Uncharacterized protein conserved in bacteria [Fun 84.77
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 84.56
COG3055381 Uncharacterized protein conserved in bacteria [Fun 84.37
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 84.28
PF02191250 OLF: Olfactomedin-like domain; InterPro: IPR003112 83.52
PF1341849 Kelch_4: Galactose oxidase, central domain; PDB: 2 83.42
KOG4341483 consensus F-box protein containing LRR [General fu 83.39
PRK11138394 outer membrane biogenesis protein BamB; Provisiona 83.33
KOG0289506 consensus mRNA splicing factor [General function p 83.1
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 82.97
PF1341549 Kelch_3: Galactose oxidase, central domain 82.7
KOG4152 830 consensus Host cell transcription factor HCFC1 [Ce 82.18
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 80.65
PRK11028 330 6-phosphogluconolactonase; Provisional 80.18
>TIGR01640 F_box_assoc_1 F-box protein interaction domain Back     alignment and domain information 
Probab=100.00  E-value=6.6e-36  Score=263.95  Aligned_cols=224  Identities=25%  Similarity=0.381  Sum_probs=164.5

Q ss_pred             EeeecceEEEeeCCceEEEEcCCcccccccCCCCCCCCCCCceeEEEEeeecCCCCeeEEEEEEEeCCCCCCceeEEEEE
Q 036391           90 LGSCNGLIALCNSVQELALFNPSTRKLKTLPLPPCFVGFPSAFIFYGFGQDKSNDDYKLVRVLHFKGNDGEDVEVEVEVY  169 (389)
Q Consensus        90 ~~s~~GLl~l~~~~~~~~V~NP~T~~~~~LP~~~~~~~~~~~~~~~~~g~~~~~~~ykvv~~~~~~~~~~~~~~~~~~Vy  169 (389)
                      ++|||||||+... ..++||||+|++++.||+++.+.... ....++||||+.+++||||++......   .....++||
T Consensus         1 ~~sCnGLlc~~~~-~~~~V~NP~T~~~~~LP~~~~~~~~~-~~~~~~~G~d~~~~~YKVv~~~~~~~~---~~~~~~~Vy   75 (230)
T TIGR01640         1 VVPCDGLICFSYG-KRLVVWNPSTGQSRWLPTPKSRRSNK-ESDTYFLGYDPIEKQYKVLCFSDRSGN---RNQSEHQVY   75 (230)
T ss_pred             CcccceEEEEecC-CcEEEECCCCCCEEecCCCCCccccc-ccceEEEeecccCCcEEEEEEEeecCC---CCCccEEEE
Confidence            4799999999864 78999999999999999876410111 122689999999999999999864321   144689999


Q ss_pred             EcCCCcEEEcccCCcccccccccccccccccCceeeECCeEEEEccCCC-CC-cEEEEEECCCceee-eeCCCCccccCC
Q 036391          170 SLKINSWRRISNLPRFLRDFYDYLYHSLFRKGYGVLAGGALHWVSPKSS-TR-SVIMAFNLVAKEFY-QLPLPDSVNVSY  246 (389)
Q Consensus       170 ss~~~~W~~~~~~p~~~~~~~~~~~~~~~~~~~~v~~~G~lywl~~~~~-~~-~~il~fD~~~e~~~-~i~~P~~~~~~~  246 (389)
                      ++++++||.++..+.          ... ....+|++||++||++.... .. ..|++||+.+|+|+ .+++|....  .
T Consensus        76 s~~~~~Wr~~~~~~~----------~~~-~~~~~v~~~G~lyw~~~~~~~~~~~~IvsFDl~~E~f~~~i~~P~~~~--~  142 (230)
T TIGR01640        76 TLGSNSWRTIECSPP----------HHP-LKSRGVCINGVLYYLAYTLKTNPDYFIVSFDVSSERFKEFIPLPCGNS--D  142 (230)
T ss_pred             EeCCCCccccccCCC----------Ccc-ccCCeEEECCEEEEEEEECCCCCcEEEEEEEcccceEeeeeecCcccc--c
Confidence            999999999974331          111 12238999999999986522 22 38999999999999 589987653  1


