Citrus Sinensis ID: 036468
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 64 | ||||||
| 359487083 | 323 | PREDICTED: bifunctional dihydroflavonol | 0.984 | 0.195 | 0.796 | 2e-21 | |
| 359487096 | 323 | PREDICTED: bifunctional dihydroflavonol | 0.984 | 0.195 | 0.796 | 3e-21 | |
| 225465329 | 323 | PREDICTED: bifunctional dihydroflavonol | 0.984 | 0.195 | 0.796 | 3e-21 | |
| 359487115 | 259 | PREDICTED: bifunctional dihydroflavonol | 0.984 | 0.243 | 0.796 | 3e-21 | |
| 224106127 | 324 | cinnamoyl CoA reductase-like protein [Po | 0.968 | 0.191 | 0.793 | 3e-20 | |
| 359486990 | 323 | PREDICTED: LOW QUALITY PROTEIN: bifuncti | 0.984 | 0.195 | 0.781 | 4e-20 | |
| 147777135 | 1403 | hypothetical protein VITISV_030427 [Viti | 0.984 | 0.044 | 0.781 | 4e-20 | |
| 147774817 | 298 | hypothetical protein VITISV_003513 [Viti | 0.984 | 0.211 | 0.781 | 4e-20 | |
| 297736314 | 326 | unnamed protein product [Vitis vinifera] | 0.953 | 0.187 | 0.790 | 5e-20 | |
| 296086570 | 284 | unnamed protein product [Vitis vinifera] | 0.984 | 0.221 | 0.781 | 5e-20 |
| >gi|359487083|ref|XP_003633515.1| PREDICTED: bifunctional dihydroflavonol 4-reductase/flavanone 4-reductase-like [Vitis vinifera] gi|296085368|emb|CBI29100.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 106 bits (264), Expect = 2e-21, Method: Composition-based stats.
Identities = 51/64 (79%), Positives = 57/64 (89%), Gaps = 1/64 (1%)
Query: 1 MSGKGKVVCVTGASGFIASWLVKLLLQRSYTVKATVRDLNN-HNAEHLLTLDGAEERLHL 59
MSG+GKVVCVTGASG+IASWLVKLLLQR YTVKATVRD N+ EHLL L+GA+ERLHL
Sbjct: 1 MSGQGKVVCVTGASGYIASWLVKLLLQRGYTVKATVRDPNDPKKTEHLLALEGAKERLHL 60
Query: 60 FKAN 63
F+AN
Sbjct: 61 FEAN 64
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|359487096|ref|XP_003633516.1| PREDICTED: bifunctional dihydroflavonol 4-reductase/flavanone 4-reductase-like [Vitis vinifera] gi|296085371|emb|CBI29103.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|225465329|ref|XP_002274632.1| PREDICTED: bifunctional dihydroflavonol 4-reductase/flavanone 4-reductase isoform 1 [Vitis vinifera] gi|296085398|emb|CBI29130.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|359487115|ref|XP_003633518.1| PREDICTED: bifunctional dihydroflavonol 4-reductase/flavanone 4-reductase isoform 2 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|224106127|ref|XP_002314053.1| cinnamoyl CoA reductase-like protein [Populus trichocarpa] gi|222850461|gb|EEE88008.1| cinnamoyl CoA reductase-like protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|359486990|ref|XP_003633502.1| PREDICTED: LOW QUALITY PROTEIN: bifunctional dihydroflavonol 4-reductase/flavanone 4-reductase-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|147777135|emb|CAN63402.1| hypothetical protein VITISV_030427 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|147774817|emb|CAN71364.1| hypothetical protein VITISV_003513 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|297736314|emb|CBI24952.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|296086570|emb|CBI32205.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 64 | ||||||
| TAIR|locus:2012250 | 369 | AT1G09480 [Arabidopsis thalian | 0.984 | 0.170 | 0.734 | 3.1e-19 | |
| TAIR|locus:2150315 | 326 | AT5G19440 [Arabidopsis thalian | 0.968 | 0.190 | 0.698 | 1.1e-18 | |
| TAIR|locus:2033394 | 319 | AT1G66800 [Arabidopsis thalian | 0.984 | 0.197 | 0.671 | 4.6e-18 | |
| TAIR|locus:2033904 | 325 | AT1G51410 [Arabidopsis thalian | 0.968 | 0.190 | 0.714 | 9.5e-18 | |
| TAIR|locus:2012265 | 322 | AT1G09490 [Arabidopsis thalian | 0.984 | 0.195 | 0.703 | 1.6e-17 | |
| TAIR|locus:2012315 | 322 | AT1G09510 [Arabidopsis thalian | 0.984 | 0.195 | 0.656 | 2.6e-17 | |
| TAIR|locus:2012280 | 325 | AT1G09500 [Arabidopsis thalian | 0.984 | 0.193 | 0.671 | 3.7e-17 | |
| TAIR|locus:2200427 | 344 | CCR1 "cinnamoyl coa reductase | 0.968 | 0.180 | 0.580 | 2.4e-13 | |
| TAIR|locus:2025832 | 332 | CCR2 "cinnamoyl coa reductase" | 0.921 | 0.177 | 0.593 | 3.6e-13 | |
| TAIR|locus:2011741 | 325 | AT1G76470 [Arabidopsis thalian | 0.968 | 0.190 | 0.603 | 1.2e-12 |
| TAIR|locus:2012250 AT1G09480 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 232 (86.7 bits), Expect = 3.1e-19, P = 3.1e-19
Identities = 47/64 (73%), Positives = 54/64 (84%)
Query: 1 MSGKGKVVCVTGASGFIASWLVKLLLQRSYTVKATVRDLNNHN-AEHLLTLDGAEERLHL 59
M+G GK+VCVTGASG+IASW+VKLLL R YTVKATVRDL + EHLL LDGA+ERL L
Sbjct: 48 MNGGGKLVCVTGASGYIASWIVKLLLLRGYTVKATVRDLTDRKKTEHLLALDGAKERLKL 107
Query: 60 FKAN 63
FKA+
Sbjct: 108 FKAD 111
|
|
| TAIR|locus:2150315 AT5G19440 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2033394 AT1G66800 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2033904 AT1G51410 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2012265 AT1G09490 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2012315 AT1G09510 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2012280 AT1G09500 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2200427 CCR1 "cinnamoyl coa reductase 1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2025832 CCR2 "cinnamoyl coa reductase" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2011741 AT1G76470 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| GSVIVG00033897001 | SubName- Full=Chromosome undetermined scaffold_71, whole genome shotgun sequence; (323 aa) | |||||||
(Vitis vinifera) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 64 | |||
| PLN02662 | 322 | PLN02662, PLN02662, cinnamyl-alcohol dehydrogenase | 3e-37 | |
| cd08958 | 293 | cd08958, FR_SDR_e, flavonoid reductase (FR), exten | 2e-27 | |
| PLN02986 | 322 | PLN02986, PLN02986, cinnamyl-alcohol dehydrogenase | 9e-27 | |
| PLN02989 | 325 | PLN02989, PLN02989, cinnamyl-alcohol dehydrogenase | 7e-22 | |
| PLN02650 | 351 | PLN02650, PLN02650, dihydroflavonol-4-reductase | 4e-21 | |
| PLN02214 | 342 | PLN02214, PLN02214, cinnamoyl-CoA reductase | 5e-19 | |
| PLN02896 | 353 | PLN02896, PLN02896, cinnamyl-alcohol dehydrogenase | 1e-17 | |
| cd05193 | 295 | cd05193, AR_like_SDR_e, aldehyde reductase, flavon | 1e-16 | |
| cd05227 | 301 | cd05227, AR_SDR_e, aldehyde reductase, extended (e | 3e-13 | |
| PLN02583 | 297 | PLN02583, PLN02583, cinnamoyl-CoA reductase | 7e-11 | |
| PLN00198 | 338 | PLN00198, PLN00198, anthocyanidin reductase; Provi | 3e-10 | |
| cd05228 | 318 | cd05228, AR_FR_like_1_SDR_e, uncharacterized subgr | 1e-07 | |
| cd05271 | 273 | cd05271, NDUFA9_like_SDR_a, NADH dehydrogenase (ub | 5e-07 | |
| TIGR03466 | 328 | TIGR03466, HpnA, hopanoid-associated sugar epimera | 5e-07 | |
| cd05257 | 316 | cd05257, Arna_like_SDR_e, Arna decarboxylase_like, | 1e-06 | |
| cd05243 | 203 | cd05243, SDR_a5, atypical (a) SDRs, subgroup 5 | 1e-06 | |
| TIGR04180 | 297 | TIGR04180, EDH_00030, NAD dependent epimerase/dehy | 5e-06 | |
| COG0451 | 314 | COG0451, WcaG, Nucleoside-diphosphate-sugar epimer | 8e-06 | |
| cd08946 | 200 | cd08946, SDR_e, extended (e) SDRs | 1e-05 | |
| cd05245 | 293 | cd05245, SDR_a2, atypical (a) SDRs, subgroup 2 | 1e-05 | |
| cd05260 | 316 | cd05260, GDP_MD_SDR_e, GDP-mannose 4,6 dehydratase | 3e-05 | |
| COG1089 | 345 | COG1089, Gmd, GDP-D-mannose dehydratase [Cell enve | 5e-05 | |
| cd05263 | 293 | cd05263, MupV_like_SDR_e, Pseudomonas fluorescens | 5e-05 | |
| pfam01370 | 233 | pfam01370, Epimerase, NAD dependent epimerase/dehy | 6e-05 | |
| COG0702 | 275 | COG0702, COG0702, Predicted nucleoside-diphosphate | 9e-05 | |
| PLN02657 | 390 | PLN02657, PLN02657, 3,8-divinyl protochlorophyllid | 1e-04 | |
| cd05280 | 325 | cd05280, MDR_yhdh_yhfp, Yhdh and yhfp-like putativ | 1e-04 | |
| cd05232 | 303 | cd05232, UDP_G4E_4_SDR_e, UDP-glucose 4 epimerase, | 1e-04 | |
| cd05230 | 305 | cd05230, UGD_SDR_e, UDP-glucuronate decarboxylase | 2e-04 | |
| PLN02653 | 340 | PLN02653, PLN02653, GDP-mannose 4,6-dehydratase | 3e-04 | |
| PRK07201 | 657 | PRK07201, PRK07201, short chain dehydrogenase; Pro | 4e-04 | |
| cd05262 | 291 | cd05262, SDR_a7, atypical (a) SDRs, subgroup 7 | 5e-04 | |
| pfam05368 | 232 | pfam05368, NmrA, NmrA-like family | 5e-04 | |
| PLN02695 | 370 | PLN02695, PLN02695, GDP-D-mannose-3',5'-epimerase | 5e-04 | |
| cd05252 | 336 | cd05252, CDP_GD_SDR_e, CDP-D-glucose 4,6-dehydrata | 5e-04 | |
| cd08932 | 223 | cd08932, HetN_like_SDR_c, HetN oxidoreductase-like | 7e-04 | |
| PRK06179 | 270 | PRK06179, PRK06179, short chain dehydrogenase; Pro | 0.001 | |
| cd05374 | 248 | cd05374, 17beta-HSD-like_SDR_c, 17beta hydroxyster | 0.001 | |
| pfam13460 | 182 | pfam13460, NAD_binding_10, NADH(P)-binding | 0.002 | |
| cd05237 | 287 | cd05237, UDP_invert_4-6DH_SDR_e, UDP-Glcnac (UDP-l | 0.002 | |
| cd05234 | 305 | cd05234, UDP_G4E_2_SDR_e, UDP-glucose 4 epimerase, | 0.002 | |
| cd08289 | 326 | cd08289, MDR_yhfp_like, Yhfp putative quinone oxid | 0.002 | |
| PRK08264 | 238 | PRK08264, PRK08264, short chain dehydrogenase; Val | 0.003 | |
| TIGR01179 | 328 | TIGR01179, galE, UDP-glucose-4-epimerase GalE | 0.004 |
| >gnl|CDD|178268 PLN02662, PLN02662, cinnamyl-alcohol dehydrogenase family protein | Back alignment and domain information |
|---|
Score = 125 bits (316), Expect = 3e-37
Identities = 52/63 (82%), Positives = 56/63 (88%), Gaps = 1/63 (1%)
Query: 2 SGKGKVVCVTGASGFIASWLVKLLLQRSYTVKATVRDLNNHN-AEHLLTLDGAEERLHLF 60
SG+GKVVCVTGASG+IASWLVKLLLQR YTVKATVRD N+ EHLL LDGA+ERLHLF
Sbjct: 1 SGEGKVVCVTGASGYIASWLVKLLLQRGYTVKATVRDPNDPKKTEHLLALDGAKERLHLF 60
Query: 61 KAN 63
KAN
Sbjct: 61 KAN 63
|
Length = 322 |
| >gnl|CDD|187661 cd08958, FR_SDR_e, flavonoid reductase (FR), extended (e) SDRs | Back alignment and domain information |
|---|
| >gnl|CDD|178567 PLN02986, PLN02986, cinnamyl-alcohol dehydrogenase family protein | Back alignment and domain information |
|---|
| >gnl|CDD|178569 PLN02989, PLN02989, cinnamyl-alcohol dehydrogenase family protein | Back alignment and domain information |
|---|
| >gnl|CDD|178256 PLN02650, PLN02650, dihydroflavonol-4-reductase | Back alignment and domain information |
|---|
| >gnl|CDD|177862 PLN02214, PLN02214, cinnamoyl-CoA reductase | Back alignment and domain information |
|---|
| >gnl|CDD|178484 PLN02896, PLN02896, cinnamyl-alcohol dehydrogenase | Back alignment and domain information |
|---|
| >gnl|CDD|187536 cd05193, AR_like_SDR_e, aldehyde reductase, flavonoid reductase, and related proteins, extended (e) SDRs | Back alignment and domain information |
|---|
| >gnl|CDD|187538 cd05227, AR_SDR_e, aldehyde reductase, extended (e) SDRs | Back alignment and domain information |
|---|
| >gnl|CDD|178195 PLN02583, PLN02583, cinnamoyl-CoA reductase | Back alignment and domain information |
|---|
| >gnl|CDD|215100 PLN00198, PLN00198, anthocyanidin reductase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|187539 cd05228, AR_FR_like_1_SDR_e, uncharacterized subgroup of aldehyde reductase and flavonoid reductase related proteins, extended (e) SDRs | Back alignment and domain information |
|---|
| >gnl|CDD|187579 cd05271, NDUFA9_like_SDR_a, NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, subunit 9, 39 kDa, (NDUFA9) -like, atypical (a) SDRs | Back alignment and domain information |
|---|
| >gnl|CDD|163279 TIGR03466, HpnA, hopanoid-associated sugar epimerase | Back alignment and domain information |
|---|
| >gnl|CDD|187567 cd05257, Arna_like_SDR_e, Arna decarboxylase_like, extended (e) SDRs | Back alignment and domain information |
|---|
| >gnl|CDD|187554 cd05243, SDR_a5, atypical (a) SDRs, subgroup 5 | Back alignment and domain information |
|---|
| >gnl|CDD|200431 TIGR04180, EDH_00030, NAD dependent epimerase/dehydratase, LLPSF_EDH_00030 family | Back alignment and domain information |
|---|
| >gnl|CDD|223528 COG0451, WcaG, Nucleoside-diphosphate-sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|212494 cd08946, SDR_e, extended (e) SDRs | Back alignment and domain information |
|---|
| >gnl|CDD|187556 cd05245, SDR_a2, atypical (a) SDRs, subgroup 2 | Back alignment and domain information |
|---|
| >gnl|CDD|187570 cd05260, GDP_MD_SDR_e, GDP-mannose 4,6 dehydratase, extended (e) SDRs | Back alignment and domain information |
|---|
| >gnl|CDD|224014 COG1089, Gmd, GDP-D-mannose dehydratase [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|187573 cd05263, MupV_like_SDR_e, Pseudomonas fluorescens MupV-like, extended (e) SDRs | Back alignment and domain information |
|---|
| >gnl|CDD|216461 pfam01370, Epimerase, NAD dependent epimerase/dehydratase family | Back alignment and domain information |
|---|
| >gnl|CDD|223774 COG0702, COG0702, Predicted nucleoside-diphosphate-sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|178263 PLN02657, PLN02657, 3,8-divinyl protochlorophyllide a 8-vinyl reductase | Back alignment and domain information |
|---|
| >gnl|CDD|176183 cd05280, MDR_yhdh_yhfp, Yhdh and yhfp-like putative quinone oxidoreductases | Back alignment and domain information |
|---|
| >gnl|CDD|187543 cd05232, UDP_G4E_4_SDR_e, UDP-glucose 4 epimerase, subgroup 4, extended (e) SDRs | Back alignment and domain information |
|---|
| >gnl|CDD|187541 cd05230, UGD_SDR_e, UDP-glucuronate decarboxylase (UGD) and related proteins, extended (e) SDRs | Back alignment and domain information |
|---|
| >gnl|CDD|178259 PLN02653, PLN02653, GDP-mannose 4,6-dehydratase | Back alignment and domain information |
|---|
| >gnl|CDD|235962 PRK07201, PRK07201, short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|187572 cd05262, SDR_a7, atypical (a) SDRs, subgroup 7 | Back alignment and domain information |
|---|
| >gnl|CDD|191263 pfam05368, NmrA, NmrA-like family | Back alignment and domain information |
|---|
| >gnl|CDD|178298 PLN02695, PLN02695, GDP-D-mannose-3',5'-epimerase | Back alignment and domain information |
|---|
| >gnl|CDD|187562 cd05252, CDP_GD_SDR_e, CDP-D-glucose 4,6-dehydratase, extended (e) SDRs | Back alignment and domain information |
|---|
| >gnl|CDD|212493 cd08932, HetN_like_SDR_c, HetN oxidoreductase-like, classical (c) SDR | Back alignment and domain information |
|---|
| >gnl|CDD|235725 PRK06179, PRK06179, short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|187632 cd05374, 17beta-HSD-like_SDR_c, 17beta hydroxysteroid dehydrogenase-like, classical (c) SDRs | Back alignment and domain information |
|---|
| >gnl|CDD|222146 pfam13460, NAD_binding_10, NADH(P)-binding | Back alignment and domain information |
|---|
| >gnl|CDD|187548 cd05237, UDP_invert_4-6DH_SDR_e, UDP-Glcnac (UDP-linked N-acetylglucosamine) inverting 4,6-dehydratase, extended (e) SDRs | Back alignment and domain information |
|---|
| >gnl|CDD|187545 cd05234, UDP_G4E_2_SDR_e, UDP-glucose 4 epimerase, subgroup 2, extended (e) SDRs | Back alignment and domain information |
|---|
| >gnl|CDD|176249 cd08289, MDR_yhfp_like, Yhfp putative quinone oxidoreductases | Back alignment and domain information |
|---|
| >gnl|CDD|181335 PRK08264, PRK08264, short chain dehydrogenase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|213592 TIGR01179, galE, UDP-glucose-4-epimerase GalE | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 64 | |||
| KOG1502 | 327 | consensus Flavonol reductase/cinnamoyl-CoA reducta | 99.6 | |
| PRK07478 | 254 | short chain dehydrogenase; Provisional | 99.44 | |
| PRK05653 | 246 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 99.44 | |
| COG0300 | 265 | DltE Short-chain dehydrogenases of various substra | 99.44 | |
| PRK06194 | 287 | hypothetical protein; Provisional | 99.41 | |
| PRK05867 | 253 | short chain dehydrogenase; Provisional | 99.4 | |
| PRK07231 | 251 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 99.4 | |
| PLN02986 | 322 | cinnamyl-alcohol dehydrogenase family protein | 99.4 | |
| PRK07890 | 258 | short chain dehydrogenase; Provisional | 99.4 | |
| PRK09072 | 263 | short chain dehydrogenase; Provisional | 99.39 | |
| PRK06114 | 254 | short chain dehydrogenase; Provisional | 99.39 | |
| PRK05866 | 293 | short chain dehydrogenase; Provisional | 99.39 | |
| PRK05557 | 248 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 99.39 | |
| PRK07035 | 252 | short chain dehydrogenase; Provisional | 99.39 | |
| PRK06172 | 253 | short chain dehydrogenase; Provisional | 99.39 | |
| PRK07523 | 255 | gluconate 5-dehydrogenase; Provisional | 99.39 | |
| PRK08862 | 227 | short chain dehydrogenase; Provisional | 99.39 | |
| PRK07453 | 322 | protochlorophyllide oxidoreductase; Validated | 99.38 | |
| PLN02583 | 297 | cinnamoyl-CoA reductase | 99.38 | |
| PRK13394 | 262 | 3-hydroxybutyrate dehydrogenase; Provisional | 99.38 | |
| TIGR01832 | 248 | kduD 2-deoxy-D-gluconate 3-dehydrogenase. This mod | 99.37 | |
| PRK08085 | 254 | gluconate 5-dehydrogenase; Provisional | 99.37 | |
| PRK12429 | 258 | 3-hydroxybutyrate dehydrogenase; Provisional | 99.37 | |
| PRK08339 | 263 | short chain dehydrogenase; Provisional | 99.37 | |
| PRK08628 | 258 | short chain dehydrogenase; Provisional | 99.36 | |
| PRK07576 | 264 | short chain dehydrogenase; Provisional | 99.36 | |
| PLN02662 | 322 | cinnamyl-alcohol dehydrogenase family protein | 99.36 | |
| PRK12826 | 251 | 3-ketoacyl-(acyl-carrier-protein) reductase; Revie | 99.36 | |
| PRK07774 | 250 | short chain dehydrogenase; Provisional | 99.36 | |
| PRK06139 | 330 | short chain dehydrogenase; Provisional | 99.36 | |
| PLN02650 | 351 | dihydroflavonol-4-reductase | 99.36 | |
| PRK06138 | 252 | short chain dehydrogenase; Provisional | 99.36 | |
| PRK05876 | 275 | short chain dehydrogenase; Provisional | 99.36 | |
| PRK12481 | 251 | 2-deoxy-D-gluconate 3-dehydrogenase; Provisional | 99.35 | |
| PRK12937 | 245 | short chain dehydrogenase; Provisional | 99.35 | |
| PRK07806 | 248 | short chain dehydrogenase; Provisional | 99.35 | |
| PLN02989 | 325 | cinnamyl-alcohol dehydrogenase family protein | 99.35 | |
| PRK07814 | 263 | short chain dehydrogenase; Provisional | 99.35 | |
| PRK06124 | 256 | gluconate 5-dehydrogenase; Provisional | 99.35 | |
| PRK08277 | 278 | D-mannonate oxidoreductase; Provisional | 99.35 | |
| PRK08589 | 272 | short chain dehydrogenase; Validated | 99.34 | |
| PRK07109 | 334 | short chain dehydrogenase; Provisional | 99.34 | |
| PRK06935 | 258 | 2-deoxy-D-gluconate 3-dehydrogenase; Provisional | 99.34 | |
| PRK05854 | 313 | short chain dehydrogenase; Provisional | 99.34 | |
| PRK08278 | 273 | short chain dehydrogenase; Provisional | 99.33 | |
| PRK07063 | 260 | short chain dehydrogenase; Provisional | 99.33 | |
| PRK12745 | 256 | 3-ketoacyl-(acyl-carrier-protein) reductase; Provi | 99.33 | |
| TIGR03325 | 262 | BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydro | 99.33 | |
| PRK07326 | 237 | short chain dehydrogenase; Provisional | 99.32 | |
| PRK08643 | 256 | acetoin reductase; Validated | 99.32 | |
| PRK07097 | 265 | gluconate 5-dehydrogenase; Provisional | 99.32 | |
| PRK07904 | 253 | short chain dehydrogenase; Provisional | 99.32 | |
| PRK07825 | 273 | short chain dehydrogenase; Provisional | 99.32 | |
| PRK06701 | 290 | short chain dehydrogenase; Provisional | 99.31 | |
| PRK08213 | 259 | gluconate 5-dehydrogenase; Provisional | 99.31 | |