Q ss_pred             CceEEEEEEeCCeEEEEEecCC-CeEEEEEEeeCCCCCCeEEEEEEcCCCCCCCcceeeeEEEEeCCCEEEEEEc-CcE-
Q 036391          247 ANVHVDVGSLEGCLCVFCFYNL-VYVDMWMMKEHAVKESWTKLISVQEPTPTRSFLFLRPLGYSRNGVKLLLEVR-REK-  323 (389)
Q Consensus       247 ~~~~~~l~~~~G~L~~~~~~~~-~~l~iW~l~~~~~~~~W~~~~~i~~~~~~~~~~~~~p~~~~~~g~~i~l~~~-~~~-  323 (389)
                      ......|++++|+|+++..... ..++||+|++++. +.|+++++|++...........|+++..+|++++.... ..+ 
T Consensus       143 ~~~~~~L~~~~G~L~~v~~~~~~~~~~IWvl~d~~~-~~W~k~~~i~~~~~~~~~~~~~~~~~~~~g~I~~~~~~~~~~~  221 (230)
T TIGR01640       143 SVDYLSLINYKGKLAVLKQKKDTNNFDLWVLNDAGK-QEWSKLFTVPIPPLPDLVDDNFLSGFTDKGEIVLCCEDENPFY  221 (230)
T ss_pred             cccceEEEEECCEEEEEEecCCCCcEEEEEECCCCC-CceeEEEEEcCcchhhhhhheeEeEEeeCCEEEEEeCCCCceE
Confidence            2224689999999999987543 4699999998874 45999999986433322222568888888765555432 134 


Q ss_pred             EEEEeCCCC
Q 036391          324 LVWFDLETN  332 (389)
Q Consensus       324 l~~yd~~~~  332 (389)
                      ++.||++++
T Consensus       222 ~~~y~~~~~  230 (230)
T TIGR01640       222 IFYYNVGEN  230 (230)
T ss_pred             EEEEeccCC
Confidence            999999875

This model describes a large family of plant domains, with several hundred members in Arabidopsis thaliana. Most examples are found C-terminal to an F-box (pfam00646), a 60 amino acid motif involved in ubiquitination of target proteins to mark them for degradation. Two-hybid experiments support the idea that most members are interchangeable F-box subunits of SCF E3 complexes. Some members have two copies of this domain.
>PF07734 FBA_1: F-box associated; InterPro: IPR006527 This domain occurs in a diverse superfamily of genes in plants Back     alignment and domain information
>PF08268 FBA_3: F-box associated domain; InterPro: IPR013187 This domain occurs in a diverse superfamily of genes in plants Back     alignment and domain information
>PLN03215 ascorbic acid mannose pathway regulator 1; Provisional Back     alignment and domain information
>PHA02713 hypothetical protein; Provisional Back     alignment and domain information
>KOG4441 consensus Proteins containing BTB/POZ and Kelch domains, involved in regulatory/signal transduction processes [Signal transduction mechanisms; General function prediction only] Back     alignment and domain information
>PHA02713 hypothetical protein; Provisional Back     alignment and domain information
>KOG4441 consensus Proteins containing BTB/POZ and Kelch domains, involved in regulatory/signal transduction processes [Signal transduction mechanisms; General function prediction only] Back     alignment and domain information
>PHA03098 kelch-like protein; Provisional Back     alignment and domain information
>PHA02790 Kelch-like protein; Provisional Back     alignment and domain information
>PLN02153 epithiospecifier protein Back     alignment and domain information
>PLN02193 nitrile-specifier protein Back     alignment and domain information
>TIGR03548 mutarot_permut cyclically-permuted mutatrotase family protein Back     alignment and domain information
>PF12937 F-box-like: F-box-like; PDB: 1P22_A 2OVP_B 2OVR_B 2OVQ_B 1FS1_A 1FS2_C 1FQV_I 1LDK_E 2AST_B 2ASS_B Back     alignment and domain information
>TIGR03547 muta_rot_YjhT mutatrotase, YjhT family Back     alignment and domain information
>PF00646 F-box: F-box domain; InterPro: IPR001810 The F-box domain was first described as a sequence motif found in cyclin-F that interacts with the protein SKP1 [, ] Back     alignment and domain information
>PLN02153 epithiospecifier protein Back     alignment and domain information
>PHA03098 kelch-like protein; Provisional Back     alignment and domain information
>PRK14131 N-acetylneuraminic acid mutarotase; Provisional Back     alignment and domain information
>PHA02790 Kelch-like protein; Provisional Back     alignment and domain information
>smart00256 FBOX A Receptor for Ubiquitination Targets Back     alignment and domain information
>PLN02193 nitrile-specifier protein Back     alignment and domain information
>TIGR03548 mutarot_permut cyclically-permuted mutatrotase family protein Back     alignment and domain information
>PRK14131 N-acetylneuraminic acid mutarotase; Provisional Back     alignment and domain information
>TIGR03547 muta_rot_YjhT mutatrotase, YjhT family Back     alignment and domain information
>KOG1230 consensus Protein containing repeated kelch motifs [General function prediction only] Back     alignment and domain information
>KOG4693 consensus Uncharacterized conserved protein, contains kelch repeat [General function prediction only] Back     alignment and domain information
>KOG0281 consensus Beta-TrCP (transducin repeats containing)/Slimb proteins [Function unknown] Back     alignment and domain information
>KOG4693 consensus Uncharacterized conserved protein, contains kelch repeat [General function prediction only] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0379 consensus Kelch repeat-containing proteins [General function prediction only] Back     alignment and domain information
>KOG0379 consensus Kelch repeat-containing proteins [General function prediction only] Back     alignment and domain information
>KOG2997 consensus F-box protein FBX9 [General function prediction only] Back     alignment and domain information
>KOG1230 consensus Protein containing repeated kelch motifs [General function prediction only] Back     alignment and domain information
>PF13964 Kelch_6: Kelch motif Back     alignment and domain information
>PF01344 Kelch_1: Kelch motif; InterPro: IPR006652 Kelch is a 50-residue motif, named after the Drosophila mutant in which it was first identified [] Back     alignment and domain information
>PF07250 Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterPro: IPR009880 This entry represents the N terminus (approximately 300 residues) of a number of plant and fungal glyoxal oxidase enzymes Back     alignment and domain information
>KOG0274 consensus Cdc4 and related F-box and WD-40 proteins [General function prediction only] Back     alignment and domain information
>PF07646 Kelch_2: Kelch motif; InterPro: IPR011498 Kelch is a 50-residue motif, named after the Drosophila mutant in which it was first identified [] Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>smart00612 Kelch Kelch domain Back     alignment and domain information
>PF07893 DUF1668: Protein of unknown function (DUF1668); InterPro: IPR012871 The hypothetical proteins found in this family are expressed by Oryza sativa (Rice) and are of unknown function Back     alignment and domain information
>PF01344 Kelch_1: Kelch motif; InterPro: IPR006652 Kelch is a 50-residue motif, named after the Drosophila mutant in which it was first identified [] Back     alignment and domain information
>PF13418 Kelch_4: Galactose oxidase, central domain; PDB: 2UVK_B Back     alignment and domain information
>PF07893 DUF1668: Protein of unknown function (DUF1668); InterPro: IPR012871 The hypothetical proteins found in this family are expressed by Oryza sativa (Rice) and are of unknown function Back     alignment and domain information
>smart00284 OLF Olfactomedin-like domains Back     alignment and domain information
>PF13964 Kelch_6: Kelch motif Back     alignment and domain information
>PF07762 DUF1618: Protein of unknown function (DUF1618); InterPro: IPR011676 The proteins of this entry are mainly hypothetical proteins expressed by Oryza sativa Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>PF07646 Kelch_2: Kelch motif; InterPro: IPR011498 Kelch is a 50-residue motif, named after the Drosophila mutant in which it was first identified [] Back     alignment and domain information
>KOG2055 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PLN02772 guanylate kinase Back     alignment and domain information
>COG4257 Vgb Streptogramin lyase [Defense mechanisms] Back     alignment and domain information
>TIGR01640 F_box_assoc_1 F-box protein interaction domain Back     alignment and domain information
>smart00612 Kelch Kelch domain Back     alignment and domain information
>COG3055 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>COG3055 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>PF02191 OLF: Olfactomedin-like domain; InterPro: IPR003112 The olfactomedin-domain was first identified in olfactomedin, an extracellular matrix protein of the olfactory neuroepithelium [] Back     alignment and domain information
>PF13418 Kelch_4: Galactose oxidase, central domain; PDB: 2UVK_B Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>KOG0289 consensus mRNA splicing factor [General function prediction only] Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>PF13415 Kelch_3: Galactose oxidase, central domain Back     alignment and domain information
>KOG4152 consensus Host cell transcription factor HCFC1 [Cell cycle control, cell division, chromosome partitioning; Transcription] Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