| PLN02214 | 342 | cinnamoyl-CoA reductase | 99.31 | |
| PRK07454 | 241 | short chain dehydrogenase; Provisional | 99.31 | |
| PRK06197 | 306 | short chain dehydrogenase; Provisional | 99.31 | |
| PRK09134 | 258 | short chain dehydrogenase; Provisional | 99.31 | |
| PRK08265 | 261 | short chain dehydrogenase; Provisional | 99.31 | |
| PRK06720 | 169 | hypothetical protein; Provisional | 99.3 | |
| PRK07666 | 239 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 99.3 | |
| PRK07062 | 265 | short chain dehydrogenase; Provisional | 99.3 | |
| PRK05565 | 247 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 99.3 | |
| PRK07024 | 257 | short chain dehydrogenase; Provisional | 99.3 | |
| PRK12823 | 260 | benD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylat | 99.3 | |
| PRK05786 | 238 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 99.3 | |
| PRK06914 | 280 | short chain dehydrogenase; Provisional | 99.3 | |
| PRK07792 | 306 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 99.29 | |
| PRK08217 | 253 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 99.29 | |
| PLN02240 | 352 | UDP-glucose 4-epimerase | 99.29 | |
| PRK12743 | 256 | oxidoreductase; Provisional | 99.29 | |
| PRK07102 | 243 | short chain dehydrogenase; Provisional | 99.29 | |
| PRK06113 | 255 | 7-alpha-hydroxysteroid dehydrogenase; Validated | 99.28 | |
| PLN02253 | 280 | xanthoxin dehydrogenase | 99.28 | |
| PRK06128 | 300 | oxidoreductase; Provisional | 99.28 | |
| PRK08251 | 248 | short chain dehydrogenase; Provisional | 99.28 | |
| COG3967 | 245 | DltE Short-chain dehydrogenase involved in D-alani | 99.28 | |
| PRK08303 | 305 | short chain dehydrogenase; Provisional | 99.28 | |
| PRK07856 | 252 | short chain dehydrogenase; Provisional | 99.27 | |
| PLN00198 | 338 | anthocyanidin reductase; Provisional | 99.27 | |
| TIGR03206 | 250 | benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydr | 99.27 | |
| PRK06200 | 263 | 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrog | 99.27 | |
| PRK06077 | 252 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 99.27 | |
| PRK07067 | 257 | sorbitol dehydrogenase; Provisional | 99.27 | |
| PRK06101 | 240 | short chain dehydrogenase; Provisional | 99.27 | |
| PRK12939 | 250 | short chain dehydrogenase; Provisional | 99.27 | |
| TIGR01472 | 343 | gmd GDP-mannose 4,6-dehydratase. Excluded from thi | 99.27 | |
| TIGR01289 | 314 | LPOR light-dependent protochlorophyllide reductase | 99.26 | |
| PRK05875 | 276 | short chain dehydrogenase; Provisional | 99.26 | |
| KOG0725 | 270 | consensus Reductases with broad range of substrate | 99.26 | |
| PRK07985 | 294 | oxidoreductase; Provisional | 99.26 | |
| PLN02896 | 353 | cinnamyl-alcohol dehydrogenase | 99.26 | |
| KOG1205 | 282 | consensus Predicted dehydrogenase [Secondary metab | 99.26 | |
| PRK05717 | 255 | oxidoreductase; Validated | 99.26 | |
| PRK06949 | 258 | short chain dehydrogenase; Provisional | 99.26 | |
| PRK08340 | 259 | glucose-1-dehydrogenase; Provisional | 99.26 | |
| PRK07370 | 258 | enoyl-(acyl carrier protein) reductase; Validated | 99.26 | |
| TIGR02622 | 349 | CDP_4_6_dhtase CDP-glucose 4,6-dehydratase. Member | 99.26 | |
| PRK12825 | 249 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 99.25 | |
| PRK06947 | 248 | glucose-1-dehydrogenase; Provisional | 99.25 | |
| PRK09242 | 257 | tropinone reductase; Provisional | 99.25 | |
| PRK12744 | 257 | short chain dehydrogenase; Provisional | 99.25 | |
| PRK09135 | 249 | pteridine reductase; Provisional | 99.25 | |
| PRK07677 | 252 | short chain dehydrogenase; Provisional | 99.25 | |
| PRK08267 | 260 | short chain dehydrogenase; Provisional | 99.25 | |
| PRK06179 | 270 | short chain dehydrogenase; Provisional | 99.25 | |
| PRK08642 | 253 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 99.25 | |
| PRK05650 | 270 | short chain dehydrogenase; Provisional | 99.25 | |
| PRK09291 | 257 | short chain dehydrogenase; Provisional | 99.25 | |
| PRK08936 | 261 | glucose-1-dehydrogenase; Provisional | 99.24 | |
| PRK09186 | 256 | flagellin modification protein A; Provisional | 99.24 | |
| PRK08226 | 263 | short chain dehydrogenase; Provisional | 99.24 | |
| PLN02653 | 340 | GDP-mannose 4,6-dehydratase | 99.24 | |
| TIGR01963 | 255 | PHB_DH 3-hydroxybutyrate dehydrogenase. This model | 99.24 | |
| PRK08993 | 253 | 2-deoxy-D-gluconate 3-dehydrogenase; Validated | 99.24 | |
| COG4221 | 246 | Short-chain alcohol dehydrogenase of unknown speci | 99.23 | |
| PRK06924 | 251 | short chain dehydrogenase; Provisional | 99.23 | |
| PRK12828 | 239 | short chain dehydrogenase; Provisional | 99.23 | |
| PRK07791 | 286 | short chain dehydrogenase; Provisional | 99.23 | |
| PRK06125 | 259 | short chain dehydrogenase; Provisional | 99.23 | |
| KOG1201 | 300 | consensus Hydroxysteroid 17-beta dehydrogenase 11 | 99.23 | |
| PRK08264 | 238 | short chain dehydrogenase; Validated | 99.23 | |
| PRK07775 | 274 | short chain dehydrogenase; Provisional | 99.22 | |
| PRK06196 | 315 | oxidoreductase; Provisional | 99.22 | |
| PRK07533 | 258 | enoyl-(acyl carrier protein) reductase; Provisiona | 99.22 | |
| PRK12827 | 249 | short chain dehydrogenase; Provisional | 99.22 | |
| PRK06171 | 266 | sorbitol-6-phosphate 2-dehydrogenase; Provisional | 99.22 | |
| PRK15181 | 348 | Vi polysaccharide biosynthesis protein TviC; Provi | 99.21 | |
| PRK08416 | 260 | 7-alpha-hydroxysteroid dehydrogenase; Provisional | 99.21 | |
| PLN02427 | 386 | UDP-apiose/xylose synthase | 99.21 | |
| PRK06180 | 277 | short chain dehydrogenase; Provisional | 99.2 | |
| PRK06181 | 263 | short chain dehydrogenase; Provisional | 99.2 | |
| PRK08063 | 250 | enoyl-(acyl carrier protein) reductase; Provisiona | 99.2 | |
| PRK08594 | 257 | enoyl-(acyl carrier protein) reductase; Provisiona | 99.2 | |
| PLN02657 | 390 | 3,8-divinyl protochlorophyllide a 8-vinyl reductas | 99.2 | |
| KOG1208 | 314 | consensus Dehydrogenases with different specificit | 99.2 | |
| PRK07201 | 657 | short chain dehydrogenase; Provisional | 99.2 | |
| PF00106 | 167 | adh_short: short chain dehydrogenase alcohol dehyd | 99.19 | |
| PRK05872 | 296 | short chain dehydrogenase; Provisional | 99.19 | |
| PRK06500 | 249 | short chain dehydrogenase; Provisional | 99.19 | |
| PLN02780 | 320 | ketoreductase/ oxidoreductase | 99.19 | |
| PRK12748 | 256 | 3-ketoacyl-(acyl-carrier-protein) reductase; Provi | 99.19 | |
| PRK12747 | 252 | short chain dehydrogenase; Provisional | 99.18 | |
| PRK06398 | 258 | aldose dehydrogenase; Validated | 99.18 | |
| PRK12384 | 259 | sorbitol-6-phosphate dehydrogenase; Provisional | 99.18 | |
| PRK12935 | 247 | acetoacetyl-CoA reductase; Provisional | 99.18 | |
| PRK12746 | 254 | short chain dehydrogenase; Provisional | 99.18 | |
| PRK06198 | 260 | short chain dehydrogenase; Provisional | 99.18 | |
| PRK12938 | 246 | acetyacetyl-CoA reductase; Provisional | 99.17 | |
| PRK06123 | 248 | short chain dehydrogenase; Provisional | 99.17 | |
| PRK12824 | 245 | acetoacetyl-CoA reductase; Provisional | 99.17 | |
| TIGR02415 | 254 | 23BDH acetoin reductases. One member of this famil | 99.17 | |
| PRK07074 | 257 | short chain dehydrogenase; Provisional | 99.17 | |
| PRK06079 | 252 | enoyl-(acyl carrier protein) reductase; Provisiona | 99.17 | |
| CHL00194 | 317 | ycf39 Ycf39; Provisional | 99.17 | |
| PRK05855 | 582 | short chain dehydrogenase; Validated | 99.17 | |
| PRK06841 | 255 | short chain dehydrogenase; Provisional | 99.16 | |
| PRK10538 | 248 | malonic semialdehyde reductase; Provisional | 99.16 | |
| PRK08415 | 274 | enoyl-(acyl carrier protein) reductase; Provisiona | 99.16 | |
| PRK06550 | 235 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 99.16 | |
| PRK08703 | 239 | short chain dehydrogenase; Provisional | 99.16 | |
| KOG1371 | 343 | consensus UDP-glucose 4-epimerase/UDP-sulfoquinovo | 99.16 | |
| PRK05993 | 277 | short chain dehydrogenase; Provisional | 99.15 | |
| PRK07023 | 243 | short chain dehydrogenase; Provisional | 99.15 | |
| PLN00141 | 251 | Tic62-NAD(P)-related group II protein; Provisional | 99.15 | |
| PLN02686 | 367 | cinnamoyl-CoA reductase | 99.15 | |
| PRK05599 | 246 | hypothetical protein; Provisional | 99.15 | |
| PRK06505 | 271 | enoyl-(acyl carrier protein) reductase; Provisiona | 99.14 | |
| PLN02206 | 442 | UDP-glucuronate decarboxylase | 99.14 | |
| PRK12936 | 245 | 3-ketoacyl-(acyl-carrier-protein) reductase NodG; | 99.14 | |
| COG1087 | 329 | GalE UDP-glucose 4-epimerase [Cell envelope biogen | 99.14 | |
| PRK06523 | 260 | short chain dehydrogenase; Provisional | 99.14 | |
| PRK06182 | 273 | short chain dehydrogenase; Validated | 99.14 | |
| PLN03209 | 576 | translocon at the inner envelope of chloroplast su | 99.13 | |
| PRK06483 | 236 | dihydromonapterin reductase; Provisional | 99.13 | |
| PRK07984 | 262 | enoyl-(acyl carrier protein) reductase; Provisiona | 99.13 | |
| TIGR01831 | 239 | fabG_rel 3-oxoacyl-(acyl-carrier-protein) reductas | 99.13 | |
| PRK08945 | 247 | putative oxoacyl-(acyl carrier protein) reductase; | 99.13 | |
| PRK06463 | 255 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 99.13 | |
| PRK06940 | 275 | short chain dehydrogenase; Provisional | 99.13 | |
| PRK06057 | 255 | short chain dehydrogenase; Provisional | 99.13 | |
| PRK06482 | 276 | short chain dehydrogenase; Provisional | 99.12 | |
| PRK12829 | 264 | short chain dehydrogenase; Provisional | 99.12 | |
| PRK08220 | 252 | 2,3-dihydroxybenzoate-2,3-dehydrogenase; Validated | 99.12 | |
| PRK08263 | 275 | short chain dehydrogenase; Provisional | 99.12 | |
| KOG4169 | 261 | consensus 15-hydroxyprostaglandin dehydrogenase an | 99.11 | |
| TIGR03589 | 324 | PseB UDP-N-acetylglucosamine 4,6-dehydratase. This | 99.11 | |
| PF13460 | 183 | NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X | 99.1 | |
| PRK09730 | 247 | putative NAD(P)-binding oxidoreductase; Provisiona | 99.1 | |
| PLN02166 | 436 | dTDP-glucose 4,6-dehydratase | 99.1 | |
| PRK08177 | 225 | short chain dehydrogenase; Provisional | 99.1 | |
| PRK06484 | 520 | short chain dehydrogenase; Validated | 99.09 | |
| TIGR01829 | 242 | AcAcCoA_reduct acetoacetyl-CoA reductase. (R)-3-hy | 99.08 | |
| PLN02572 | 442 | UDP-sulfoquinovose synthase | 99.08 | |
| PRK07424 | 406 | bifunctional sterol desaturase/short chain dehydro | 99.08 | |
| PRK07831 | 262 | short chain dehydrogenase; Provisional | 99.08 | |
| PRK08690 | 261 | enoyl-(acyl carrier protein) reductase; Provisiona | 99.08 | |
| TIGR01500 | 256 | sepiapter_red sepiapterin reductase. This model de | 99.08 | |
| PRK08219 | 227 | short chain dehydrogenase; Provisional | 99.07 | |
| PRK08159 | 272 | enoyl-(acyl carrier protein) reductase; Provisiona | 99.06 | |
| PRK05884 | 223 | short chain dehydrogenase; Provisional | 99.05 | |
| PRK07889 | 256 | enoyl-(acyl carrier protein) reductase; Provisiona | 99.05 | |
| TIGR01830 | 239 | 3oxo_ACP_reduc 3-oxoacyl-(acyl-carrier-protein) re | 99.04 | |
| PRK10675 | 338 | UDP-galactose-4-epimerase; Provisional | 99.04 | |
| PRK06603 | 260 | enoyl-(acyl carrier protein) reductase; Provisiona | 99.04 | |
| PRK08017 | 256 | oxidoreductase; Provisional | 99.04 | |
| PRK11908 | 347 | NAD-dependent epimerase/dehydratase family protein | 99.03 | |
| KOG1014 | 312 | consensus 17 beta-hydroxysteroid dehydrogenase typ | 99.03 | |
| TIGR02685 | 267 | pter_reduc_Leis pteridine reductase. Pteridine red | 99.03 | |
| PRK08125 | 660 | bifunctional UDP-glucuronic acid decarboxylase/UDP | 99.03 | |
| PRK05693 | 274 | short chain dehydrogenase; Provisional | 99.03 | |
| PLN00015 | 308 | protochlorophyllide reductase | 99.02 | |
| PRK07060 | 245 | short chain dehydrogenase; Provisional | 99.02 | |
| PRK07832 | 272 | short chain dehydrogenase; Provisional | 99.01 | |
| smart00822 | 180 | PKS_KR This enzymatic domain is part of bacterial | 99.01 | |
| PRK06484 | 520 | short chain dehydrogenase; Validated | 99.0 | |
| PRK10217 | 355 | dTDP-glucose 4,6-dehydratase; Provisional | 98.99 | |
| COG0451 | 314 | WcaG Nucleoside-diphosphate-sugar epimerases [Cell | 98.99 | |
| TIGR02632 | 676 | RhaD_aldol-ADH rhamnulose-1-phosphate aldolase/alc | 98.99 | |
| PF08659 | 181 | KR: KR domain; InterPro: IPR013968 This domain is | 98.98 | |
| PLN02695 | 370 | GDP-D-mannose-3',5'-epimerase | 98.97 | |
| PRK08324 | 681 | short chain dehydrogenase; Validated | 98.96 | |
| TIGR03466 | 328 | HpnA hopanoid-associated sugar epimerase. The sequ | 98.96 | |
| PLN02260 | 668 | probable rhamnose biosynthetic enzyme | 98.96 | |
| PF01370 | 236 | Epimerase: NAD dependent epimerase/dehydratase fam | 98.96 | |
| KOG1611 | 249 | consensus Predicted short chain-type dehydrogenase | 98.95 | |
| PRK12859 | 256 | 3-ketoacyl-(acyl-carrier-protein) reductase; Provi | 98.95 | |
| PRK07041 | 230 | short chain dehydrogenase; Provisional | 98.95 | |
| PRK06953 | 222 | short chain dehydrogenase; Provisional | 98.95 | |
| PRK12742 | 237 | oxidoreductase; Provisional | 98.93 | |
| PRK12320 | 699 | hypothetical protein; Provisional | 98.93 | |
| PRK07069 | 251 | short chain dehydrogenase; Validated | 98.92 | |
| COG1028 | 251 | FabG Dehydrogenases with different specificities ( | 98.91 | |
| TIGR01746 | 367 | Thioester-redct thioester reductase domain. It has | 98.91 | |
| KOG1429 | 350 | consensus dTDP-glucose 4-6-dehydratase/UDP-glucuro | 98.9 | |
| COG1088 | 340 | RfbB dTDP-D-glucose 4,6-dehydratase [Cell envelope | 98.89 | |
| PRK12367 | 245 | short chain dehydrogenase; Provisional | 98.89 | |
| PRK06997 | 260 | enoyl-(acyl carrier protein) reductase; Provisiona | 98.89 | |
| PF01073 | 280 | 3Beta_HSD: 3-beta hydroxysteroid dehydrogenase/iso | 98.89 | |
| PRK09009 | 235 | C factor cell-cell signaling protein; Provisional | 98.89 | |
| PRK07201 | 657 | short chain dehydrogenase; Provisional | 98.88 | |
| COG1086 | 588 | Predicted nucleoside-diphosphate sugar epimerases | 98.88 | |
| PLN02730 | 303 | enoyl-[acyl-carrier-protein] reductase | 98.87 | |
| TIGR01181 | 317 | dTDP_gluc_dehyt dTDP-glucose 4,6-dehydratase. This | 98.87 | |
| TIGR03649 | 285 | ergot_EASG ergot alkaloid biosynthesis protein, AF | 98.87 | |
| PRK07577 | 234 | short chain dehydrogenase; Provisional | 98.87 | |
| PRK08309 | 177 | short chain dehydrogenase; Provisional | 98.85 | |
| KOG1200 | 256 | consensus Mitochondrial/plastidial beta-ketoacyl-A | 98.85 | |
| PRK10084 | 352 | dTDP-glucose 4,6 dehydratase; Provisional | 98.84 | |
| TIGR01777 | 292 | yfcH conserved hypothetical protein TIGR01777. Thi | 98.82 | |
| TIGR01179 | 328 | galE UDP-glucose-4-epimerase. This enzyme intercon | 98.82 | |
| COG0702 | 275 | Predicted nucleoside-diphosphate-sugar epimerases | 98.8 | |
| PRK08261 | 450 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 98.75 | |
| PLN02996 | 491 | fatty acyl-CoA reductase | 98.74 | |
| KOG1430 | 361 | consensus C-3 sterol dehydrogenase/3-beta-hydroxys | 98.73 | |
| PF07993 | 249 | NAD_binding_4: Male sterility protein; InterPro: I | 98.73 | |
| PRK05865 | 854 | hypothetical protein; Provisional | 98.72 | |
| PLN00016 | 378 | RNA-binding protein; Provisional | 98.71 | |
| PF02719 | 293 | Polysacc_synt_2: Polysaccharide biosynthesis prote | 98.71 | |
| PLN02778 | 298 | 3,5-epimerase/4-reductase | 98.7 | |
| PLN02503 | 605 | fatty acyl-CoA reductase 2 | 98.69 | |
| PRK09987 | 299 | dTDP-4-dehydrorhamnose reductase; Provisional | 98.66 | |
| PRK11150 | 308 | rfaD ADP-L-glycero-D-mannoheptose-6-epimerase; Pro | 98.65 | |
| COG1090 | 297 | Predicted nucleoside-diphosphate sugar epimerase [ | 98.63 | |
| KOG1478 | 341 | consensus 3-keto sterol reductase [Lipid transport | 98.62 | |
| TIGR01214 | 287 | rmlD dTDP-4-dehydrorhamnose reductase. This enzyme | 98.6 | |
| COG2910 | 211 | Putative NADH-flavin reductase [General function p | 98.6 | |
| PF05368 | 233 | NmrA: NmrA-like family; InterPro: IPR008030 NmrA i | 98.55 | |
| PRK13656 | 398 | trans-2-enoyl-CoA reductase; Provisional | 98.53 | |
| PRK07578 | 199 | short chain dehydrogenase; Provisional | 98.52 | |
| PRK06300 | 299 | enoyl-(acyl carrier protein) reductase; Provisiona | 98.52 | |
| KOG1207 | 245 | consensus Diacetyl reductase/L-xylulose reductase | 98.52 | |
| KOG1210 | 331 | consensus Predicted 3-ketosphinganine reductase [S | 98.48 | |
| PF04321 | 286 | RmlD_sub_bind: RmlD substrate binding domain; Inte | 98.47 | |
| KOG1610 | 322 | consensus Corticosteroid 11-beta-dehydrogenase and | 98.47 | |
| KOG1199 | 260 | consensus Short-chain alcohol dehydrogenase/3-hydr | 98.45 | |
| KOG1209 | 289 | consensus 1-Acyl dihydroxyacetone phosphate reduct | 98.44 | |
| COG3320 | 382 | Putative dehydrogenase domain of multifunctional n | 98.44 | |
| TIGR02197 | 314 | heptose_epim ADP-L-glycero-D-manno-heptose-6-epime | 98.44 | |
| PRK12548 | 289 | shikimate 5-dehydrogenase; Provisional | 98.41 | |
| TIGR02813 | 2582 | omega_3_PfaA polyketide-type polyunsaturated fatty | 98.41 | |
| cd01078 | 194 | NAD_bind_H4MPT_DH NADP binding domain of methylene | 98.39 | |
| COG1089 | 345 | Gmd GDP-D-mannose dehydratase [Cell envelope bioge | 98.33 | |
| COG1748 | 389 | LYS9 Saccharopine dehydrogenase and related protei | 98.32 | |
| PRK09620 | 229 | hypothetical protein; Provisional | 98.31 | |
| TIGR03443 | 1389 | alpha_am_amid L-aminoadipate-semialdehyde dehydrog | 98.3 | |
| PF13561 | 241 | adh_short_C2: Enoyl-(Acyl carrier protein) reducta | 98.26 | |
| PRK14106 | 450 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn | 98.25 | |
| PRK05579 | 399 | bifunctional phosphopantothenoylcysteine decarboxy | 98.21 | |
| PRK02472 | 447 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn | 98.13 | |
| PLN02725 | 306 | GDP-4-keto-6-deoxymannose-3,5-epimerase-4-reductas | 98.11 | |
| PF01488 | 135 | Shikimate_DH: Shikimate / quinate 5-dehydrogenase; | 98.1 | |
| PLN02260 | 668 | probable rhamnose biosynthetic enzyme | 98.09 | |
| PRK14982 | 340 | acyl-ACP reductase; Provisional | 98.03 | |
| PRK06849 | 389 | hypothetical protein; Provisional | 97.93 | |
| KOG1203 | 411 | consensus Predicted dehydrogenase [Carbohydrate tr | 97.92 | |
| KOG1221 | 467 | consensus Acyl-CoA reductase [Lipid transport and | 97.89 | |
| TIGR01915 | 219 | npdG NADPH-dependent F420 reductase. This model re | 97.87 | |
| KOG2865 | 391 | consensus NADH:ubiquinone oxidoreductase, NDUFA9/3 | 97.84 | |
| PF03435 | 386 | Saccharop_dh: Saccharopine dehydrogenase ; InterPr | 97.8 | |
| PRK00258 | 278 | aroE shikimate 5-dehydrogenase; Reviewed | 97.77 | |
| cd01336 | 325 | MDH_cytoplasmic_cytosolic Cytoplasmic and cytosoli | 97.76 | |
| COG0569 | 225 | TrkA K+ transport systems, NAD-binding component [ | 97.72 | |
| PRK06732 | 229 | phosphopantothenate--cysteine ligase; Validated | 97.71 | |
| PLN02520 | 529 | bifunctional 3-dehydroquinate dehydratase/shikimat | 97.68 | |
| TIGR00715 | 256 | precor6x_red precorrin-6x reductase. This enzyme w | 97.67 | |
| COG1091 | 281 | RfbD dTDP-4-dehydrorhamnose reductase [Cell envelo | 97.67 | |