No hit with e-value below 0.005

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query389
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 99.46
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 99.41
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 99.39
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 99.35
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 99.34
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 99.33
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 99.23
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 99.22
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 99.22
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 99.22
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 99.17
1fs1_A53 SKP2 F-BOX, cyclin A/CDK2-associated P19; F-BOX, L 99.11
2e31_A297 FBS1, F-box only protein 2; ubiquitin, SCF, ubiqui 99.09
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 99.08
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 99.04
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 98.97
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 98.92
2zwa_A695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 98.9
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 98.89
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 98.75
1k3i_A 656 Galactose oxidase precursor; blade beta propeller, 98.48
2zwa_A695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 98.28
1k3i_A 656 Galactose oxidase precursor; blade beta propeller, 98.03
3l2o_B312 F-box only protein 4; small G protein fold, UBL co 98.0
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 97.5
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 97.09
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 96.48
3jrp_A379 Fusion protein of protein transport protein SEC13 96.33
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 95.91
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 95.57
3jro_A 753 Fusion protein of protein transport protein SEC13 95.37
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 94.98
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 94.57
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 94.51
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 94.42
4e54_B435 DNA damage-binding protein 2; beta barrel, double 94.42
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 93.96
3jrp_A379 Fusion protein of protein transport protein SEC13 93.71
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 93.56
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 93.46
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 93.34
1l0q_A391 Surface layer protein; SLP, S-layer, 7-bladed beta 93.24
1l0q_A391 Surface layer protein; SLP, S-layer, 7-bladed beta 92.98
1k8k_C372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 92.89
3dwl_C377 Actin-related protein 2/3 complex subunit 1; prope 92.85
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 92.73
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 92.55
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 92.52
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 92.33
4g56_B357 MGC81050 protein; protein arginine methyltransfera 92.1
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 92.09
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 91.77
3fm0_A345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 91.71
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 91.41
3hfq_A 347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 91.37
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 91.27
3q7m_A376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 90.85
1pby_B337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 90.8
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 90.6
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 90.56
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 90.17
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 89.9
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 89.6
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 89.48
2aq5_A402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 89.21
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 88.69
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 87.9
3bg1_A316 Protein SEC13 homolog; NPC, transport, WD repeat, 87.89
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 87.72
4gga_A420 P55CDC, cell division cycle protein 20 homolog; ce 87.62
3q7m_A 376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 86.97
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 86.79
1k8k_C 372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 86.75
3mmy_A368 MRNA export factor; mRNA export, nuclear protein; 86.42
4a11_B408 DNA excision repair protein ERCC-8; DNA binding pr 85.69
4a11_B408 DNA excision repair protein ERCC-8; DNA binding pr 85.45
1pgu_A 615 Actin interacting protein 1; WD repeat, seven-blad 84.87
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 84.85
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 84.8
3dwl_C 377 Actin-related protein 2/3 complex subunit 1; prope 84.59
3sjl_D386 Methylamine dehydrogenase heavy chain; MAUG, C-hem 84.34
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 83.23
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 83.14
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 82.88
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 82.68
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 82.32
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 82.22
3fm0_A 345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 81.64
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 80.78
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Back     alignment and structure
Probab=99.46  E-value=4.3e-11  Score=109.42  Aligned_cols=196  Identities=12%  Similarity=0.047  Sum_probs=128.0

Q ss_pred             eEEEEcCCcccccccCCCCCCCCCCCceeEEEEeeecCCCCeeEEEEEEEeCCCCCCceeEEEEEEcCCCcEEEcccCCc
Q 036391          105 ELALFNPSTRKLKTLPLPPCFVGFPSAFIFYGFGQDKSNDDYKLVRVLHFKGNDGEDVEVEVEVYSLKINSWRRISNLPR  184 (389)
Q Consensus       105 ~~~V~NP~T~~~~~LP~~~~~~~~~~~~~~~~~g~~~~~~~ykvv~~~~~~~~~~~~~~~~~~Vyss~~~~W~~~~~~p~  184 (389)
                      .++++||.|++|..+|+++.  ... ...++.+      + =+++.++.....+.......+++|+..+++|+.++.+| 
T Consensus        68 ~~~~~d~~~~~W~~~~~~p~--~r~-~~~~~~~------~-~~lyv~GG~~~~~~~~~~~~~~~~d~~~~~W~~~~~~p-  136 (315)
T 4asc_A           68 YFLQFDHLDSEWLGMPPLPS--PRC-LFGLGEA------L-NSIYVVGGREIKDGERCLDSVMCYDRLSFKWGESDPLP-  136 (315)
T ss_dssp             EEEEEETTTTEEEECCCBSS--CEE-SCEEEEE------T-TEEEEECCEESSTTCCBCCCEEEEETTTTEEEECCCCS-
T ss_pred             ceEEecCCCCeEEECCCCCc--chh-ceeEEEE------C-CEEEEEeCCcCCCCCcccceEEEECCCCCcEeECCCCC-
Confidence            48899999999999998775  211 1112111      1 14555544322112234567899999999999998777 


Q ss_pred             ccccccccccccccccCceeeECCeEEEEccC---CCCCcEEEEEECCCceeeee-CCCCccccCCCceEEEEEEeCCeE
Q 036391          185 FLRDFYDYLYHSLFRKGYGVLAGGALHWVSPK---SSTRSVIMAFNLVAKEFYQL-PLPDSVNVSYANVHVDVGSLEGCL  260 (389)
Q Consensus       185 ~~~~~~~~~~~~~~~~~~~v~~~G~lywl~~~---~~~~~~il~fD~~~e~~~~i-~~P~~~~~~~~~~~~~l~~~~G~L  260 (389)
                                 ..+....++.++|.+|.+++.   ......+.+||+.+++|+.+ ++|....      ....+..+|+|
T Consensus       137 -----------~~r~~~~~~~~~~~iyv~GG~~~~~~~~~~~~~yd~~~~~W~~~~~~p~~r~------~~~~~~~~~~i  199 (315)
T 4asc_A          137 -----------YVVYGHTVLSHMDLVYVIGGKGSDRKCLNKMCVYDPKKFEWKELAPMQTARS------LFGATVHDGRI  199 (315)
T ss_dssp             -----------SCCBSCEEEEETTEEEEECCBCTTSCBCCCEEEEETTTTEEEECCCCSSCCB------SCEEEEETTEE
T ss_pred             -----------CcccceeEEEECCEEEEEeCCCCCCcccceEEEEeCCCCeEEECCCCCCchh------ceEEEEECCEE
Confidence                       223556678899999999875   12235799999999999998 4554432      23567789999


Q ss_pred             EEEEecCCC--eEEEEEEeeCCCCCCeEEEEEEcCCCCCCCcceeeeEEEEeCCCEEEEEEcC--------------cEE
Q 036391          261 CVFCFYNLV--YVDMWMMKEHAVKESWTKLISVQEPTPTRSFLFLRPLGYSRNGVKLLLEVRR--------------EKL  324 (389)
Q Consensus       261 ~~~~~~~~~--~l~iW~l~~~~~~~~W~~~~~i~~~~~~~~~~~~~p~~~~~~g~~i~l~~~~--------------~~l  324 (389)
                      +++......  .-++|+++-  .+..|+.+..++...      .....+.. ++.++++....              ..+
T Consensus       200 yv~GG~~~~~~~~~~~~yd~--~~~~W~~~~~~p~~r------~~~~~~~~-~~~l~v~GG~~~~~~~~~~~~~~~~~~v  270 (315)
T 4asc_A          200 IVAAGVTDTGLTSSAEVYSI--TDNKWAPFEAFPQER------SSLSLVSL-VGTLYAIGGFATLETESGELVPTELNDI  270 (315)
T ss_dssp             EEEEEECSSSEEEEEEEEET--TTTEEEEECCCSSCC------BSCEEEEE-TTEEEEEEEEEEEECTTSCEEEEEEEEE
T ss_pred             EEEeccCCCCccceEEEEEC--CCCeEEECCCCCCcc------cceeEEEE-CCEEEEECCccccCcCCccccccccCcE
Confidence            999875432  346888875  246899875433221      11222333 44444444221              248