| TIGR00507 | 270 | aroE shikimate 5-dehydrogenase. This model finds p | 97.64 | |
| cd01075 | 200 | NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of l | 97.64 | |
| PRK09496 | 453 | trkA potassium transporter peripheral membrane com | 97.64 | |
| PRK08655 | 437 | prephenate dehydrogenase; Provisional | 97.63 | |
| TIGR00521 | 390 | coaBC_dfp phosphopantothenoylcysteine decarboxylas | 97.61 | |
| KOG0747 | 331 | consensus Putative NAD+-dependent epimerases [Carb | 97.61 | |
| PRK09496 | 453 | trkA potassium transporter peripheral membrane com | 97.59 | |
| PRK07819 | 286 | 3-hydroxybutyryl-CoA dehydrogenase; Validated | 97.53 | |
| cd01065 | 155 | NAD_bind_Shikimate_DH NAD(P) binding domain of Shi | 97.53 | |
| PF01118 | 121 | Semialdhyde_dh: Semialdehyde dehydrogenase, NAD bi | 97.51 | |
| TIGR02114 | 227 | coaB_strep phosphopantothenate--cysteine ligase, s | 97.5 | |
| PRK06249 | 313 | 2-dehydropantoate 2-reductase; Provisional | 97.5 | |
| PF02737 | 180 | 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD bind | 97.48 | |
| PRK14874 | 334 | aspartate-semialdehyde dehydrogenase; Provisional | 97.46 | |
| KOG1372 | 376 | consensus GDP-mannose 4,6 dehydratase [Carbohydrat | 97.46 | |
| PRK11199 | 374 | tyrA bifunctional chorismate mutase/prephenate deh | 97.43 | |
| COG0623 | 259 | FabI Enoyl-[acyl-carrier-protein] | 97.42 | |
| COG2085 | 211 | Predicted dinucleotide-binding enzymes [General fu | 97.41 | |
| PRK06129 | 308 | 3-hydroxyacyl-CoA dehydrogenase; Validated | 97.35 | |
| PRK04308 | 445 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn | 97.32 | |
| PRK08664 | 349 | aspartate-semialdehyde dehydrogenase; Reviewed | 97.31 | |
| cd01080 | 168 | NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of | 97.28 | |
| PLN02968 | 381 | Probable N-acetyl-gamma-glutamyl-phosphate reducta | 97.26 | |
| PRK06444 | 197 | prephenate dehydrogenase; Provisional | 97.26 | |
| PRK06718 | 202 | precorrin-2 dehydrogenase; Reviewed | 97.25 | |
| PF00056 | 141 | Ldh_1_N: lactate/malate dehydrogenase, NAD binding | 97.24 | |
| PRK09310 | 477 | aroDE bifunctional 3-dehydroquinate dehydratase/sh | 97.24 | |
| TIGR02853 | 287 | spore_dpaA dipicolinic acid synthetase, A subunit. | 97.19 | |
| PF12242 | 78 | Eno-Rase_NADH_b: NAD(P)H binding domain of trans-2 | 97.17 | |
| PRK00066 | 315 | ldh L-lactate dehydrogenase; Reviewed | 97.16 | |
| TIGR01470 | 205 | cysG_Nterm siroheme synthase, N-terminal domain. T | 97.13 | |
| KOG2733 | 423 | consensus Uncharacterized membrane protein [Functi | 97.13 | |
| PF13241 | 103 | NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_ | 97.12 | |
| PRK00436 | 343 | argC N-acetyl-gamma-glutamyl-phosphate reductase; | 97.11 | |
| PF01113 | 124 | DapB_N: Dihydrodipicolinate reductase, N-terminus; | 97.11 | |
| PRK05671 | 336 | aspartate-semialdehyde dehydrogenase; Reviewed | 97.09 | |
| PRK14188 | 296 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 97.08 | |
| PRK06522 | 304 | 2-dehydropantoate 2-reductase; Reviewed | 97.06 | |
| PRK04148 | 134 | hypothetical protein; Provisional | 97.06 | |
| KOG4039 | 238 | consensus Serine/threonine kinase TIP30/CC3 [Signa | 97.03 | |
| cd08259 | 332 | Zn_ADH5 Alcohol dehydrogenases of the MDR family. | 96.99 | |
| cd05212 | 140 | NAD_bind_m-THF_DH_Cyclohyd_like NAD(P) binding dom | 96.99 | |
| PRK12549 | 284 | shikimate 5-dehydrogenase; Reviewed | 96.98 | |
| PRK05086 | 312 | malate dehydrogenase; Provisional | 96.97 | |
| PRK14175 | 286 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 96.97 | |
| PRK07530 | 292 | 3-hydroxybutyryl-CoA dehydrogenase; Validated | 96.96 | |
| cd08295 | 338 | double_bond_reductase_like Arabidopsis alkenal dou | 96.96 | |
| PRK14192 | 283 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 96.95 | |
| PRK01438 | 480 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn | 96.95 | |
| PF03446 | 163 | NAD_binding_2: NAD binding domain of 6-phosphogluc | 96.93 | |
| PLN00106 | 323 | malate dehydrogenase | 96.93 | |
| COG0240 | 329 | GpsA Glycerol-3-phosphate dehydrogenase [Energy pr | 96.93 | |
| KOG1431 | 315 | consensus GDP-L-fucose synthetase [Carbohydrate tr | 96.92 | |
| cd08294 | 329 | leukotriene_B4_DH_like 13-PGR is a bifunctional en | 96.9 | |
| TIGR02354 | 200 | thiF_fam2 thiamine biosynthesis protein ThiF, fami | 96.89 | |
| cd05294 | 309 | LDH-like_MDH_nadp A lactate dehydrogenases-like st | 96.89 | |
| PRK14194 | 301 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 96.89 | |
| COG5322 | 351 | Predicted dehydrogenase [General function predicti | 96.87 | |
| PRK09260 | 288 | 3-hydroxybutyryl-CoA dehydrogenase; Validated | 96.87 | |
| PF02254 | 116 | TrkA_N: TrkA-N domain; InterPro: IPR003148 The reg | 96.86 | |
| PRK14619 | 308 | NAD(P)H-dependent glycerol-3-phosphate dehydrogena | 96.85 | |
| PRK07688 | 339 | thiamine/molybdopterin biosynthesis ThiF/MoeB-like | 96.85 | |
| PRK05690 | 245 | molybdopterin biosynthesis protein MoeB; Provision | 96.83 | |
| PTZ00325 | 321 | malate dehydrogenase; Provisional | 96.8 | |
| TIGR02825 | 325 | B4_12hDH leukotriene B4 12-hydroxydehydrogenase/15 | 96.8 | |
| PRK00094 | 325 | gpsA NAD(P)H-dependent glycerol-3-phosphate dehydr | 96.78 | |
| cd05276 | 323 | p53_inducible_oxidoreductase PIG3 p53-inducible qu | 96.77 | |
| PRK08306 | 296 | dipicolinate synthase subunit A; Reviewed | 96.77 | |
| PF02826 | 178 | 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehy | 96.77 | |
| PRK12475 | 338 | thiamine/molybdopterin biosynthesis MoeB-like prot | 96.77 | |
| cd05191 | 86 | NAD_bind_amino_acid_DH NAD(P) binding domain of am | 96.76 | |
| cd05291 | 306 | HicDH_like L-2-hydroxyisocapronate dehydrogenases | 96.74 | |
| PRK07417 | 279 | arogenate dehydrogenase; Reviewed | 96.73 | |
| cd08253 | 325 | zeta_crystallin Zeta-crystallin with NADP-dependen | 96.72 | |
| PRK14027 | 283 | quinate/shikimate dehydrogenase; Provisional | 96.71 | |
| PRK14618 | 328 | NAD(P)H-dependent glycerol-3-phosphate dehydrogena | 96.7 | |
| PRK11064 | 415 | wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Pro | 96.69 | |
| cd08293 | 345 | PTGR2 Prostaglandin reductase. Prostaglandins and | 96.69 | |
| PRK08293 | 287 | 3-hydroxybutyryl-CoA dehydrogenase; Validated | 96.69 | |
| PF03721 | 185 | UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogen | 96.69 | |
| PLN02545 | 295 | 3-hydroxybutyryl-CoA dehydrogenase | 96.67 | |
| TIGR01809 | 282 | Shik-DH-AROM shikimate-5-dehydrogenase, fungal ARO | 96.67 | |
| PLN03154 | 348 | putative allyl alcohol dehydrogenase; Provisional | 96.66 | |
| COG0287 | 279 | TyrA Prephenate dehydrogenase [Amino acid transpor | 96.66 | |
| PF02882 | 160 | THF_DHG_CYH_C: Tetrahydrofolate dehydrogenase/cycl | 96.65 | |
| KOG1198 | 347 | consensus Zinc-binding oxidoreductase [Energy prod | 96.63 | |
| COG0604 | 326 | Qor NADPH:quinone reductase and related Zn-depende | 96.59 | |
| PRK08268 | 507 | 3-hydroxy-acyl-CoA dehydrogenase; Validated | 96.59 | |
| PLN02383 | 344 | aspartate semialdehyde dehydrogenase | 96.57 | |
| PRK06719 | 157 | precorrin-2 dehydrogenase; Validated | 96.56 | |
| cd00704 | 323 | MDH Malate dehydrogenase. Malate dehydrogenase (MD | 96.55 | |
| PRK02006 | 498 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn | 96.55 | |
| cd01483 | 143 | E1_enzyme_family Superfamily of activating enzymes | 96.54 | |
| PRK05442 | 326 | malate dehydrogenase; Provisional | 96.53 | |
| cd01338 | 322 | MDH_choloroplast_like Chloroplast-like malate dehy | 96.49 | |
| PRK06130 | 311 | 3-hydroxybutyryl-CoA dehydrogenase; Validated | 96.49 | |
| cd08266 | 342 | Zn_ADH_like1 Alcohol dehydrogenases of the MDR fam | 96.49 | |
| cd08268 | 328 | MDR2 Medium chain dehydrogenases/reductase (MDR)/z | 96.49 | |
| TIGR01850 | 346 | argC N-acetyl-gamma-glutamyl-phosphate reductase, | 96.48 | |
| PRK14620 | 326 | NAD(P)H-dependent glycerol-3-phosphate dehydrogena | 96.48 | |
| COG0169 | 283 | AroE Shikimate 5-dehydrogenase [Amino acid transpo | 96.47 | |
| PRK06035 | 291 | 3-hydroxyacyl-CoA dehydrogenase; Validated | 96.47 | |
| TIGR01035 | 417 | hemA glutamyl-tRNA reductase. This enzyme, togethe | 96.46 | |
| PF01210 | 157 | NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate | 96.45 | |
| TIGR02356 | 202 | adenyl_thiF thiazole biosynthesis adenylyltransfer | 96.44 | |
| TIGR01296 | 339 | asd_B aspartate-semialdehyde dehydrogenase (peptid | 96.43 | |
| PRK07531 | 495 | bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioe | 96.41 | |
| cd01485 | 198 | E1-1_like Ubiquitin activating enzyme (E1), repeat | 96.4 | |
| PLN02256 | 304 | arogenate dehydrogenase | 96.4 | |
| PRK07066 | 321 | 3-hydroxybutyryl-CoA dehydrogenase; Validated | 96.39 | |
| PRK13243 | 333 | glyoxylate reductase; Reviewed | 96.39 | |
| cd01337 | 310 | MDH_glyoxysomal_mitochondrial Glyoxysomal and mito | 96.38 | |
| PRK05808 | 282 | 3-hydroxybutyryl-CoA dehydrogenase; Validated | 96.37 | |
| PRK00141 | 473 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn | 96.37 | |
| PRK10669 | 558 | putative cation:proton antiport protein; Provision | 96.37 | |
| PF12076 | 164 | Wax2_C: WAX2 C-terminal domain; InterPro: IPR02194 | 96.36 | |
| PRK06223 | 307 | malate dehydrogenase; Reviewed | 96.35 | |
| PRK05476 | 425 | S-adenosyl-L-homocysteine hydrolase; Provisional | 96.34 | |
| PRK08229 | 341 | 2-dehydropantoate 2-reductase; Provisional | 96.34 | |
| cd05311 | 226 | NAD_bind_2_malic_enz NAD(P) binding domain of mali | 96.32 | |
| PRK12749 | 288 | quinate/shikimate dehydrogenase; Reviewed | 96.32 | |
| TIGR02279 | 503 | PaaC-3OHAcCoADH 3-hydroxyacyl-CoA dehydrogenase Pa | 96.31 | |
| cd00757 | 228 | ThiF_MoeB_HesA_family ThiF_MoeB_HesA. Family of E1 | 96.3 | |
| PRK13940 | 414 | glutamyl-tRNA reductase; Provisional | 96.29 | |
| TIGR02824 | 325 | quinone_pig3 putative NAD(P)H quinone oxidoreducta | 96.28 | |
| PRK10792 | 285 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 96.28 | |
| PRK12550 | 272 | shikimate 5-dehydrogenase; Reviewed | 96.28 | |
| cd08289 | 326 | MDR_yhfp_like Yhfp putative quinone oxidoreductase | 96.26 | |
| KOG0409 | 327 | consensus Predicted dehydrogenase [General functio | 96.25 | |
| PTZ00117 | 319 | malate dehydrogenase; Provisional | 96.25 | |
| PRK07502 | 307 | cyclohexadienyl dehydrogenase; Validated | 96.25 | |
| TIGR00978 | 341 | asd_EA aspartate-semialdehyde dehydrogenase (non-p | 96.22 | |
| PF04127 | 185 | DFP: DNA / pantothenate metabolism flavoprotein; I | 96.22 | |
| PRK11559 | 296 | garR tartronate semialdehyde reductase; Provisiona | 96.2 | |
| PRK08644 | 212 | thiamine biosynthesis protein ThiF; Provisional | 96.2 | |
| COG1064 | 339 | AdhP Zn-dependent alcohol dehydrogenases [General | 96.2 | |
| PRK05597 | 355 | molybdopterin biosynthesis protein MoeB; Validated | 96.19 | |
| KOG4022 | 236 | consensus Dihydropteridine reductase DHPR/QDPR [Am | 96.19 | |
| cd08250 | 329 | Mgc45594_like Mgc45594 gene product and other MDR | 96.19 | |
| cd05292 | 308 | LDH_2 A subgroup of L-lactate dehydrogenases. L-la | 96.18 | |
| PRK14179 | 284 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 96.18 | |
| cd00650 | 263 | LDH_MDH_like NAD-dependent, lactate dehydrogenase- | 96.17 | |
| TIGR03201 | 349 | dearomat_had 6-hydroxycyclohex-1-ene-1-carbonyl-Co | 96.17 | |
| PTZ00345 | 365 | glycerol-3-phosphate dehydrogenase; Provisional | 96.16 | |
| TIGR01758 | 324 | MDH_euk_cyt malate dehydrogenase, NAD-dependent. T | 96.14 | |
| cd01487 | 174 | E1_ThiF_like E1_ThiF_like. Member of superfamily o | 96.13 | |
| PRK12409 | 410 | D-amino acid dehydrogenase small subunit; Provisio | 96.12 | |
| PF03807 | 96 | F420_oxidored: NADP oxidoreductase coenzyme F420-d | 96.12 | |
| PRK13236 | 296 | nitrogenase reductase; Reviewed | 96.11 | |
| PF00899 | 135 | ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-a | 96.1 | |
| TIGR01759 | 323 | MalateDH-SF1 malate dehydrogenase. This model repr | 96.1 | |
| PRK11880 | 267 | pyrroline-5-carboxylate reductase; Reviewed | 96.08 | |
| COG0665 | 387 | DadA Glycine/D-amino acid oxidases (deaminating) [ | 96.07 | |
| PRK12480 | 330 | D-lactate dehydrogenase; Provisional | 96.06 | |
| cd05288 | 329 | PGDH Prostaglandin dehydrogenases. Prostaglandins | 96.06 | |
| PRK09880 | 343 | L-idonate 5-dehydrogenase; Provisional | 96.04 | |
| PRK14189 | 285 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 96.03 | |
| COG0039 | 313 | Mdh Malate/lactate dehydrogenases [Energy producti | 96.03 | |
| COG0190 | 283 | FolD 5,10-methylene-tetrahydrofolate dehydrogenase | 96.03 | |
| PRK07236 | 386 | hypothetical protein; Provisional | 96.03 | |
| cd01079 | 197 | NAD_bind_m-THF_DH NAD binding domain of methylene- | 96.02 | |
| PRK13982 | 475 | bifunctional SbtC-like/phosphopantothenoylcysteine | 96.02 | |
| cd05188 | 271 | MDR Medium chain reductase/dehydrogenase (MDR)/zin | 96.02 | |
| PRK00045 | 423 | hemA glutamyl-tRNA reductase; Reviewed | 96.01 | |
| PRK13886 | 241 | conjugal transfer protein TraL; Provisional | 96.0 | |
| PLN00203 | 519 | glutamyl-tRNA reductase | 95.99 | |
| PLN02712 | 667 | arogenate dehydrogenase | 95.99 | |
| PRK14177 | 284 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 95.99 | |
| PRK14176 | 287 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 95.98 | |
| PRK07494 | 388 | 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio | 95.98 | |
| PRK08818 | 370 | prephenate dehydrogenase; Provisional | 95.97 | |
| cd08270 | 305 | MDR4 Medium chain dehydrogenases/reductase (MDR)/z | 95.97 | |
| TIGR01772 | 312 | MDH_euk_gproteo malate dehydrogenase, NAD-dependen | 95.96 | |
| TIGR00872 | 298 | gnd_rel 6-phosphogluconate dehydrogenase (decarbox | 95.95 | |
| TIGR03026 | 411 | NDP-sugDHase nucleotide sugar dehydrogenase. All o | 95.94 | |
| PRK08163 | 396 | salicylate hydroxylase; Provisional | 95.93 | |
| PRK14191 | 285 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 95.92 | |
| cd08241 | 323 | QOR1 Quinone oxidoreductase (QOR). QOR catalyzes t | 95.92 | |
| PRK06728 | 347 | aspartate-semialdehyde dehydrogenase; Provisional | 95.91 | |
| PTZ00082 | 321 | L-lactate dehydrogenase; Provisional | 95.9 | |
| cd01492 | 197 | Aos1_SUMO Ubiquitin activating enzyme (E1) subunit | 95.9 | |
| TIGR00518 | 370 | alaDH alanine dehydrogenase. The family of known L | 95.9 | |
| cd08244 | 324 | MDR_enoyl_red Possible enoyl reductase. Member ide | 95.88 | |
| cd08292 | 324 | ETR_like_2 2-enoyl thioester reductase (ETR) like | 95.88 | |
| TIGR02822 | 329 | adh_fam_2 zinc-binding alcohol dehydrogenase famil | 95.88 | |
| PRK12767 | 326 | carbamoyl phosphate synthase-like protein; Provisi | 95.88 | |
| KOG1204 | 253 | consensus Predicted dehydrogenase [Secondary metab | 95.87 | |
| PRK03659 | 601 | glutathione-regulated potassium-efflux system prot | 95.86 | |
| PF00208 | 244 | ELFV_dehydrog: Glutamate/Leucine/Phenylalanine/Val | 95.85 | |
| PF00070 | 80 | Pyr_redox: Pyridine nucleotide-disulphide oxidored | 95.84 | |
| cd08243 | 320 | quinone_oxidoreductase_like_1 Quinone oxidoreducta | 95.84 | |
| cd05213 | 311 | NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain | 95.84 |
| >KOG1502 consensus Flavonol reductase/cinnamoyl-CoA reductase [Defense mechanisms] | Back alignment and domain information |
|---|
Probab=99.60 E-value=1e-14 Score=77.88 Aligned_cols=61 Identities=66% Similarity=1.061 Sum_probs=53.3
Q ss_pred CCeEEEEecCcchHHHHHHHHHHHCCCEEEEEEeCCCCcch-hHHhhhcCCCCceEEEEccC
Q 036468 4 KGKVVCVTGASGFIASWLVKLLLQRSYTVKATVRDLNNHNA-EHLLTLDGAEERLHLFKANS 64 (64)
Q Consensus 4 ~~~~~~i~g~~~~ig~~~~~~l~~~~~~v~~~~r~~~~~~~-~~~~~~~~~~~~~~~~~~Di 64 (64)
.++.|+||||+|+||++++++|+++||.|....|++++.+. .++.++.....++..+..|+
T Consensus 5 ~~~~VcVTGAsGfIgswivk~LL~rGY~V~gtVR~~~~~k~~~~L~~l~~a~~~l~l~~aDL 66 (327)
T KOG1502|consen 5 EGKKVCVTGASGFIGSWIVKLLLSRGYTVRGTVRDPEDEKKTEHLRKLEGAKERLKLFKADL 66 (327)
T ss_pred CCcEEEEeCCchHHHHHHHHHHHhCCCEEEEEEcCcchhhhHHHHHhcccCcccceEEeccc
Confidence 46789999999999999999999999999999999988554 46888877677788998886
|
|
| >PRK07478 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK05653 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated | Back alignment and domain information |
|---|
| >COG0300 DltE Short-chain dehydrogenases of various substrate specificities [General function prediction only] | Back alignment and domain information |
|---|
| >PRK06194 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK05867 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07231 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PLN02986 cinnamyl-alcohol dehydrogenase family protein | Back alignment and domain information |
|---|
| >PRK07890 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK09072 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06114 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK05866 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK05557 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated | Back alignment and domain information |
|---|
| >PRK07035 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06172 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07523 gluconate 5-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08862 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07453 protochlorophyllide oxidoreductase; Validated | Back alignment and domain information |
|---|
| >PLN02583 cinnamoyl-CoA reductase | Back alignment and domain information |
|---|
| >PRK13394 3-hydroxybutyrate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR01832 kduD 2-deoxy-D-gluconate 3-dehydrogenase | Back alignment and domain information |
|---|
| >PRK08085 gluconate 5-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK12429 3-hydroxybutyrate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08339 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08628 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07576 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PLN02662 cinnamyl-alcohol dehydrogenase family protein | Back alignment and domain information |
|---|
| >PRK12826 3-ketoacyl-(acyl-carrier-protein) reductase; Reviewed | Back alignment and domain information |
|---|
| >PRK07774 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06139 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PLN02650 dihydroflavonol-4-reductase | Back alignment and domain information |
|---|
| >PRK06138 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK05876 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK12481 2-deoxy-D-gluconate 3-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK12937 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07806 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PLN02989 cinnamyl-alcohol dehydrogenase family protein | Back alignment and domain information |
|---|
| >PRK07814 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06124 gluconate 5-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08277 D-mannonate oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK08589 short chain dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK07109 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06935 2-deoxy-D-gluconate 3-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK05854 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08278 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07063 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK12745 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >TIGR03325 BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase | Back alignment and domain information |
|---|
| >PRK07326 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08643 acetoin reductase; Validated | Back alignment and domain information |
|---|
| >PRK07097 gluconate 5-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07904 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07825 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06701 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08213 gluconate 5-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PLN02214 cinnamoyl-CoA reductase | Back alignment and domain information |
|---|
| >PRK07454 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06197 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK09134 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08265 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06720 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK07666 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK07062 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK05565 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK07024 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK12823 benD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK05786 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK06914 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07792 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK08217 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PLN02240 UDP-glucose 4-epimerase | Back alignment and domain information |
|---|
| >PRK12743 oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK07102 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06113 7-alpha-hydroxysteroid dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PLN02253 xanthoxin dehydrogenase | Back alignment and domain information |
|---|
| >PRK06128 oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK08251 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >COG3967 DltE Short-chain dehydrogenase involved in D-alanine esterification of lipoteichoic acid and wall teichoic acid (D-alanine transfer protein) [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >PRK08303 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07856 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PLN00198 anthocyanidin reductase; Provisional | Back alignment and domain information |
|---|
| >TIGR03206 benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydrogenase | Back alignment and domain information |
|---|
| >PRK06200 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06077 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK07067 sorbitol dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06101 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK12939 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR01472 gmd GDP-mannose 4,6-dehydratase | Back alignment and domain information |
|---|
| >TIGR01289 LPOR light-dependent protochlorophyllide reductase | Back alignment and domain information |
|---|
| >PRK05875 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >KOG0725 consensus Reductases with broad range of substrate specificities [General function prediction only] | Back alignment and domain information |
|---|
| >PRK07985 oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PLN02896 cinnamyl-alcohol dehydrogenase | Back alignment and domain information |
|---|
| >KOG1205 consensus Predicted dehydrogenase [Secondary metabolites biosynthesis, transport and catabolism] | Back alignment and domain information |
|---|
| >PRK05717 oxidoreductase; Validated | Back alignment and domain information |
|---|
| >PRK06949 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08340 glucose-1-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07370 enoyl-(acyl carrier protein) reductase; Validated | Back alignment and domain information |
|---|
| >TIGR02622 CDP_4_6_dhtase CDP-glucose 4,6-dehydratase | Back alignment and domain information |
|---|
| >PRK12825 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK06947 glucose-1-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK09242 tropinone reductase; Provisional | Back alignment and domain information |
|---|
| >PRK12744 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK09135 pteridine reductase; Provisional | Back alignment and domain information |
|---|
| >PRK07677 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08267 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06179 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08642 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK05650 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK09291 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08936 glucose-1-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK09186 flagellin modification protein A; Provisional | Back alignment and domain information |
|---|
| >PRK08226 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PLN02653 GDP-mannose 4,6-dehydratase | Back alignment and domain information |
|---|
| >TIGR01963 PHB_DH 3-hydroxybutyrate dehydrogenase | Back alignment and domain information |
|---|
| >PRK08993 2-deoxy-D-gluconate 3-dehydrogenase; Validated | Back alignment and domain information |
|---|
| >COG4221 Short-chain alcohol dehydrogenase of unknown specificity [General function prediction only] | Back alignment and domain information |
|---|
| >PRK06924 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK12828 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07791 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06125 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >KOG1201 consensus Hydroxysteroid 17-beta dehydrogenase 11 [Secondary metabolites biosynthesis, transport and catabolism] | Back alignment and domain information |
|---|
| >PRK08264 short chain dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK07775 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06196 oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK07533 enoyl-(acyl carrier protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK12827 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06171 sorbitol-6-phosphate 2-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK15181 Vi polysaccharide biosynthesis protein TviC; Provisional | Back alignment and domain information |
|---|
| >PRK08416 7-alpha-hydroxysteroid dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PLN02427 UDP-apiose/xylose synthase | Back alignment and domain information |
|---|
| >PRK06180 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06181 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08063 enoyl-(acyl carrier protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK08594 enoyl-(acyl carrier protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PLN02657 3,8-divinyl protochlorophyllide a 8-vinyl reductase | Back alignment and domain information |
|---|
| >KOG1208 consensus Dehydrogenases with different specificities (related to short-chain alcohol dehydrogenases) [Secondary metabolites biosynthesis, transport and catabolism] | Back alignment and domain information |
|---|
| >PRK07201 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PF00106 adh_short: short chain dehydrogenase alcohol dehydrogenase superfamily signature glucose/ribitol dehydrogenase family signature; InterPro: IPR002198 The short-chain dehydrogenases/reductases family (SDR) [] is a very large family of enzymes, most of which are known to be NAD- or NADP-dependent oxidoreductases | Back alignment and domain information |
|---|
| >PRK05872 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06500 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PLN02780 ketoreductase/ oxidoreductase | Back alignment and domain information |
|---|
| >PRK12748 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK12747 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06398 aldose dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK12384 sorbitol-6-phosphate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK12935 acetoacetyl-CoA reductase; Provisional | Back alignment and domain information |
|---|
| >PRK12746 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06198 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK12938 acetyacetyl-CoA reductase; Provisional | Back alignment and domain information |
|---|
| >PRK06123 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK12824 acetoacetyl-CoA reductase; Provisional | Back alignment and domain information |
|---|
| >TIGR02415 23BDH acetoin reductases | Back alignment and domain information |
|---|
| >PRK07074 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06079 enoyl-(acyl carrier protein) reductase; Provisional | Back alignment and domain information |
|---|
| >CHL00194 ycf39 Ycf39; Provisional | Back alignment and domain information |
|---|
| >PRK05855 short chain dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK06841 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK10538 malonic semialdehyde reductase; Provisional | Back alignment and domain information |
|---|
| >PRK08415 enoyl-(acyl carrier protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK06550 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK08703 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >KOG1371 consensus UDP-glucose 4-epimerase/UDP-sulfoquinovose synthase [Cell wall/membrane/envelope biogenesis] | Back alignment and domain information |
|---|
| >PRK05993 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07023 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PLN00141 Tic62-NAD(P)-related group II protein; Provisional | Back alignment and domain information |
|---|
| >PLN02686 cinnamoyl-CoA reductase | Back alignment and domain information |
|---|
| >PRK05599 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK06505 enoyl-(acyl carrier protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PLN02206 UDP-glucuronate decarboxylase | Back alignment and domain information |
|---|
| >PRK12936 3-ketoacyl-(acyl-carrier-protein) reductase NodG; Reviewed | Back alignment and domain information |
|---|
| >COG1087 GalE UDP-glucose 4-epimerase [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >PRK06523 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06182 short chain dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PLN03209 translocon at the inner envelope of chloroplast subunit 62; Provisional | Back alignment and domain information |
|---|
| >PRK06483 dihydromonapterin reductase; Provisional | Back alignment and domain information |
|---|
| >PRK07984 enoyl-(acyl carrier protein) reductase; Provisional | Back alignment and domain information |
|---|
| >TIGR01831 fabG_rel 3-oxoacyl-(acyl-carrier-protein) reductase, putative | Back alignment and domain information |
|---|
| >PRK08945 putative oxoacyl-(acyl carrier protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK06463 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK06940 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06057 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06482 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK12829 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08220 2,3-dihydroxybenzoate-2,3-dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK08263 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >KOG4169 consensus 15-hydroxyprostaglandin dehydrogenase and related dehydrogenases [Lipid transport and metabolism; General function prediction only] | Back alignment and domain information |
|---|
| >TIGR03589 PseB UDP-N-acetylglucosamine 4,6-dehydratase | Back alignment and domain information |
|---|
| >PF13460 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X_A 3GPI_A 3QVO_A 2Q46_B 1YBM_B 1XQ6_B 2Q4B_B 3EW7_A 3IUS_B | Back alignment and domain information |
|---|
| >PRK09730 putative NAD(P)-binding oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PLN02166 dTDP-glucose 4,6-dehydratase | Back alignment and domain information |
|---|
| >PRK08177 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06484 short chain dehydrogenase; Validated | Back alignment and domain information |
|---|
| >TIGR01829 AcAcCoA_reduct acetoacetyl-CoA reductase | Back alignment and domain information |
|---|
| >PLN02572 UDP-sulfoquinovose synthase | Back alignment and domain information |
|---|
| >PRK07424 bifunctional sterol desaturase/short chain dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK07831 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08690 enoyl-(acyl carrier protein) reductase; Provisional | Back alignment and domain information |
|---|
| >TIGR01500 sepiapter_red sepiapterin reductase | Back alignment and domain information |
|---|
| >PRK08219 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08159 enoyl-(acyl carrier protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK05884 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07889 enoyl-(acyl carrier protein) reductase; Provisional | Back alignment and domain information |
|---|
| >TIGR01830 3oxo_ACP_reduc 3-oxoacyl-(acyl-carrier-protein) reductase | Back alignment and domain information |
|---|
| >PRK10675 UDP-galactose-4-epimerase; Provisional | Back alignment and domain information |
|---|
| >PRK06603 enoyl-(acyl carrier protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK08017 oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK11908 NAD-dependent epimerase/dehydratase family protein; Provisional | Back alignment and domain information |
|---|
| >KOG1014 consensus 17 beta-hydroxysteroid dehydrogenase type 3, HSD17B3 [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR02685 pter_reduc_Leis pteridine reductase | Back alignment and domain information |
|---|
| >PRK08125 bifunctional UDP-glucuronic acid decarboxylase/UDP-4-amino-4-deoxy-L-arabinose formyltransferase; Validated | Back alignment and domain information |
|---|
| >PRK05693 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PLN00015 protochlorophyllide reductase | Back alignment and domain information |
|---|
| >PRK07060 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07832 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >smart00822 PKS_KR This enzymatic domain is part of bacterial polyketide synthases and catalyses the first step in the reductive modification of the beta-carbonyl centres in the growing polyketide chain | Back alignment and domain information |
|---|
| >PRK06484 short chain dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK10217 dTDP-glucose 4,6-dehydratase; Provisional | Back alignment and domain information |
|---|
| >COG0451 WcaG Nucleoside-diphosphate-sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR02632 RhaD_aldol-ADH rhamnulose-1-phosphate aldolase/alcohol dehydrogenase | Back alignment and domain information |
|---|
| >PF08659 KR: KR domain; InterPro: IPR013968 This domain is found in bacterial polyketide synthases that catalyse the first step in the reductive modification of the beta-carbonyl centres in the growing polyketide chain | Back alignment and domain information |
|---|
| >PLN02695 GDP-D-mannose-3',5'-epimerase | Back alignment and domain information |
|---|
| >PRK08324 short chain dehydrogenase; Validated | Back alignment and domain information |
|---|
| >TIGR03466 HpnA hopanoid-associated sugar epimerase | Back alignment and domain information |
|---|
| >PLN02260 probable rhamnose biosynthetic enzyme | Back alignment and domain information |
|---|
| >PF01370 Epimerase: NAD dependent epimerase/dehydratase family; InterPro: IPR001509 This family of proteins utilise NAD as a cofactor | Back alignment and domain information |
|---|
| >KOG1611 consensus Predicted short chain-type dehydrogenase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK12859 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK07041 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06953 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK12742 oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK12320 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK07069 short chain dehydrogenase; Validated | Back alignment and domain information |
|---|
| >COG1028 FabG Dehydrogenases with different specificities (related to short-chain alcohol dehydrogenases) [Secondary metabolites biosynthesis, transport, and catabolism / General function prediction only] | Back alignment and domain information |
|---|
| >TIGR01746 Thioester-redct thioester reductase domain | Back alignment and domain information |
|---|
| >KOG1429 consensus dTDP-glucose 4-6-dehydratase/UDP-glucuronic acid decarboxylase [Carbohydrate transport and metabolism; Cell wall/membrane/envelope biogenesis] | Back alignment and domain information |
|---|
| >COG1088 RfbB dTDP-D-glucose 4,6-dehydratase [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >PRK12367 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06997 enoyl-(acyl carrier protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PF01073 3Beta_HSD: 3-beta hydroxysteroid dehydrogenase/isomerase family; InterPro: IPR002225 The enzyme 3 beta-hydroxysteroid dehydrogenase/5-ene-4-ene isomerase (3 beta-HSD) catalyses the oxidation and isomerisation of 5-ene-3 beta-hydroxypregnene and 5-ene-hydroxyandrostene steroid precursors into the corresponding 4-ene-ketosteroids necessary for the formation of all classes of steroid hormones | Back alignment and domain information |
|---|
| >PRK09009 C factor cell-cell signaling protein; Provisional | Back alignment and domain information |
|---|
| >PRK07201 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >COG1086 Predicted nucleoside-diphosphate sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PLN02730 enoyl-[acyl-carrier-protein] reductase | Back alignment and domain information |
|---|
| >TIGR01181 dTDP_gluc_dehyt dTDP-glucose 4,6-dehydratase | Back alignment and domain information |
|---|
| >TIGR03649 ergot_EASG ergot alkaloid biosynthesis protein, AFUA_2G17970 family | Back alignment and domain information |
|---|
| >PRK07577 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08309 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >KOG1200 consensus Mitochondrial/plastidial beta-ketoacyl-ACP reductase [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK10084 dTDP-glucose 4,6 dehydratase; Provisional | Back alignment and domain information |
|---|
| >TIGR01777 yfcH conserved hypothetical protein TIGR01777 | Back alignment and domain information |
|---|
| >TIGR01179 galE UDP-glucose-4-epimerase | Back alignment and domain information |
|---|
| >COG0702 Predicted nucleoside-diphosphate-sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PRK08261 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PLN02996 fatty acyl-CoA reductase | Back alignment and domain information |
|---|
| >KOG1430 consensus C-3 sterol dehydrogenase/3-beta-hydroxysteroid dehydrogenase and related dehydrogenases [Lipid transport and metabolism; Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PF07993 NAD_binding_4: Male sterility protein; InterPro: IPR013120 This family represents the C-terminal NAD-binding region of the male sterility protein from Arabidopsis and Drosophila | Back alignment and domain information |
|---|
| >PRK05865 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PLN00016 RNA-binding protein; Provisional | Back alignment and domain information |
|---|
| >PF02719 Polysacc_synt_2: Polysaccharide biosynthesis protein; InterPro: IPR003869 This domain is found in diverse bacterial polysaccharide biosynthesis proteins including the CapD protein from Staphylococcus aureus [], the WalL protein, mannosyl-transferase [], and several putative epimerases | Back alignment and domain information |
|---|
| >PLN02778 3,5-epimerase/4-reductase | Back alignment and domain information |
|---|
| >PLN02503 fatty acyl-CoA reductase 2 | Back alignment and domain information |
|---|
| >PRK09987 dTDP-4-dehydrorhamnose reductase; Provisional | Back alignment and domain information |
|---|
| >PRK11150 rfaD ADP-L-glycero-D-mannoheptose-6-epimerase; Provisional | Back alignment and domain information |
|---|
| >COG1090 Predicted nucleoside-diphosphate sugar epimerase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1478 consensus 3-keto sterol reductase [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR01214 rmlD dTDP-4-dehydrorhamnose reductase | Back alignment and domain information |
|---|
| >COG2910 Putative NADH-flavin reductase [General function prediction only] | Back alignment and domain information |
|---|
| >PF05368 NmrA: NmrA-like family; InterPro: IPR008030 NmrA is a negative transcriptional regulator involved in the post-translational modification of the transcription factor AreA | Back alignment and domain information |
|---|
| >PRK13656 trans-2-enoyl-CoA reductase; Provisional | Back alignment and domain information |
|---|
| >PRK07578 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06300 enoyl-(acyl carrier protein) reductase; Provisional | Back alignment and domain information |
|---|
| >KOG1207 consensus Diacetyl reductase/L-xylulose reductase [Secondary metabolites biosynthesis, transport and catabolism] | Back alignment and domain information |
|---|
| >KOG1210 consensus Predicted 3-ketosphinganine reductase [Secondary metabolites biosynthesis, transport and catabolism] | Back alignment and domain information |
|---|
| >PF04321 RmlD_sub_bind: RmlD substrate binding domain; InterPro: IPR005913 dTDP-4-dehydrorhamnose reductase (1 | Back alignment and domain information |
|---|
| >KOG1610 consensus Corticosteroid 11-beta-dehydrogenase and related short chain-type dehydrogenases [Secondary metabolites biosynthesis, transport and catabolism; General function prediction only] | Back alignment and domain information |
|---|
| >KOG1199 consensus Short-chain alcohol dehydrogenase/3-hydroxyacyl-CoA dehydrogenase [Secondary metabolites biosynthesis, transport and catabolism] | Back alignment and domain information |
|---|
| >KOG1209 consensus 1-Acyl dihydroxyacetone phosphate reductase and related dehydrogenases [Secondary metabolites biosynthesis, transport and catabolism] | Back alignment and domain information |
|---|
| >COG3320 Putative dehydrogenase domain of multifunctional non-ribosomal peptide synthetases and related enzymes [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >TIGR02197 heptose_epim ADP-L-glycero-D-manno-heptose-6-epimerase | Back alignment and domain information |
|---|
| >PRK12548 shikimate 5-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR02813 omega_3_PfaA polyketide-type polyunsaturated fatty acid synthase PfaA | Back alignment and domain information |
|---|
| >cd01078 NAD_bind_H4MPT_DH NADP binding domain of methylene tetrahydromethanopterin dehydrogenase | Back alignment and domain information |
|---|
| >COG1089 Gmd GDP-D-mannose dehydratase [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >COG1748 LYS9 Saccharopine dehydrogenase and related proteins [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK09620 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03443 alpha_am_amid L-aminoadipate-semialdehyde dehydrogenase | Back alignment and domain information |
|---|
| >PF13561 adh_short_C2: Enoyl-(Acyl carrier protein) reductase; PDB: 2UV8_B 3HMJ_A 2VKZ_C 1O5I_A 2P91_C 2OP0_A 2OL4_B 1NHW_A 1NNU_B 2O2Y_B | Back alignment and domain information |
|---|
| >PRK14106 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK05579 bifunctional phosphopantothenoylcysteine decarboxylase/phosphopantothenate synthase; Validated | Back alignment and domain information |
|---|
| >PRK02472 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional | Back alignment and domain information |
|---|
| >PLN02725 GDP-4-keto-6-deoxymannose-3,5-epimerase-4-reductase | Back alignment and domain information |
|---|
| >PF01488 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; InterPro: IPR006151 This entry represents a domain found in shikimate and quinate dehydrogenases, as well as glutamyl-tRNA reductases | Back alignment and domain information |
|---|
| >PLN02260 probable rhamnose biosynthetic enzyme | Back alignment and domain information |
|---|
| >PRK14982 acyl-ACP reductase; Provisional | Back alignment and domain information |
|---|
| >PRK06849 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG1203 consensus Predicted dehydrogenase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >KOG1221 consensus Acyl-CoA reductase [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR01915 npdG NADPH-dependent F420 reductase | Back alignment and domain information |
|---|
| >KOG2865 consensus NADH:ubiquinone oxidoreductase, NDUFA9/39kDa subunit [Energy production and conversion] | Back alignment and domain information |
|---|
| >PF03435 Saccharop_dh: Saccharopine dehydrogenase ; InterPro: IPR005097 This entry represents saccharopine dehydrogenase and homospermidine synthase | Back alignment and domain information |
|---|
| >PRK00258 aroE shikimate 5-dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >cd01336 MDH_cytoplasmic_cytosolic Cytoplasmic and cytosolic Malate dehydrogenases | Back alignment and domain information |
|---|
| >COG0569 TrkA K+ transport systems, NAD-binding component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK06732 phosphopantothenate--cysteine ligase; Validated | Back alignment and domain information |
|---|
| >PLN02520 bifunctional 3-dehydroquinate dehydratase/shikimate dehydrogenase | Back alignment and domain information |
|---|
| >TIGR00715 precor6x_red precorrin-6x reductase | Back alignment and domain information |
|---|
| >COG1091 RfbD dTDP-4-dehydrorhamnose reductase [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >TIGR00507 aroE shikimate 5-dehydrogenase | Back alignment and domain information |
|---|
| >cd01075 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase | Back alignment and domain information |
|---|
| >PRK09496 trkA potassium transporter peripheral membrane component; Reviewed | Back alignment and domain information |
|---|
| >PRK08655 prephenate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR00521 coaBC_dfp phosphopantothenoylcysteine decarboxylase/phosphopantothenate--cysteine ligase, prokaryotic | Back alignment and domain information |
|---|
| >KOG0747 consensus Putative NAD+-dependent epimerases [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PRK09496 trkA potassium transporter peripheral membrane component; Reviewed | Back alignment and domain information |
|---|
| >PRK07819 3-hydroxybutyryl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >cd01065 NAD_bind_Shikimate_DH NAD(P) binding domain of Shikimate dehydrogenase | Back alignment and domain information |
|---|
| >PF01118 Semialdhyde_dh: Semialdehyde dehydrogenase, NAD binding domain; InterPro: IPR000534 The semialdehyde dehydrogenase family is found in N-acetyl-glutamine semialdehyde dehydrogenase (AgrC), which is involved in arginine biosynthesis, and aspartate-semialdehyde dehydrogenase [], an enzyme involved in the biosynthesis of various amino acids from aspartate | Back alignment and domain information |
|---|
| >TIGR02114 coaB_strep phosphopantothenate--cysteine ligase, streptococcal | Back alignment and domain information |
|---|
| >PRK06249 2-dehydropantoate 2-reductase; Provisional | Back alignment and domain information |
|---|
| >PF02737 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain; InterPro: IPR006176 3-hydroxyacyl-CoA dehydrogenase (1 | Back alignment and domain information |
|---|
| >PRK14874 aspartate-semialdehyde dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >KOG1372 consensus GDP-mannose 4,6 dehydratase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PRK11199 tyrA bifunctional chorismate mutase/prephenate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >COG0623 FabI Enoyl-[acyl-carrier-protein] | Back alignment and domain information |
|---|
| >COG2085 Predicted dinucleotide-binding enzymes [General function prediction only] | Back alignment and domain information |
|---|
| >PRK06129 3-hydroxyacyl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK04308 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK08664 aspartate-semialdehyde dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >cd01080 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of methylene-tetrahydrofolate dehydrogenase/cyclohydrolase | Back alignment and domain information |
|---|
| >PLN02968 Probable N-acetyl-gamma-glutamyl-phosphate reductase | Back alignment and domain information |
|---|
| >PRK06444 prephenate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06718 precorrin-2 dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PF00056 Ldh_1_N: lactate/malate dehydrogenase, NAD binding domain Prosite entry for lactate dehydrogenase Prosite entry for malate dehydrogenase; InterPro: IPR001236 L-lactate dehydrogenases are metabolic enzymes which catalyse the conversion of L-lactate to pyruvate, the last step in anaerobic glycolysis [] | Back alignment and domain information |
|---|
| >PRK09310 aroDE bifunctional 3-dehydroquinate dehydratase/shikimate dehydrogenase protein; Reviewed | Back alignment and domain information |
|---|
| >TIGR02853 spore_dpaA dipicolinic acid synthetase, A subunit | Back alignment and domain information |
|---|
| >PF12242 Eno-Rase_NADH_b: NAD(P)H binding domain of trans-2-enoyl-CoA reductase; PDB: 3ZU5_A 3ZU3_A 3ZU4_A 3ZU2_A 3S8M_A | Back alignment and domain information |
|---|
| >PRK00066 ldh L-lactate dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >TIGR01470 cysG_Nterm siroheme synthase, N-terminal domain | Back alignment and domain information |
|---|
| >KOG2733 consensus Uncharacterized membrane protein [Function unknown] | Back alignment and domain information |
|---|
| >PF13241 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_B 1PJT_A 1PJS_A 1PJQ_A 1KYQ_B | Back alignment and domain information |
|---|
| >PRK00436 argC N-acetyl-gamma-glutamyl-phosphate reductase; Validated | Back alignment and domain information |
|---|
| >PF01113 DapB_N: Dihydrodipicolinate reductase, N-terminus; InterPro: IPR000846 Dihydrodipicolinate reductase catalyzes the second step in the biosynthesis of diaminopimelic acid and lysine, the NAD or NADP-dependent reduction of 2,3-dihydrodipicolinate into 2,3,4,5-tetrahydrodipicolinate [, , ] | Back alignment and domain information |
|---|
| >PRK05671 aspartate-semialdehyde dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PRK14188 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK06522 2-dehydropantoate 2-reductase; Reviewed | Back alignment and domain information |
|---|
| >PRK04148 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG4039 consensus Serine/threonine kinase TIP30/CC3 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd08259 Zn_ADH5 Alcohol dehydrogenases of the MDR family | Back alignment and domain information |
|---|
| >cd05212 NAD_bind_m-THF_DH_Cyclohyd_like NAD(P) binding domain of methylene-tetrahydrofolate dehydrogenase and methylene-tetrahydrofolate dehydrogenase/cyclohydrolase | Back alignment and domain information |
|---|
| >PRK12549 shikimate 5-dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PRK05086 malate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK14175 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK07530 3-hydroxybutyryl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >cd08295 double_bond_reductase_like Arabidopsis alkenal double bond reductase and leukotriene B4 12-hydroxydehydrogenase | Back alignment and domain information |
|---|
| >PRK14192 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK01438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional | Back alignment and domain information |
|---|
| >PF03446 NAD_binding_2: NAD binding domain of 6-phosphogluconate dehydrogenase; InterPro: IPR006115 6-Phosphogluconate dehydrogenase (1 | Back alignment and domain information |
|---|
| >PLN00106 malate dehydrogenase | Back alignment and domain information |
|---|
| >COG0240 GpsA Glycerol-3-phosphate dehydrogenase [Energy production and conversion] | Back alignment and domain information |
|---|
| >KOG1431 consensus GDP-L-fucose synthetase [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd08294 leukotriene_B4_DH_like 13-PGR is a bifunctional enzyme with delta-13 15-prostaglandin reductase and leukotriene B4 12 hydroxydehydrogenase activity | Back alignment and domain information |
|---|
| >TIGR02354 thiF_fam2 thiamine biosynthesis protein ThiF, family 2 | Back alignment and domain information |
|---|
| >cd05294 LDH-like_MDH_nadp A lactate dehydrogenases-like structure with malate dehydrogenase enzymatic activity | Back alignment and domain information |
|---|
| >PRK14194 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >COG5322 Predicted dehydrogenase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK09260 3-hydroxybutyryl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PF02254 TrkA_N: TrkA-N domain; InterPro: IPR003148 The regulator of K+ conductance (RCK) domain is found in many ligand-gated K+ channels, most often attached to the intracellular carboxy terminus | Back alignment and domain information |
|---|
| >PRK14619 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07688 thiamine/molybdopterin biosynthesis ThiF/MoeB-like protein; Validated | Back alignment and domain information |
|---|
| >PRK05690 molybdopterin biosynthesis protein MoeB; Provisional | Back alignment and domain information |
|---|
| >PTZ00325 malate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR02825 B4_12hDH leukotriene B4 12-hydroxydehydrogenase/15-oxo-prostaglandin 13-reductase | Back alignment and domain information |
|---|
| >PRK00094 gpsA NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Validated | Back alignment and domain information |
|---|
| >cd05276 p53_inducible_oxidoreductase PIG3 p53-inducible quinone oxidoreductase | Back alignment and domain information |
|---|
| >PRK08306 dipicolinate synthase subunit A; Reviewed | Back alignment and domain information |
|---|
| >PF02826 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain; InterPro: IPR006140 A number of NAD-dependent 2-hydroxyacid dehydrogenases which seem to be specific for the D-isomer of their substrate have been shown to be functionally and structurally related | Back alignment and domain information |
|---|
| >PRK12475 thiamine/molybdopterin biosynthesis MoeB-like protein; Provisional | Back alignment and domain information |
|---|
| >cd05191 NAD_bind_amino_acid_DH NAD(P) binding domain of amino acid dehydrogenase-like proteins | Back alignment and domain information |
|---|
| >cd05291 HicDH_like L-2-hydroxyisocapronate dehydrogenases and some bacterial L-lactate dehydrogenases | Back alignment and domain information |
|---|
| >PRK07417 arogenate dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >cd08253 zeta_crystallin Zeta-crystallin with NADP-dependent quinone reductase activity (QOR) | Back alignment and domain information |
|---|
| >PRK14027 quinate/shikimate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK14618 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK11064 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >cd08293 PTGR2 Prostaglandin reductase | Back alignment and domain information |
|---|
| >PRK08293 3-hydroxybutyryl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PF03721 UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogenase family, NAD binding domain; InterPro: IPR001732 The UDP-glucose/GDP-mannose dehydrogenases are a small group of enzymes which possesses the ability to catalyse the NAD-dependent 2-fold oxidation of an alcohol to an acid without the release of an aldehyde intermediate [, ] | Back alignment and domain information |
|---|
| >PLN02545 3-hydroxybutyryl-CoA dehydrogenase | Back alignment and domain information |
|---|
| >TIGR01809 Shik-DH-AROM shikimate-5-dehydrogenase, fungal AROM-type | Back alignment and domain information |
|---|
| >PLN03154 putative allyl alcohol dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >COG0287 TyrA Prephenate dehydrogenase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PF02882 THF_DHG_CYH_C: Tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding domain; InterPro: IPR020631 Enzymes that participate in the transfer of one-carbon units require the coenzyme tetrahydrofolate (THF) | Back alignment and domain information |
|---|
| >KOG1198 consensus Zinc-binding oxidoreductase [Energy production and conversion; General function prediction only] | Back alignment and domain information |
|---|
| >COG0604 Qor NADPH:quinone reductase and related Zn-dependent oxidoreductases [Energy production and conversion / General function prediction only] | Back alignment and domain information |
|---|
| >PRK08268 3-hydroxy-acyl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PLN02383 aspartate semialdehyde dehydrogenase | Back alignment and domain information |
|---|
| >PRK06719 precorrin-2 dehydrogenase; Validated | Back alignment and domain information |
|---|
| >cd00704 MDH Malate dehydrogenase | Back alignment and domain information |
|---|
| >PRK02006 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional | Back alignment and domain information |
|---|
| >cd01483 E1_enzyme_family Superfamily of activating enzymes (E1) of the ubiquitin-like proteins | Back alignment and domain information |
|---|
| >PRK05442 malate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >cd01338 MDH_choloroplast_like Chloroplast-like malate dehydrogenases | Back alignment and domain information |
|---|
| >PRK06130 3-hydroxybutyryl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >cd08266 Zn_ADH_like1 Alcohol dehydrogenases of the MDR family | Back alignment and domain information |
|---|
| >cd08268 MDR2 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family | Back alignment and domain information |
|---|
| >TIGR01850 argC N-acetyl-gamma-glutamyl-phosphate reductase, common form | Back alignment and domain information |
|---|
| >PRK14620 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >COG0169 AroE Shikimate 5-dehydrogenase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK06035 3-hydroxyacyl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >TIGR01035 hemA glutamyl-tRNA reductase | Back alignment and domain information |
|---|
| >PF01210 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus; InterPro: IPR011128 NAD-dependent glycerol-3-phosphate dehydrogenase (GPDH) catalyses the interconversion of dihydroxyacetone phosphate and L-glycerol-3-phosphate | Back alignment and domain information |
|---|
| >TIGR02356 adenyl_thiF thiazole biosynthesis adenylyltransferase ThiF, E | Back alignment and domain information |
|---|
| >TIGR01296 asd_B aspartate-semialdehyde dehydrogenase (peptidoglycan organisms) | Back alignment and domain information |
|---|
| >PRK07531 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioesterase; Validated | Back alignment and domain information |
|---|
| >cd01485 E1-1_like Ubiquitin activating enzyme (E1), repeat 1-like | Back alignment and domain information |
|---|
| >PLN02256 arogenate dehydrogenase | Back alignment and domain information |
|---|
| >PRK07066 3-hydroxybutyryl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK13243 glyoxylate reductase; Reviewed | Back alignment and domain information |
|---|
| >cd01337 MDH_glyoxysomal_mitochondrial Glyoxysomal and mitochondrial malate dehydrogenases | Back alignment and domain information |
|---|
| >PRK05808 3-hydroxybutyryl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK00141 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK10669 putative cation:proton antiport protein; Provisional | Back alignment and domain information |
|---|
| >PF12076 Wax2_C: WAX2 C-terminal domain; InterPro: IPR021940 This presumed domain is functionally uncharacterised | Back alignment and domain information |
|---|
| >PRK06223 malate dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PRK05476 S-adenosyl-L-homocysteine hydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK08229 2-dehydropantoate 2-reductase; Provisional | Back alignment and domain information |
|---|
| >cd05311 NAD_bind_2_malic_enz NAD(P) binding domain of malic enzyme (ME), subgroup 2 | Back alignment and domain information |
|---|
| >PRK12749 quinate/shikimate dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >TIGR02279 PaaC-3OHAcCoADH 3-hydroxyacyl-CoA dehydrogenase PaaC | Back alignment and domain information |
|---|
| >cd00757 ThiF_MoeB_HesA_family ThiF_MoeB_HesA | Back alignment and domain information |
|---|
| >PRK13940 glutamyl-tRNA reductase; Provisional | Back alignment and domain information |
|---|
| >TIGR02824 quinone_pig3 putative NAD(P)H quinone oxidoreductase, PIG3 family | Back alignment and domain information |
|---|
| >PRK10792 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK12550 shikimate 5-dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >cd08289 MDR_yhfp_like Yhfp putative quinone oxidoreductases | Back alignment and domain information |
|---|
| >KOG0409 consensus Predicted dehydrogenase [General function prediction only] | Back alignment and domain information |
|---|
| >PTZ00117 malate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07502 cyclohexadienyl dehydrogenase; Validated | Back alignment and domain information |
|---|
| >TIGR00978 asd_EA aspartate-semialdehyde dehydrogenase (non-peptidoglycan organisms) | Back alignment and domain information |
|---|
| >PF04127 DFP: DNA / pantothenate metabolism flavoprotein; InterPro: IPR007085 This entry represents the C-terminal domain found in DNA/pantothenate metabolism flavoproteins, which affects synthesis of DNA and pantothenate metabolism | Back alignment and domain information |
|---|
| >PRK11559 garR tartronate semialdehyde reductase; Provisional | Back alignment and domain information |
|---|
| >PRK08644 thiamine biosynthesis protein ThiF; Provisional | Back alignment and domain information |
|---|
| >COG1064 AdhP Zn-dependent alcohol dehydrogenases [General function prediction only] | Back alignment and domain information |
|---|
| >PRK05597 molybdopterin biosynthesis protein MoeB; Validated | Back alignment and domain information |
|---|
| >KOG4022 consensus Dihydropteridine reductase DHPR/QDPR [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >cd08250 Mgc45594_like Mgc45594 gene product and other MDR family members | Back alignment and domain information |
|---|
| >cd05292 LDH_2 A subgroup of L-lactate dehydrogenases | Back alignment and domain information |
|---|
| >PRK14179 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >cd00650 LDH_MDH_like NAD-dependent, lactate dehydrogenase-like, 2-hydroxycarboxylate dehydrogenase family | Back alignment and domain information |
|---|
| >TIGR03201 dearomat_had 6-hydroxycyclohex-1-ene-1-carbonyl-CoA dehydrogenase | Back alignment and domain information |
|---|
| >PTZ00345 glycerol-3-phosphate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR01758 MDH_euk_cyt malate dehydrogenase, NAD-dependent | Back alignment and domain information |
|---|
| >cd01487 E1_ThiF_like E1_ThiF_like | Back alignment and domain information |
|---|
| >PRK12409 D-amino acid dehydrogenase small subunit; Provisional | Back alignment and domain information |
|---|
| >PF03807 F420_oxidored: NADP oxidoreductase coenzyme F420-dependent; InterPro: IPR004455 The function of F420-dependent NADP reductase is the transfer of electrons from reduced coenzyme F420 into an electron transport chain | Back alignment and domain information |
|---|
| >PRK13236 nitrogenase reductase; Reviewed | Back alignment and domain information |
|---|
| >PF00899 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-activating enzyme (E1 enzyme) [, ] activates ubiquitin by first adenylating with ATP its C-terminal glycine residue and thereafter linking this residue to the side chain of a cysteine residue in E1, yielding an ubiquitin-E1 thiolester and free AMP | Back alignment and domain information |
|---|
| >TIGR01759 MalateDH-SF1 malate dehydrogenase | Back alignment and domain information |
|---|
| >PRK11880 pyrroline-5-carboxylate reductase; Reviewed | Back alignment and domain information |
|---|
| >COG0665 DadA Glycine/D-amino acid oxidases (deaminating) [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK12480 D-lactate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >cd05288 PGDH Prostaglandin dehydrogenases | Back alignment and domain information |
|---|
| >PRK09880 L-idonate 5-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK14189 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >COG0039 Mdh Malate/lactate dehydrogenases [Energy production and conversion] | Back alignment and domain information |
|---|
| >COG0190 FolD 5,10-methylene-tetrahydrofolate dehydrogenase/Methenyl tetrahydrofolate cyclohydrolase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PRK07236 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd01079 NAD_bind_m-THF_DH NAD binding domain of methylene-tetrahydrofolate dehydrogenase | Back alignment and domain information |
|---|
| >PRK13982 bifunctional SbtC-like/phosphopantothenoylcysteine decarboxylase/phosphopantothenate synthase; Provisional | Back alignment and domain information |
|---|
| >cd05188 MDR Medium chain reductase/dehydrogenase (MDR)/zinc-dependent alcohol dehydrogenase-like family | Back alignment and domain information |
|---|
| >PRK00045 hemA glutamyl-tRNA reductase; Reviewed | Back alignment and domain information |
|---|
| >PRK13886 conjugal transfer protein TraL; Provisional | Back alignment and domain information |
|---|
| >PLN00203 glutamyl-tRNA reductase | Back alignment and domain information |
|---|
| >PLN02712 arogenate dehydrogenase | Back alignment and domain information |
|---|
| >PRK14177 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK14176 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK07494 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional | Back alignment and domain information |
|---|
| >PRK08818 prephenate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >cd08270 MDR4 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family | Back alignment and domain information |
|---|
| >TIGR01772 MDH_euk_gproteo malate dehydrogenase, NAD-dependent | Back alignment and domain information |
|---|
| >TIGR00872 gnd_rel 6-phosphogluconate dehydrogenase (decarboxylating) | Back alignment and domain information |
|---|
| >TIGR03026 NDP-sugDHase nucleotide sugar dehydrogenase | Back alignment and domain information |
|---|
| >PRK08163 salicylate hydroxylase; Provisional | Back alignment and domain information |
|---|
| >PRK14191 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >cd08241 QOR1 Quinone oxidoreductase (QOR) | Back alignment and domain information |
|---|
| >PRK06728 aspartate-semialdehyde dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PTZ00082 L-lactate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >cd01492 Aos1_SUMO Ubiquitin activating enzyme (E1) subunit Aos1 | Back alignment and domain information |
|---|
| >TIGR00518 alaDH alanine dehydrogenase | Back alignment and domain information |
|---|
| >cd08244 MDR_enoyl_red Possible enoyl reductase | Back alignment and domain information |
|---|
| >cd08292 ETR_like_2 2-enoyl thioester reductase (ETR) like proteins, child 2 | Back alignment and domain information |
|---|
| >TIGR02822 adh_fam_2 zinc-binding alcohol dehydrogenase family protein | Back alignment and domain information |
|---|
| >PRK12767 carbamoyl phosphate synthase-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG1204 consensus Predicted dehydrogenase [Secondary metabolites biosynthesis, transport and catabolism] | Back alignment and domain information |
|---|
| >PRK03659 glutathione-regulated potassium-efflux system protein KefB; Provisional | Back alignment and domain information |
|---|
| >PF00208 ELFV_dehydrog: Glutamate/Leucine/Phenylalanine/Valine dehydrogenase; InterPro: IPR006096 Glutamate, leucine, phenylalanine and valine dehydrogenases are structurally and functionally related | Back alignment and domain information |
|---|
| >PF00070 Pyr_redox: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR001327 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] | Back alignment and domain information |
|---|
| >cd08243 quinone_oxidoreductase_like_1 Quinone oxidoreductase (QOR) | Back alignment and domain information |
|---|
| >cd05213 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain of glutamyl-tRNA reductase | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 64 | ||||
| 2c29_D | 337 | Structure Of Dihydroflavonol Reductase From Vitis V | 7e-14 | ||
| 2p4h_X | 322 | Crystal Structure Of Vestitone Reductase From Alfal | 5e-09 | ||
| 2rh8_A | 338 | Structure Of Apo Anthocyanidin Reductase From Vitis | 2e-08 | ||
| 1ujm_A | 342 | Crystal Structure Of Aldehyde Reductase 2 From Spor | 7e-04 | ||
| 1y1p_A | 342 | X-Ray Structure Of Aldehyde Reductase With Nadph Le | 8e-04 |
| >pdb|2C29|D Chain D, Structure Of Dihydroflavonol Reductase From Vitis Vinifera At 1.8 A. Length = 337 | Back alignment and structure |
|
| >pdb|2P4H|X Chain X, Crystal Structure Of Vestitone Reductase From Alfalfa (Medicago Sativa L.) Length = 322 | Back alignment and structure |
| >pdb|2RH8|A Chain A, Structure Of Apo Anthocyanidin Reductase From Vitis Vinifera Length = 338 | Back alignment and structure |
| >pdb|1UJM|A Chain A, Crystal Structure Of Aldehyde Reductase 2 From Sporobolomyces Salmonicolor Aku4429 Length = 342 | Back alignment and structure |
| >pdb|1Y1P|A Chain A, X-Ray Structure Of Aldehyde Reductase With Nadph Length = 342 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 64 | |||
| 2c29_D | 337 | Dihydroflavonol 4-reductase; flavonoids, short deh | 1e-32 | |
| 2p4h_X | 322 | Vestitone reductase; NADPH-dependent reductase, is | 3e-27 | |
| 2rh8_A | 338 | Anthocyanidin reductase; flavonoids, rossmann fold | 5e-27 | |
| 1y1p_A | 342 | ARII, aldehyde reductase II; rossmann fold, short | 3e-24 | |
| 3dhn_A | 227 | NAD-dependent epimerase/dehydratase; reductase, PF | 1e-16 | |
| 2x4g_A | 342 | Nucleoside-diphosphate-sugar epimerase; isomerase; | 1e-11 | |
| 1xgk_A | 352 | Nitrogen metabolite repression regulator NMRA; ros | 2e-11 | |
| 3dqp_A | 219 | Oxidoreductase YLBE; alpha-beta protein., structur | 9e-09 | |
| 3ew7_A | 221 | LMO0794 protein; Q8Y8U8_lismo, putative NAD-depend | 7e-08 | |
| 2c5a_A | 379 | GDP-mannose-3', 5'-epimerase; short chain dehydrat | 7e-08 | |
| 3e8x_A | 236 | Putative NAD-dependent epimerase/dehydratase; stru | 1e-07 | |
| 3slg_A | 372 | PBGP3 protein; structural genomics, seattle struct | 2e-07 | |
| 3vps_A | 321 | TUNA, NAD-dependent epimerase/dehydratase; tunicam | 4e-07 | |
| 1hdo_A | 206 | Biliverdin IX beta reductase; foetal metabolism, H | 5e-07 | |
| 2a35_A | 215 | Hypothetical protein PA4017; alpha-beta-alpha sand | 6e-07 | |
| 3u9l_A | 324 | 3-oxoacyl-[acyl-carrier-protein] reductase; struct | 6e-07 | |
| 3h2s_A | 224 | Putative NADH-flavin reductase; Q03B84, NESG, LCR1 | 1e-06 | |
| 3r6d_A | 221 | NAD-dependent epimerase/dehydratase; structural ge | 2e-06 | |
| 1xq6_A | 253 | Unknown protein; structural genomics, protein stru | 2e-06 | |
| 2wm3_A | 299 | NMRA-like family domain containing protein 1; unkn | 2e-06 | |
| 1sb8_A | 352 | WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCN | 4e-06 | |
| 3ruf_A | 351 | WBGU; rossmann fold, UDP-hexose 4-epimerase, isome | 5e-06 | |
| 2bll_A | 345 | Protein YFBG; decarboxylase, short chain dehydroge | 8e-06 | |
| 3m2p_A | 311 | UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J | 8e-06 | |
| 3rft_A | 267 | Uronate dehydrogenase; apoenzyme, rossmann fold, N | 1e-05 | |
| 3ajr_A | 317 | NDP-sugar epimerase; L-threonine dehydrogenase, L- | 2e-05 | |
| 3qvo_A | 236 | NMRA family protein; structural genomics, PSI-biol | 2e-05 | |
| 3m1a_A | 281 | Putative dehydrogenase; short, PSI, MCSG, structur | 2e-05 | |
| 3oh8_A | 516 | Nucleoside-diphosphate sugar epimerase (SULA FAMI; | 3e-05 | |
| 2q1w_A | 333 | Putative nucleotide sugar epimerase/ dehydratase; | 3e-05 | |
| 1qyd_A | 313 | Pinoresinol-lariciresinol reductase; NADPH-depende | 5e-05 | |
| 3ay3_A | 267 | NAD-dependent epimerase/dehydratase; glucuronic ac | 5e-05 | |
| 1rkx_A | 357 | CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; | 5e-05 | |
| 2v6g_A | 364 | Progesterone 5-beta-reductase; tyrosine-dependent | 7e-05 | |
| 2pff_A | 1688 | Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl | 8e-05 | |
| 2bka_A | 242 | CC3, TAT-interacting protein TIP30; NADPH, PEG600, | 1e-04 | |
| 2b69_A | 343 | UDP-glucuronate decarboxylase 1; UDP-glucoronic ac | 2e-04 | |
| 1qyc_A | 308 | Phenylcoumaran benzylic ether reductase PT1; NADPH | 2e-04 | |
| 2x6t_A | 357 | ADP-L-glycero-D-manno-heptose-6-epimerase; isomera | 3e-04 | |
| 1z7e_A | 660 | Protein aRNA; rossmann fold, OB-like fold, hydrola | 3e-04 | |
| 1sby_A | 254 | Alcohol dehydrogenase; ternary complex, NAD, trifl | 5e-04 | |
| 3sxp_A | 362 | ADP-L-glycero-D-mannoheptose-6-epimerase; rossman | 5e-04 | |
| 3st7_A | 369 | Capsular polysaccharide synthesis enzyme CAP5F; ro | 5e-04 | |
| 2pk3_A | 321 | GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, shor | 5e-04 | |
| 2yy7_A | 312 | L-threonine dehydrogenase; thermolabIle, flavobact | 6e-04 |
| >2c29_D Dihydroflavonol 4-reductase; flavonoids, short dehydrogenase reductase, NADPH, dihydroquercetin, rossmann fold, oxidoreductase; HET: NAP DQH; 1.81A {Vitis vinifera} PDB: 2iod_A* 2nnl_D* 3bxx_A* 3c1t_A* Length = 337 | Back alignment and structure |
|---|
Score = 113 bits (284), Expect = 1e-32
Identities = 37/64 (57%), Positives = 44/64 (68%), Gaps = 1/64 (1%)
Query: 1 MSGKGKVVCVTGASGFIASWLVKLLLQRSYTVKATVRDLNNHNA-EHLLTLDGAEERLHL 59
M + + VCVTGASGFI SWLV LL+R YTV+ATVRD N +HLL L AE L L
Sbjct: 1 MGSQSETVCVTGASGFIGSWLVMRLLERGYTVRATVRDPTNVKKVKHLLDLPKAETHLTL 60
Query: 60 FKAN 63
+KA+
Sbjct: 61 WKAD 64
|
| >2p4h_X Vestitone reductase; NADPH-dependent reductase, isoflavonoid, plant protein; 1.40A {Medicago sativa} Length = 322 | Back alignment and structure |
|---|
| >2rh8_A Anthocyanidin reductase; flavonoids, rossmann fold, short chain dehydrogenase/reductase, oxidoreductase; 2.22A {Vitis vinifera} PDB: 3hfs_A Length = 338 | Back alignment and structure |
|---|
| >1y1p_A ARII, aldehyde reductase II; rossmann fold, short chain dehydrogenase reductase, oxidoreductase; HET: NMN AMP; 1.60A {Sporidiobolus salmonicolor} SCOP: c.2.1.2 PDB: 1ujm_A* 1zze_A Length = 342 | Back alignment and structure |
|---|
| >3dhn_A NAD-dependent epimerase/dehydratase; reductase, PF01370, Q89Z24_bactn, NESG, BTR310, structural genomics, PSI-2; 2.00A {Bacteroides thetaiotaomicron} Length = 227 | Back alignment and structure |
|---|
| >2x4g_A Nucleoside-diphosphate-sugar epimerase; isomerase; 2.65A {Pseudomonas aeruginosa} Length = 342 | Back alignment and structure |
|---|
| >1xgk_A Nitrogen metabolite repression regulator NMRA; rossmann fold, transcriptional regulation, short chain dehyd reductase, NADP binding; 1.40A {Emericella nidulans} SCOP: c.2.1.2 PDB: 1k6x_A* 1k6j_A 1k6i_A* 1ti7_A* 2vus_A 2vut_A* 2vuu_A* Length = 352 | Back alignment and structure |
|---|
| >3dqp_A Oxidoreductase YLBE; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 1.40A {Lactococcus lactis subsp} Length = 219 | Back alignment and structure |
|---|
| >3ew7_A LMO0794 protein; Q8Y8U8_lismo, putative NAD-dependent epimerase/dehydratase, LMR162, NESG, structural genomics, PSI-2; 2.73A {Listeria monocytogenes} Length = 221 | Back alignment and structure |
|---|
| >2c5a_A GDP-mannose-3', 5'-epimerase; short chain dehydratase/reductase, GDP-gulose, GDP-galactose, keto intermediate, vitamin C, SDR; HET: GDC NAD BTB; 1.4A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2c59_A* 2c54_A* 2c5e_A* Length = 379 | Back alignment and structure |
|---|
| >3e8x_A Putative NAD-dependent epimerase/dehydratase; structural genomics, APC7755, NADP, P protein structure initiative; HET: MSE NAP; 2.10A {Bacillus halodurans} Length = 236 | Back alignment and structure |
|---|
| >3slg_A PBGP3 protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid, melioidosis, glanders; 2.10A {Burkholderia pseudomallei} Length = 372 | Back alignment and structure |
|---|
| >3vps_A TUNA, NAD-dependent epimerase/dehydratase; tunicamycins, biosynthesis, EXO-glycal, rossman transferase; HET: UD1 NAD; 1.90A {Streptomyces chartreusis} Length = 321 | Back alignment and structure |
|---|
| >1hdo_A Biliverdin IX beta reductase; foetal metabolism, HAEM degradation, flavin reductase, diaphorase, green HAEM binding protein; HET: NAP; 1.15A {Homo sapiens} SCOP: c.2.1.2 PDB: 1he2_A* 1he3_A* 1he4_A* 1he5_A* Length = 206 | Back alignment and structure |
|---|
| >2a35_A Hypothetical protein PA4017; alpha-beta-alpha sandwich, structura genomics, PSI, protein structure initiative; 1.50A {Pseudomonas aeruginosa} SCOP: c.2.1.2 Length = 215 | Back alignment and structure |
|---|
| >3u9l_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.10A {Sinorhizobium meliloti} Length = 324 | Back alignment and structure |
|---|
| >3h2s_A Putative NADH-flavin reductase; Q03B84, NESG, LCR19, structural genomics, PSI-2, protein structure initiative; HET: NDP; 1.78A {Lactobacillus casei atcc 334} Length = 224 | Back alignment and structure |
|---|
| >3r6d_A NAD-dependent epimerase/dehydratase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, veillo parvula; HET: MLZ; 1.25A {Veillonella parvula dsm 2008} PDB: 3r14_A* Length = 221 | Back alignment and structure |
|---|
| >1xq6_A Unknown protein; structural genomics, protein structure initiative, CESG, AT5G02240, NADP, center for eukaryotic structural genomics; HET: NAP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1ybm_A* 2q46_A* 2q4b_A* Length = 253 | Back alignment and structure |
|---|
| >2wm3_A NMRA-like family domain containing protein 1; unknown function; HET: NAP NFL; 1.85A {Homo sapiens} PDB: 2wmd_A* 2exx_A* 3dxf_A 3e5m_A Length = 299 | Back alignment and structure |
|---|
| >1sb8_A WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCNAC, SDR, G SYK, UDP, N-acetylglucosamine, N- acetylgalactosamine, UDP-GLC, isomerase; HET: NAD UD2; 2.10A {Pseudomonas aeruginosa} SCOP: c.2.1.2 PDB: 1sb9_A* Length = 352 | Back alignment and structure |
|---|
| >3ruf_A WBGU; rossmann fold, UDP-hexose 4-epimerase, isomerase; HET: NAD UDP; 2.00A {Plesiomonas shigelloides} PDB: 3ru9_A* 3rud_A* 3rue_A* 3rua_A* 3ruh_A* 3ruc_A* 3ru7_A* 3lu1_A* Length = 351 | Back alignment and structure |
|---|
| >2bll_A Protein YFBG; decarboxylase, short chain dehydrogenase, L-ARA4N biosynthes methyltransferase, transferase; 2.3A {Escherichia coli} SCOP: c.2.1.2 PDB: 1u9j_A 1z73_A 1z75_A 1z7b_A 1z74_A Length = 345 | Back alignment and structure |
|---|
| >3m2p_A UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J, isomerase, structural genomics, PSI-2, protein structure initiative; HET: UDP; 2.95A {Bacillus cereus} Length = 311 | Back alignment and structure |
|---|
| >3rft_A Uronate dehydrogenase; apoenzyme, rossmann fold, NAD binding, oxidoreductase; 1.90A {Agrobacterium tumefaciens} PDB: 3rfv_A* 3rfx_A* Length = 267 | Back alignment and structure |
|---|
| >3ajr_A NDP-sugar epimerase; L-threonine dehydrogenase, L-3- hydroxynorvaline, oxidoreductase; HET: NAD; 1.77A {Thermoplasma volcanium} PDB: 3a9w_A* 3a4v_A* 3a1n_A* Length = 317 | Back alignment and structure |
|---|
| >3qvo_A NMRA family protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MNB; 2.30A {Shigella flexneri 2A} Length = 236 | Back alignment and structure |
|---|
| >3m1a_A Putative dehydrogenase; short, PSI, MCSG, structural genomics, midwest center for structural genomics, protein structure initiative; 2.00A {Streptomyces avermitilis} Length = 281 | Back alignment and structure |
|---|
| >3oh8_A Nucleoside-diphosphate sugar epimerase (SULA FAMI; DUF1731_C, northeast structural genomics consortium, NESG, C PSI-biology; 2.00A {Corynebacterium glutamicum} Length = 516 | Back alignment and structure |
|---|
| >2q1w_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, sugar binding protein; HET: NAD; 2.19A {Bordetella bronchiseptica} Length = 333 | Back alignment and structure |
|---|
| >1qyd_A Pinoresinol-lariciresinol reductase; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.50A {Thuja plicata} SCOP: c.2.1.2 Length = 313 | Back alignment and structure |
|---|
| >3ay3_A NAD-dependent epimerase/dehydratase; glucuronic acid dehydrogeanse, oxidoreductase; 2.10A {Chromohalobacter salexigens} Length = 267 | Back alignment and structure |
|---|
| >1rkx_A CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 1.80A {Yersinia pseudotuberculosis} SCOP: c.2.1.2 PDB: 1wvg_A* Length = 357 | Back alignment and structure |
|---|
| >2v6g_A Progesterone 5-beta-reductase; tyrosine-dependent oxidoreductase, oxidoreductase, SDR, cardenolides, cardiac glycosides; HET: NAP; 2.3A {Digitalis lanata} PDB: 2v6f_A* Length = 364 | Back alignment and structure |
|---|
| >2pff_A Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl-carrier-PR; fatty acid synthase, acyl-carrier-protein, beta-ketoacyl RED beta-ketoacyl synthase, dehydratase; 4.00A {Saccharomyces cerevisiae} Length = 1688 | Back alignment and structure |
|---|
| >2bka_A CC3, TAT-interacting protein TIP30; NADPH, PEG600, transcription; HET: NDP PE8; 1.7A {Homo sapiens} SCOP: c.2.1.2 PDB: 2fmu_A Length = 242 | Back alignment and structure |
|---|
| >2b69_A UDP-glucuronate decarboxylase 1; UDP-glucoronic acid decarboxylase, structural genomics, STRU genomics consortium, SGC, lyase; HET: MSE NAD UDP; 1.21A {Homo sapiens} SCOP: c.2.1.2 PDB: 4ef7_A* Length = 343 | Back alignment and structure |
|---|
| >1qyc_A Phenylcoumaran benzylic ether reductase PT1; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.20A {Pinus taeda} SCOP: c.2.1.2 Length = 308 | Back alignment and structure |
|---|
| >2x6t_A ADP-L-glycero-D-manno-heptose-6-epimerase; isomerase, carbohydrate metabolism, stress response; HET: NAP ADP BMA; 2.36A {Escherichia coli} PDB: 2x86_A* Length = 357 | Back alignment and structure |
|---|
| >1z7e_A Protein aRNA; rossmann fold, OB-like fold, hydrolase; HET: ATP UGA; 3.00A {Escherichia coli} SCOP: b.46.1.1 c.2.1.2 c.65.1.1 Length = 660 | Back alignment and structure |
|---|
| >1sby_A Alcohol dehydrogenase; ternary complex, NAD, trifluoroethanol, oxidoreductase; HET: NAD; 1.10A {Scaptodrosophila lebanonensis} SCOP: c.2.1.2 PDB: 1b14_A* 1b15_A* 1a4u_A* 1b2l_A* 1b16_A* 3rj5_A* 3rj9_A* 1mg5_A* Length = 254 | Back alignment and structure |
|---|
| >3sxp_A ADP-L-glycero-D-mannoheptose-6-epimerase; rossman fold, NAD binding, isomerase; HET: NAD; 2.55A {Helicobacter pylori} Length = 362 | Back alignment and structure |
|---|
| >3st7_A Capsular polysaccharide synthesis enzyme CAP5F; rossmann fold, cupid domain, short-chain dehydrogenase/reduc NADPH; 2.45A {Staphylococcus aureus} PDB: 2zkl_A 3vhr_A Length = 369 | Back alignment and structure |
|---|
| >2pk3_A GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, short-chain dehydrogenase/reductase, rossmann fold, oxidoreductase; HET: A2R GDD; 1.82A {Aneurinibacillus thermoaerophilus} Length = 321 | Back alignment and structure |
|---|
| >2yy7_A L-threonine dehydrogenase; thermolabIle, flavobacterium FRIG KUC-1, oxidoreductase; HET: PE8 NAD MES; 2.06A {Flavobacterium frigidimaris} Length = 312 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 64 | |||
| 4fn4_A | 254 | Short chain dehydrogenase; NADH-binding, rossmann | 99.59 | |
| 3h7a_A | 252 | Short chain dehydrogenase; oxidoreductase, PSI-2, | 99.58 | |
| 4gkb_A | 258 | 3-oxoacyl-[acyl-carrier protein] reductase; putati | 99.55 | |
| 3lyl_A | 247 | 3-oxoacyl-(acyl-carrier-protein) reductase; alpha | 99.54 | |
| 3r1i_A | 276 | Short-chain type dehydrogenase/reductase; structur | 99.53 | |
| 4g81_D | 255 | Putative hexonate dehydrogenase; enzyme function i | 99.53 | |
| 3qiv_A | 253 | Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR | 99.53 | |
| 3rih_A | 293 | Short chain dehydrogenase or reductase; structural | 99.52 | |
| 4imr_A | 275 | 3-oxoacyl-(acyl-carrier-protein) reductase; oxidor | 99.52 | |
| 3v8b_A | 283 | Putative dehydrogenase, possibly 3-oxoacyl-[acyl- | 99.52 | |
| 2ae2_A | 260 | Protein (tropinone reductase-II); oxidoreductase, | 99.51 | |
| 3svt_A | 281 | Short-chain type dehydrogenase/reductase; ssgcid, | 99.51 | |
| 3pk0_A | 262 | Short-chain dehydrogenase/reductase SDR; ssgcid, s | 99.51 | |
| 4iin_A | 271 | 3-ketoacyl-acyl carrier protein reductase (FABG); | 99.5 | |
| 3gaf_A | 256 | 7-alpha-hydroxysteroid dehydrogenase; seattle stru | 99.5 | |
| 4hp8_A | 247 | 2-deoxy-D-gluconate 3-dehydrogenase; enzyme functi | 99.5 | |
| 3awd_A | 260 | GOX2181, putative polyol dehydrogenase; oxidoreduc | 99.5 | |
| 3sc4_A | 285 | Short chain dehydrogenase (A0QTM2 homolog); ssgcid | 99.49 | |
| 3edm_A | 259 | Short chain dehydrogenase; structural genomics, ox | 99.49 | |
| 2hq1_A | 247 | Glucose/ribitol dehydrogenase; CTH-1438, structura | 99.49 | |
| 3tfo_A | 264 | Putative 3-oxoacyl-(acyl-carrier-protein) reducta; | 99.49 | |
| 3m1a_A | 281 | Putative dehydrogenase; short, PSI, MCSG, structur | 99.48 | |
| 1ae1_A | 273 | Tropinone reductase-I; oxidoreductase, tropane alk | 99.48 | |
| 3imf_A | 257 | Short chain dehydrogenase; structural genomics, in | 99.48 | |
| 3tpc_A | 257 | Short chain alcohol dehydrogenase-related dehydro; | 99.48 | |
| 3ged_A | 247 | Short-chain dehydrogenase/reductase SDR; SCOR, ros | 99.48 | |
| 3ai3_A | 263 | NADPH-sorbose reductase; rossmann-fold, NADPH-depe | 99.48 | |
| 4fs3_A | 256 | Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; | 99.48 | |
| 3sju_A | 279 | Keto reductase; short-chain dehydrogenase, oxidore | 99.48 | |
| 3ksu_A | 262 | 3-oxoacyl-acyl carrier protein reductase; structur | 99.48 | |
| 3rkr_A | 262 | Short chain oxidoreductase; rossmann fold; HET: NA | 99.48 | |
| 3tjr_A | 301 | Short chain dehydrogenase; structural genomics, se | 99.47 | |
| 4ibo_A | 271 | Gluconate dehydrogenase; enzyme function initiativ | 99.47 | |
| 3e03_A | 274 | Short chain dehydrogenase; structural genomics, PS | 99.47 | |
| 3uf0_A | 273 | Short-chain dehydrogenase/reductase SDR; gluconate | 99.47 | |
| 2c29_D | 337 | Dihydroflavonol 4-reductase; flavonoids, short deh | 99.47 | |
| 2o23_A | 265 | HADH2 protein; HSD17B10, schad, ERAB, type II HADH | 99.47 | |
| 4egf_A | 266 | L-xylulose reductase; structural genomics, ssgcid, | 99.47 | |
| 3ijr_A | 291 | Oxidoreductase, short chain dehydrogenase/reducta; | 99.47 | |
| 2rhc_B | 277 | Actinorhodin polyketide ketoreductase; oxidoreduct | 99.47 | |
| 3nyw_A | 250 | Putative oxidoreductase; fatty acid synthesis,3-ox | 99.47 | |
| 1yb1_A | 272 | 17-beta-hydroxysteroid dehydrogenase type XI; shor | 99.47 | |
| 1fmc_A | 255 | 7 alpha-hydroxysteroid dehydrogenase; short-chain | 99.46 | |
| 3v2g_A | 271 | 3-oxoacyl-[acyl-carrier-protein] reductase; struct | 99.46 | |
| 4dmm_A | 269 | 3-oxoacyl-[acyl-carrier-protein] reductase; rossma | 99.46 | |
| 1xq1_A | 266 | Putative tropinone reducatse; structural genomics, | 99.46 | |
| 3cxt_A | 291 | Dehydrogenase with different specificities; rossma | 99.46 | |
| 3ucx_A | 264 | Short chain dehydrogenase; ssgcid, seattle structu | 99.46 | |
| 3ioy_A | 319 | Short-chain dehydrogenase/reductase SDR; structura | 99.46 | |
| 4fgs_A | 273 | Probable dehydrogenase protein; PSI-biology, nysgr | 99.46 | |
| 3i4f_A | 264 | 3-oxoacyl-[acyl-carrier protein] reductase; struct | 99.46 | |
| 3u5t_A | 267 | 3-oxoacyl-[acyl-carrier-protein] reductase; struct | 99.45 | |
| 2b4q_A | 276 | Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier | 99.45 | |
| 1xhl_A | 297 | Short-chain dehydrogenase/reductase family member | 99.45 | |
| 1sby_A | 254 | Alcohol dehydrogenase; ternary complex, NAD, trifl | 99.45 | |
| 3afn_B | 258 | Carbonyl reductase; alpha/beta/alpha, rossmann-fol | 99.45 | |
| 1zem_A | 262 | Xylitol dehydrogenase; rossmann fold, dinucleotide | 99.45 | |
| 3rd5_A | 291 | Mypaa.01249.C; ssgcid, structural genomics, seattl | 99.45 | |
| 3tox_A | 280 | Short chain dehydrogenase; structural genomics, PS | 99.45 | |
| 1g0o_A | 283 | Trihydroxynaphthalene reductase; protein-NADPH-act | 99.45 | |
| 3tzq_B | 271 | Short-chain type dehydrogenase/reductase; ssgcid, | 99.44 | |
| 2jah_A | 247 | Clavulanic acid dehydrogenase; short-chain dehydro | 99.44 | |
| 3osu_A | 246 | 3-oxoacyl-[acyl-carrier-protein] reductase; struct | 99.44 | |
| 1ja9_A | 274 | 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; p | 99.44 | |
| 2zat_A | 260 | Dehydrogenase/reductase SDR family member 4; alpha | 99.44 | |
| 3n74_A | 261 | 3-ketoacyl-(acyl-carrier-protein) reductase; seatt | 99.44 | |
| 3o26_A | 311 | Salutaridine reductase; short chain dehydrogenase/ | 99.44 | |
| 1xkq_A | 280 | Short-chain reductase family member (5D234); parra | 99.44 | |
| 3zv4_A | 281 | CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; ox | 99.44 | |
| 2z1n_A | 260 | Dehydrogenase; reductase, SDR, oxidoreductase; 1.8 | 99.44 | |
| 3ppi_A | 281 | 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, de | 99.44 | |
| 3ctm_A | 279 | Carbonyl reductase; alcohol dehydrogenase, short-c | 99.44 | |
| 3enk_A | 341 | UDP-glucose 4-epimerase; seattle structural genomi | 99.43 | |
| 4dqx_A | 277 | Probable oxidoreductase protein; structural genomi | 99.43 | |
| 1h5q_A | 265 | NADP-dependent mannitol dehydrogenase; oxidoreduct | 99.43 | |
| 3v2h_A | 281 | D-beta-hydroxybutyrate dehydrogenase; structural g | 99.43 | |
| 1iy8_A | 267 | Levodione reductase; oxidoreductase; HET: NAD; 1.6 | 99.43 | |
| 3lf2_A | 265 | Short chain oxidoreductase Q9HYA2; SDR, SCOR, ross | 99.43 | |
| 3s55_A | 281 | Putative short-chain dehydrogenase/reductase; stru | 99.43 | |
| 3ruf_A | 351 | WBGU; rossmann fold, UDP-hexose 4-epimerase, isome | 99.43 | |
| 4da9_A | 280 | Short-chain dehydrogenase/reductase; structural ge | 99.42 | |
| 2qq5_A | 260 | DHRS1, dehydrogenase/reductase SDR family member 1 | 99.42 | |
| 3is3_A | 270 | 17BETA-hydroxysteroid dehydrogenase; short chain d | 99.42 | |
| 1w6u_A | 302 | 2,4-dienoyl-COA reductase, mitochondrial precursor | 99.42 | |
| 2c07_A | 285 | 3-oxoacyl-(acyl-carrier protein) reductase; oxidor | 99.42 | |
| 3pxx_A | 287 | Carveol dehydrogenase; structural genomics, seattl | 99.42 | |
| 3ftp_A | 270 | 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid | 99.42 | |
| 3t4x_A | 267 | Oxidoreductase, short chain dehydrogenase/reducta; | 99.42 | |
| 2rh8_A | 338 | Anthocyanidin reductase; flavonoids, rossmann fold | 99.42 | |
| 3pgx_A | 280 | Carveol dehydrogenase; structural genomics, seattl | 99.42 | |
| 2uvd_A | 246 | 3-oxoacyl-(acyl-carrier-protein) reductase; beta-k | 99.42 | |
| 3oid_A | 258 | Enoyl-[acyl-carrier-protein] reductase [NADPH]; fa | 99.42 | |
| 3l77_A | 235 | Short-chain alcohol dehydrogenase; oxidoreductase; | 99.41 | |
| 1geg_A | 256 | Acetoin reductase; SDR family, oxidoreductase; HET | 99.41 | |
| 3u9l_A | 324 | 3-oxoacyl-[acyl-carrier-protein] reductase; struct | 99.41 | |
| 1spx_A | 278 | Short-chain reductase family member (5L265); paral | 99.41 | |
| 1wma_A | 276 | Carbonyl reductase [NADPH] 1; oxidoreductase; HET: | 99.41 | |
| 3sx2_A | 278 | Putative 3-ketoacyl-(acyl-carrier-protein) reduct; | 99.41 | |
| 3gem_A | 260 | Short chain dehydrogenase; structural genomics, AP | 99.41 | |
| 2pd6_A | 264 | Estradiol 17-beta-dehydrogenase 8; short-chain deh | 99.41 | |
| 2q2v_A | 255 | Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidore | 99.41 | |
| 3e8x_A | 236 | Putative NAD-dependent epimerase/dehydratase; stru | 99.41 | |
| 2wsb_A | 254 | Galactitol dehydrogenase; oxidoreductase, SDR, ros | 99.41 | |
| 3kvo_A | 346 | Hydroxysteroid dehydrogenase-like protein 2; HSDL2 | 99.41 | |
| 3r3s_A | 294 | Oxidoreductase; structural genomics, csgid, center | 99.4 | |
| 2pnf_A | 248 | 3-oxoacyl-[acyl-carrier-protein] reductase; short | 99.4 | |
| 3a28_C | 258 | L-2.3-butanediol dehydrogenase; chiral substrate r | 99.4 | |
| 1vl8_A | 267 | Gluconate 5-dehydrogenase; TM0441, structural geno | 99.4 | |
| 2x9g_A | 288 | PTR1, pteridine reductase; short chain dehydrogena | 99.4 | |
| 4egb_A | 346 | DTDP-glucose 4,6-dehydratase; rhamnose pathway, ce | 99.4 | |
| 1sny_A | 267 | Sniffer CG10964-PA; alpha and beta protein, rossma | 99.4 | |
| 4e6p_A | 259 | Probable sorbitol dehydrogenase (L-iditol 2-dehyd; | 99.4 | |
| 3uve_A | 286 | Carveol dehydrogenase ((+)-trans-carveol dehydrog; | 99.4 | |
| 3ak4_A | 263 | NADH-dependent quinuclidinone reductase; SDR, (R)- | 99.39 | |
| 3op4_A | 248 | 3-oxoacyl-[acyl-carrier protein] reductase; 3-keto | 99.39 | |
| 3un1_A | 260 | Probable oxidoreductase; structural genomics, PSI- | 99.39 | |
| 3l6e_A | 235 | Oxidoreductase, short-chain dehydrogenase/reducta; | 99.39 | |
| 3f1l_A | 252 | Uncharacterized oxidoreductase YCIK; E. coli, NADP | 99.39 | |
| 2cfc_A | 250 | 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidor | 99.39 | |
| 3grp_A | 266 | 3-oxoacyl-(acyl carrierprotein) reductase; structu | 99.39 | |
| 2ew8_A | 249 | (S)-1-phenylethanol dehydrogenase; transferase; 2. | 99.39 | |
| 2gdz_A | 267 | NAD+-dependent 15-hydroxyprostaglandin dehydrogen; | 99.39 | |
| 3ezl_A | 256 | Acetoacetyl-COA reductase; ssgcid, acetyacetyl-COA | 99.39 | |
| 1yo6_A | 250 | Putative carbonyl reductase sniffer; tyrosine-depe | 99.39 | |
| 4iiu_A | 267 | 3-oxoacyl-[acyl-carrier protein] reductase; struct | 99.39 | |
| 1e7w_A | 291 | Pteridine reductase; dihydrofolate reductase, shor | 99.39 | |
| 2z1m_A | 345 | GDP-D-mannose dehydratase; short-chain dehydrogena | 99.39 | |
| 2bgk_A | 278 | Rhizome secoisolariciresinol dehydrogenase; oxidor | 99.39 | |
| 3dii_A | 247 | Short-chain dehydrogenase/reductase SDR; SCOR, ros | 99.38 | |
| 3t7c_A | 299 | Carveol dehydrogenase; structural genomics, seattl | 99.38 | |
| 4dry_A | 281 | 3-oxoacyl-[acyl-carrier-protein] reductase; struct | 99.38 | |
| 1yxm_A | 303 | Pecra, peroxisomal trans 2-enoyl COA reductase; pe | 99.38 | |
| 3tsc_A | 277 | Putative oxidoreductase; structural genomics, seat | 99.38 | |
| 2ehd_A | 234 | Oxidoreductase, oxidoreductase, short-chain dehydr | 99.38 | |
| 3gk3_A | 269 | Acetoacetyl-COA reductase; acetoacetyl-CO reductas | 99.38 | |
| 1uls_A | 245 | Putative 3-oxoacyl-acyl carrier protein reductase; | 99.38 | |
| 1zk4_A | 251 | R-specific alcohol dehydrogenase; short chain redu | 99.38 | |
| 3rwb_A | 247 | TPLDH, pyridoxal 4-dehydrogenase; short chain dehy | 99.38 | |
| 1gee_A | 261 | Glucose 1-dehydrogenase; short-chain dehydrogenase | 99.37 | |
| 3gvc_A | 277 | Oxidoreductase, probable short-chain type dehydrog | 99.37 | |
| 2qhx_A | 328 | Pteridine reductase 1; oxidoreductase, short-chain | 99.37 | |
| 1x1t_A | 260 | D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, S | 99.37 | |
| 3o38_A | 266 | Short chain dehydrogenase; tuberculosis, ortholog | 99.37 | |
| 3sxp_A | 362 | ADP-L-glycero-D-mannoheptose-6-epimerase; rossman | 99.37 | |
| 4eso_A | 255 | Putative oxidoreductase; NADP, structural genomics | 99.36 | |
| 4fc7_A | 277 | Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossman | 99.36 | |
| 3qlj_A | 322 | Short chain dehydrogenase; structural genomics, se | 99.36 | |
| 2d1y_A | 256 | Hypothetical protein TT0321; strucrtural genomics, | 99.36 | |
| 1mxh_A | 276 | Pteridine reductase 2; SDR topology, protein-subst | 99.36 | |
| 1xu9_A | 286 | Corticosteroid 11-beta-dehydrogenase, isozyme 1; h | 99.36 | |
| 2a4k_A | 263 | 3-oxoacyl-[acyl carrier protein] reductase; reduct | 99.36 | |
| 3icc_A | 255 | Putative 3-oxoacyl-(acyl carrier protein) reducta; | 99.36 | |
| 3k31_A | 296 | Enoyl-(acyl-carrier-protein) reductase; ssgcid, NI | 99.36 | |
| 3i1j_A | 247 | Oxidoreductase, short chain dehydrogenase/reducta; | 99.35 | |
| 3dqp_A | 219 | Oxidoreductase YLBE; alpha-beta protein., structur | 99.35 | |
| 2bd0_A | 244 | Sepiapterin reductase; oxidoreductase; HET: NAP BI | 99.35 | |
| 3oig_A | 266 | Enoyl-[acyl-carrier-protein] reductase [NADH]; fat | 99.35 | |
| 1hdc_A | 254 | 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxi | 99.35 | |
| 1rpn_A | 335 | GDP-mannose 4,6-dehydratase; short-chain dehydroge | 99.35 | |
| 4h15_A | 261 | Short chain alcohol dehydrogenase-related dehydro; | 99.35 | |
| 3d3w_A | 244 | L-xylulose reductase; uronate cycle, short-chain d | 99.35 | |
| 1cyd_A | 244 | Carbonyl reductase; short-chain dehydrogenase, oxi | 99.35 | |
| 3qvo_A | 236 | NMRA family protein; structural genomics, PSI-biol | 99.35 | |
| 3ew7_A | 221 | LMO0794 protein; Q8Y8U8_lismo, putative NAD-depend | 99.34 | |
| 3tl3_A | 257 | Short-chain type dehydrogenase/reductase; ssgcid, | 99.34 | |
| 1rkx_A | 357 | CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; | 99.34 | |
| 1oaa_A | 259 | Sepiapterin reductase; tetrahydrobiopterin, oxidor | 99.34 | |
| 3oec_A | 317 | Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; | 99.34 | |
| 1hxh_A | 253 | 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-b | 99.34 | |
| 4b79_A | 242 | PA4098, probable short-chain dehydrogenase; oxidor | 99.34 | |
| 3r6d_A | 221 | NAD-dependent epimerase/dehydratase; structural ge | 99.33 | |
| 2ag5_A | 246 | DHRS6, dehydrogenase/reductase (SDR family) member | 99.33 | |
| 2pzm_A | 330 | Putative nucleotide sugar epimerase/ dehydratase; | 99.33 | |
| 2pd4_A | 275 | Enoyl-[acyl-carrier-protein] reductase [NADH]; ant | 99.33 | |
| 3slg_A | 372 | PBGP3 protein; structural genomics, seattle struct | 99.33 | |
| 4e3z_A | 272 | Putative oxidoreductase protein; PSI-biology, stru | 99.33 | |
| 1nff_A | 260 | Putative oxidoreductase RV2002; directed evolution | 99.33 | |
| 4dyv_A | 272 | Short-chain dehydrogenase/reductase SDR; structura | 99.33 | |
| 1xg5_A | 279 | ARPG836; short chain dehydrogenase, human, SGC, st | 99.33 | |
| 2p4h_X | 322 | Vestitone reductase; NADPH-dependent reductase, is | 99.33 | |
| 3rft_A | 267 | Uronate dehydrogenase; apoenzyme, rossmann fold, N | 99.32 | |
| 1orr_A | 347 | CDP-tyvelose-2-epimerase; rossmann fold, short-cha | 99.32 | |
| 3dhn_A | 227 | NAD-dependent epimerase/dehydratase; reductase, PF | 99.31 | |
| 3guy_A | 230 | Short-chain dehydrogenase/reductase SDR; structura | 99.31 | |
| 1qsg_A | 265 | Enoyl-[acyl-carrier-protein] reductase; enoyl redu | 99.31 | |
| 2q1w_A | 333 | Putative nucleotide sugar epimerase/ dehydratase; | 99.31 | |
| 3ek2_A | 271 | Enoyl-(acyl-carrier-protein) reductase (NADH); ssg | 99.31 | |
| 2nwq_A | 272 | Probable short-chain dehydrogenase; oxidoreductase | 99.31 | |
| 2hun_A | 336 | 336AA long hypothetical DTDP-glucose 4,6-dehydrat; | 99.31 | |
| 2fwm_X | 250 | 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; e | 99.31 | |
| 1t2a_A | 375 | GDP-mannose 4,6 dehydratase; structural genomics c | 99.31 | |
| 2dtx_A | 264 | Glucose 1-dehydrogenase related protein; rossmann | 99.3 | |
| 1ek6_A | 348 | UDP-galactose 4-epimerase; short-chain dehydrogena | 99.3 | |
| 3h2s_A | 224 | Putative NADH-flavin reductase; Q03B84, NESG, LCR1 | 99.3 | |
| 3f9i_A | 249 | 3-oxoacyl-[acyl-carrier-protein] reductase; 3-keto | 99.3 | |
| 3p19_A | 266 | BFPVVD8, putative blue fluorescent protein; rossma | 99.3 | |
| 1yde_A | 270 | Retinal dehydrogenase/reductase 3; oxidoreductase, | 99.3 | |
| 3nrc_A | 280 | Enoyl-[acyl-carrier-protein] reductase (NADH); ros | 99.3 | |
| 2nm0_A | 253 | Probable 3-oxacyl-(acyl-carrier-protein) reductas; | 99.29 | |
| 1oc2_A | 348 | DTDP-glucose 4,6-dehydratase; lyase, NADH, rhamnos | 99.29 | |
| 4b4o_A | 298 | Epimerase family protein SDR39U1; isomerase; HET: | 99.29 | |
| 2b69_A | 343 | UDP-glucuronate decarboxylase 1; UDP-glucoronic ac | 99.29 | |
| 3gdg_A | 267 | Probable NADP-dependent mannitol dehydrogenase; ro | 99.29 | |
| 1xgk_A | 352 | Nitrogen metabolite repression regulator NMRA; ros | 99.28 | |
| 2c5a_A | 379 | GDP-mannose-3', 5'-epimerase; short chain dehydrat | 99.28 | |
| 2p91_A | 285 | Enoyl-[acyl-carrier-protein] reductase [NADH]; NAD | 99.28 | |
| 1sb8_A | 352 | WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCN | 99.27 | |
| 2wyu_A | 261 | Enoyl-[acyl carrier protein] reductase; oxidoreduc | 99.27 | |
| 3e9n_A | 245 | Putative short-chain dehydrogenase/reductase; stru | 99.27 | |
| 3grk_A | 293 | Enoyl-(acyl-carrier-protein) reductase (NADH); ssg | 99.27 | |
| 1edo_A | 244 | Beta-keto acyl carrier protein reductase; nucleoti | 99.27 | |
| 1hdo_A | 206 | Biliverdin IX beta reductase; foetal metabolism, H | 99.26 | |
| 3m2p_A | 311 | UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J | 99.26 | |
| 2hrz_A | 342 | AGR_C_4963P, nucleoside-diphosphate-sugar epimeras | 99.26 | |
| 4id9_A | 347 | Short-chain dehydrogenase/reductase; putative dehy | 99.26 | |
| 4dqv_A | 478 | Probable peptide synthetase NRP (peptide synthase; | 99.25 | |
| 2bka_A | 242 | CC3, TAT-interacting protein TIP30; NADPH, PEG600, | 99.25 | |
| 2ph3_A | 245 | 3-oxoacyl-[acyl carrier protein] reductase; TTHA04 | 99.25 | |
| 1n7h_A | 381 | GDP-D-mannose-4,6-dehydratase; rossmann fold, SDR, | 99.25 | |
| 1db3_A | 372 | GDP-mannose 4,6-dehydratase; NADP, GDP-fucose, lya | 99.25 | |
| 2a35_A | 215 | Hypothetical protein PA4017; alpha-beta-alpha sand | 99.25 | |
| 2q1s_A | 377 | Putative nucleotide sugar epimerase/ dehydratase; | 99.24 | |
| 2x4g_A | 342 | Nucleoside-diphosphate-sugar epimerase; isomerase; | 99.24 | |
| 1kew_A | 361 | RMLB;, DTDP-D-glucose 4,6-dehydratase; rossmann fo | 99.24 | |
| 3rku_A | 287 | Oxidoreductase YMR226C; substrate fingerprint, sho | 99.24 | |
| 1r6d_A | 337 | TDP-glucose-4,6-dehydratase; rossmann fold, short- | 99.24 | |
| 3vtz_A | 269 | Glucose 1-dehydrogenase; rossmann fold, oxidoreduc | 99.24 | |
| 3i6i_A | 346 | Putative leucoanthocyanidin reductase 1; rossmann | 99.23 | |
| 3ko8_A | 312 | NAD-dependent epimerase/dehydratase; isomerase, UD | 99.23 | |
| 3asu_A | 248 | Short-chain dehydrogenase/reductase SDR; SDR famil | 99.23 | |
| 2r6j_A | 318 | Eugenol synthase 1; phenylpropene, PIP reductase, | 99.23 | |
| 1y1p_A | 342 | ARII, aldehyde reductase II; rossmann fold, short | 99.23 | |
| 2gn4_A | 344 | FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann | 99.21 | |
| 1xq6_A | 253 | Unknown protein; structural genomics, protein stru | 99.2 | |
| 4f6c_A | 427 | AUSA reductase domain protein; thioester reductase | 99.2 | |
| 1z45_A | 699 | GAL10 bifunctional protein; epimerase, mutarotase, | 99.2 | |
| 2h7i_A | 269 | Enoyl-[acyl-carrier-protein] reductase [NADH]; oxi | 99.2 | |
| 1udb_A | 338 | Epimerase, UDP-galactose-4-epimerase; isomerase; H | 99.19 | |
| 2wm3_A | 299 | NMRA-like family domain containing protein 1; unkn | 99.19 | |
| 3mje_A | 496 | AMPHB; rossmann fold, oxidoreductase; HET: NDP; 1. | 99.19 | |
| 3ius_A | 286 | Uncharacterized conserved protein; APC63810, silic | 99.19 | |
| 2bll_A | 345 | Protein YFBG; decarboxylase, short chain dehydroge | 99.19 | |
| 2pk3_A | 321 | GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, shor | 99.18 | |
| 1jtv_A | 327 | 17 beta-hydroxysteroid dehydrogenase type 1; stero | 99.18 | |
| 1gy8_A | 397 | UDP-galactose 4-epimerase; oxidoreductase; HET: NA | 99.18 | |
| 2c20_A | 330 | UDP-glucose 4-epimerase; carbohydrate metabolism, | 99.17 | |
| 1o5i_A | 249 | 3-oxoacyl-(acyl carrier protein) reductase; TM1169 | 99.17 | |
| 1uay_A | 242 | Type II 3-hydroxyacyl-COA dehydrogenase; beta oxid | 99.16 | |
| 2ekp_A | 239 | 2-deoxy-D-gluconate 3-dehydrogenase; structural ge | 99.15 | |
| 3nzo_A | 399 | UDP-N-acetylglucosamine 4,6-dehydratase; structura | 99.15 | |
| 1ooe_A | 236 | Dihydropteridine reductase; structural genomics, P | 99.15 | |
| 3orf_A | 251 | Dihydropteridine reductase; alpha-beta-alpha sandw | 99.15 | |
| 2z5l_A | 511 | Tylkr1, tylactone synthase starter module and modu | 99.15 | |
| 1uzm_A | 247 | 3-oxoacyl-[acyl-carrier protein] reductase; beta-k | 99.15 | |
| 1qyc_A | 308 | Phenylcoumaran benzylic ether reductase PT1; NADPH | 99.15 | |
| 1dhr_A | 241 | Dihydropteridine reductase; oxidoreductase(acting | 99.14 | |
| 2v6g_A | 364 | Progesterone 5-beta-reductase; tyrosine-dependent | 99.14 | |
| 3uxy_A | 266 | Short-chain dehydrogenase/reductase SDR; structura | 99.14 | |
| 3e48_A | 289 | Putative nucleoside-diphosphate-sugar epimerase; a | 99.13 | |
| 3kzv_A | 254 | Uncharacterized oxidoreductase YIR035C; cytoplasmi | 99.13 | |
| 3gpi_A | 286 | NAD-dependent epimerase/dehydratase; structural ge | 99.13 | |
| 4e4y_A | 244 | Short chain dehydrogenase family protein; structur | 99.12 | |
| 2gas_A | 307 | Isoflavone reductase; NADPH-dependent reductase, o | 99.12 | |
| 1qyd_A | 313 | Pinoresinol-lariciresinol reductase; NADPH-depende | 99.12 | |
| 3c1o_A | 321 | Eugenol synthase; phenylpropene, PIP reductase, sh | 99.11 | |
| 3uce_A | 223 | Dehydrogenase; rossmann fold, oxidoreductase; HET: | 99.11 | |
| 2fr1_A | 486 | Erythromycin synthase, eryai; short chain dehydrog | 99.11 | |
| 1i24_A | 404 | Sulfolipid biosynthesis protein SQD1; SDR, short-c | 99.11 | |
| 2yy7_A | 312 | L-threonine dehydrogenase; thermolabIle, flavobact | 99.11 | |
| 3s8m_A | 422 | Enoyl-ACP reductase; rossmann fold, oxidoreductase | 99.1 | |
| 2p5y_A | 311 | UDP-glucose 4-epimerase; TTHA0591, structural geno | 99.1 | |
| 3vps_A | 321 | TUNA, NAD-dependent epimerase/dehydratase; tunicam | 99.09 | |
| 1z7e_A | 660 | Protein aRNA; rossmann fold, OB-like fold, hydrola | 99.09 | |
| 2dkn_A | 255 | 3-alpha-hydroxysteroid dehydrogenase; oxidoreducta | 99.09 | |
| 2jl1_A | 287 | Triphenylmethane reductase; oxidoreductase, biorem | 99.09 | |
| 3ay3_A | 267 | NAD-dependent epimerase/dehydratase; glucuronic ac | 99.08 | |
| 1fjh_A | 257 | 3alpha-hydroxysteroid dehydrogenase/carbonyl reduc | 99.07 | |
| 2ydy_A | 315 | Methionine adenosyltransferase 2 subunit beta; oxi | 99.07 | |
| 4f6l_B | 508 | AUSA reductase domain protein; thioester reductase | 99.06 | |
| 2et6_A | 604 | (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-ox | 99.06 | |
| 3zu3_A | 405 | Putative reductase YPO4104/Y4119/YP_4011; oxidored | 99.06 | |
| 3qp9_A | 525 | Type I polyketide synthase pikaii; rossmann fold, | 99.04 | |
| 4eue_A | 418 | Putative reductase CA_C0462; TER, biofuel, synthet | 99.02 | |
| 2zcu_A | 286 | Uncharacterized oxidoreductase YTFG; alpha-beta sa | 99.01 | |
| 3oh8_A | 516 | Nucleoside-diphosphate sugar epimerase (SULA FAMI; | 99.0 | |
| 3d7l_A | 202 | LIN1944 protein; APC89317, structural genomics, PS | 99.0 | |
| 3slk_A | 795 | Polyketide synthase extender module 2; rossmann fo | 98.98 | |
| 3u0b_A | 454 | Oxidoreductase, short chain dehydrogenase/reducta | 98.98 | |
| 2pff_A | 1688 | Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl | 98.97 | |
| 1d7o_A | 297 | Enoyl-[acyl-carrier protein] reductase (NADH) PRE; | 98.97 | |
| 3zen_D | 3089 | Fatty acid synthase; transferase, mycolic acid bio | 98.97 | |
| 2uv9_A | 1878 | Fatty acid synthase alpha subunits; fungal, dehydr | 98.96 | |
| 2uv8_A | 1887 | Fatty acid synthase subunit alpha (FAS2); fatty ac | 98.95 | |
| 1zmt_A | 254 | Haloalcohol dehalogenase HHEC; halohydrin dehaloge | 98.95 | |
| 1gz6_A | 319 | Estradiol 17 beta-dehydrogenase 4; 17BETA-HSD4, MF | 98.94 | |
| 3ehe_A | 313 | UDP-glucose 4-epimerase (GALE-1); PSI-II, NYSGXRC, | 98.93 | |
| 2et6_A | 604 | (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-ox | 98.93 | |
| 2x6t_A | 357 | ADP-L-glycero-D-manno-heptose-6-epimerase; isomera | 98.92 | |
| 3oml_A | 613 | GH14720P, peroxisomal multifunctional enzyme type | 98.92 | |
| 3lt0_A | 329 | Enoyl-ACP reductase; triclosan, triclosan variant, | 98.92 | |
| 1vl0_A | 292 | DTDP-4-dehydrorhamnose reductase, RFBD ortholog; s | 98.9 | |
| 2o2s_A | 315 | Enoyl-acyl carrier reductase; enoyl reductase, tri | 98.9 | |
| 2ptg_A | 319 | Enoyl-acyl carrier reductase; apicomplexa, enoyl ( | 98.9 | |
| 1lu9_A | 287 | Methylene tetrahydromethanopterin dehydrogenase; a | 98.9 | |
| 2yut_A | 207 | Putative short-chain oxidoreductase; alpha and bet | 98.9 | |
| 3sc6_A | 287 | DTDP-4-dehydrorhamnose reductase; RFBD, structural | 98.9 | |
| 3ic5_A | 118 | Putative saccharopine dehydrogenase; structural ge | 98.89 | |
| 1e6u_A | 321 | GDP-fucose synthetase; epimerase/reductase, SDR, R | 98.89 | |
| 3ajr_A | 317 | NDP-sugar epimerase; L-threonine dehydrogenase, L- | 98.85 | |
| 2vz8_A | 2512 | Fatty acid synthase; transferase, phosphopantethei | 98.83 | |
| 1n2s_A | 299 | DTDP-4-, DTDP-glucose oxidoreductase; rossman-fold | 98.82 | |
| 1zmo_A | 244 | Halohydrin dehalogenase; haloalcohol dehalogenase, | 98.8 | |
| 2ggs_A | 273 | 273AA long hypothetical DTDP-4-dehydrorhamnose red | 98.77 | |
| 1eq2_A | 310 | ADP-L-glycero-D-mannoheptose 6-epimerase; N-termin | 98.76 | |
| 3st7_A | 369 | Capsular polysaccharide synthesis enzyme CAP5F; ro | 98.71 | |
| 1u7z_A | 226 | Coenzyme A biosynthesis bifunctional protein coabc | 98.68 | |
| 4ggo_A | 401 | Trans-2-enoyl-COA reductase; rossmann fold, oxidor | 98.65 | |
| 2gk4_A | 232 | Conserved hypothetical protein; alpha-beta-alpha s | 98.64 | |
| 3llv_A | 141 | Exopolyphosphatase-related protein; NAD(P)-binding | 98.57 | |
| 4b8w_A | 319 | GDP-L-fucose synthase; oxidoreductase; HET: NAP GD | 98.55 | |
| 1y7t_A | 327 | Malate dehydrogenase; NAD-dependent-MDH-NADPH comp | 98.51 | |
| 1ff9_A | 450 | Saccharopine reductase; lysine biosynthesis, alpha | 98.44 | |
| 2hmt_A | 144 | YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane | 98.34 | |
| 1id1_A | 153 | Putative potassium channel protein; RCK domain, E. | 98.27 | |
| 1pqw_A | 198 | Polyketide synthase; rossmann fold, dimer, structu | 98.25 | |
| 4ina_A | 405 | Saccharopine dehydrogenase; structural genomics, P | 98.24 | |
| 1b8p_A | 329 | Protein (malate dehydrogenase); oxidoreductase; 1. | 98.18 | |
| 2g1u_A | 155 | Hypothetical protein TM1088A; structural genomics, | 98.18 | |
| 1lss_A | 140 | TRK system potassium uptake protein TRKA homolog; | 98.17 | |
| 2axq_A | 467 | Saccharopine dehydrogenase; rossmann fold variant, | 98.13 | |
| 1jay_A | 212 | Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossma | 98.12 | |
| 3l4b_C | 218 | TRKA K+ channel protien TM1088B; potassium channel | 98.09 | |
| 1nyt_A | 271 | Shikimate 5-dehydrogenase; alpha/beta domains, WID | 98.07 | |
| 1v3u_A | 333 | Leukotriene B4 12- hydroxydehydrogenase/prostaglan | 98.07 | |
| 2hcy_A | 347 | Alcohol dehydrogenase 1; tetramer of asymmetric di | 98.06 | |
| 1smk_A | 326 | Malate dehydrogenase, glyoxysomal; tricarboxylic c | 98.04 | |
| 3fwz_A | 140 | Inner membrane protein YBAL; TRKA-N domain, E.coli | 98.01 | |
| 3c24_A | 286 | Putative oxidoreductase; YP_511008.1, structural g | 97.97 | |
| 1p77_A | 272 | Shikimate 5-dehydrogenase; NADPH, oxidoreductase; | 97.96 | |
| 1nvt_A | 287 | Shikimate 5'-dehydrogenase; structural genomics, P | 97.94 | |
| 1qor_A | 327 | Quinone oxidoreductase; HET: NAP; 2.20A {Escherich | 97.9 | |
| 3o8q_A | 281 | Shikimate 5-dehydrogenase I alpha; structural geno | 97.9 | |
| 1wly_A | 333 | CAAR, 2-haloacrylate reductase; NADPH-dependent ox | 97.9 | |
| 1iz0_A | 302 | Quinone oxidoreductase; APO-enzyme, riken structur | 97.89 | |
| 3tnl_A | 315 | Shikimate dehydrogenase; structural genomics, cent | 97.89 | |
| 1yb5_A | 351 | Quinone oxidoreductase; medium-chain dehydrogenase | 97.87 | |
| 2j8z_A | 354 | Quinone oxidoreductase; medium-chain dehydrogenase | 97.87 | |
| 2j3h_A | 345 | NADP-dependent oxidoreductase P1; double bond redu | 97.87 | |
| 3jyo_A | 283 | Quinate/shikimate dehydrogenase; enzyme-cofactor c | 97.86 | |
| 4b7c_A | 336 | Probable oxidoreductase; NADP cofactor, rossmann f | 97.86 | |
| 4eye_A | 342 | Probable oxidoreductase; structural genomics, niai | 97.86 | |
| 4g65_A | 461 | TRK system potassium uptake protein TRKA; structur | 97.86 | |
| 3ond_A | 488 | Adenosylhomocysteinase; plant protein, enzyme-subs | 97.85 | |
| 2zb4_A | 357 | Prostaglandin reductase 2; rossmann fold, alternat | 97.84 | |
| 3abi_A | 365 | Putative uncharacterized protein PH1688; L-lysine | 97.81 | |
| 3pwz_A | 272 | Shikimate dehydrogenase 3; alpha-beta, oxidoreduct | 97.8 | |
| 4dup_A | 353 | Quinone oxidoreductase; PSI-biology, structural ge | 97.8 | |
| 3gms_A | 340 | Putative NADPH:quinone reductase; structural genom | 97.78 | |
| 2o7s_A | 523 | DHQ-SDH PR, bifunctional 3-dehydroquinate dehydrat | 97.78 | |
| 3phh_A | 269 | Shikimate dehydrogenase; shikimate pathway, helico | 97.78 | |
| 3qwb_A | 334 | Probable quinone oxidoreductase; rossmann fold, qu | 97.77 | |
| 2eez_A | 369 | Alanine dehydrogenase; TTHA0216, structural genomi | 97.72 | |
| 3jyn_A | 325 | Quinone oxidoreductase; rossmann fold, protein-NAD | 97.7 | |
| 1pzg_A | 331 | LDH, lactate dehydrogenase; apicomplexa, APAD, tet | 97.69 | |
| 2eih_A | 343 | Alcohol dehydrogenase; zinc ION binding protein, s | 97.67 | |
| 3don_A | 277 | Shikimate dehydrogenase; alpha-beta structure, ros | 97.65 | |
| 1f0y_A | 302 | HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive | 97.63 | |
| 2aef_A | 234 | Calcium-gated potassium channel MTHK; rossmann fol | 97.62 | |
| 1jvb_A | 347 | NAD(H)-dependent alcohol dehydrogenase; archaeon, | 97.61 | |
| 3t4e_A | 312 | Quinate/shikimate dehydrogenase; structural genomi | 97.61 | |
| 4huj_A | 220 | Uncharacterized protein; PSI-biology, nysgrc, stru | 97.59 | |
| 2cdc_A | 366 | Glucose dehydrogenase glucose 1-dehydrogenase, DHG | 97.58 | |
| 1ks9_A | 291 | KPA reductase;, 2-dehydropantoate 2-reductase; PAN | 97.57 | |
| 3lk7_A | 451 | UDP-N-acetylmuramoylalanine--D-glutamate ligase; a | 97.57 | |
| 3c85_A | 183 | Putative glutathione-regulated potassium-efflux S | 97.57 | |
| 3pi7_A | 349 | NADH