Q ss_pred             EEEeCCCCcEEEE
Q 036391          325 VWFDLETNSLRTV  337 (389)
Q Consensus       325 ~~yd~~~~~~~~v  337 (389)
                      ..||+++++|+.+
T Consensus       271 ~~yd~~~~~W~~~  283 (315)
T 4asc_A          271 WRYNEEEKKWEGV  283 (315)
T ss_dssp             EEEETTTTEEEEE
T ss_pred             EEecCCCChhhhh
Confidence            8999999999998
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Back     alignment and structure
>1fs1_A SKP2 F-BOX, cyclin A/CDK2-associated P19; F-BOX, LRR, leucine-rich repeat, SCF, ubiquitin, ubiquitin protein ligase; 1.80A {Homo sapiens} SCOP: a.158.1.1 PDB: 1ldk_E Back     alignment and structure
>2e31_A FBS1, F-box only protein 2; ubiquitin, SCF, ubiquitin ligase, FBS1; 2.40A {Mus musculus} PDB: 2e32_A Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Back     alignment and structure
>3l2o_B F-box only protein 4; small G protein fold, UBL conjugation pathway, ubiquitin Pro ligase, protein binding-cell cycle complex; 2.80A {Homo sapiens} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ... Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 389
d1fs1a141 a.158.1.1 (A:109-149) Skp2 {Human (Homo sapiens) [ 1e-04
>d1fs1a1 a.158.1.1 (A:109-149) Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 41 Back     information, alignment and structure

class: All alpha proteins
fold: F-box domain
superfamily: F-box domain
family: F-box domain
domain: Skp2
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 37.0 bits (86), Expect = 1e-04
 Identities = 8/38 (21%), Positives = 15/38 (39%)

Query: 4  KIPLDIIADIFCRQPVKSLLRFRCVSKTCCSLIDSQDF 41
           +P +++  IF    +  LL+   V K    L   +  
Sbjct: 3  SLPDELLLGIFSCLCLPELLKVSGVCKRWYRLASDESL 40

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query389
d1fs1a141 Skp2 {Human (Homo sapiens) [TaxId: 9606]} 99.28
d2ovrb1102 F-box/WD repeat-containing protein 7, FBXW7 {Human 98.73
d1zgka1288 Kelch-like ECH-associated protein 1, KEAP1 {Human 98.7
d1zgka1288 Kelch-like ECH-associated protein 1, KEAP1 {Human 98.68
d1nexb1100 Cdc4 F-box and linker domains {Baker's yeast (Sacc 98.58
d1p22a1118 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 98.27
d1k3ia3387 Galactose oxidase, central domain {Fungi (Fusarium 97.86
d1k3ia3 387 Galactose oxidase, central domain {Fungi (Fusarium 97.77
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 93.05
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 91.83
d1k8kc_ 371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 89.62
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 88.25
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 88.19
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 82.74
d1pbyb_ 337 Quinohemoprotein amine dehydrogenase B chain {Para 81.83
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 81.65
>d1fs1a1 a.158.1.1 (A:109-149) Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: F-box domain
superfamily: F-box domain
family: F-box domain
domain: Skp2
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.28  E-value=7.8e-13  Score=79.57  Aligned_cols=40  Identities=20%  Similarity=0.320  Sum_probs=37.6

Q ss_pred             CCCCcHHHHHHHHhcCCccchhhhcccchhhhhhhCCHHH
Q 036391            2 SKKIPLDIIADIFCRQPVKSLLRFRCVSKTCCSLIDSQDF   41 (389)
Q Consensus         2 ~~~LP~Dll~~IL~rLP~ksl~r~r~VcK~W~~li~s~~F   41 (389)
                      ++.||+|++.+||++||+++++|+++|||+|+.+++++.+
T Consensus         1 f~~LP~eil~~If~~L~~~dl~~~~~Vcr~w~~l~~~~~l   40 (41)
T d1fs1a1           1 WDSLPDELLLGIFSCLCLPELLKVSGVCKRWYRLASDESL   40 (41)
T ss_dssp             CCSSCHHHHHHHHTTSCGGGHHHHHTTCHHHHHHHTCGGG
T ss_pred             CCcCCHHHHHHHHHcCCHHHHHHHHHHHHHHHHHhCCccc
Confidence            4789999999999999999999999999999999998863
>d2ovrb1 a.158.1.1 (B:2263-2364) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nexb1 a.158.1.1 (B:270-369) Cdc4 F-box and linker domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1p22a1 a.158.1.1 (A:135-252) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure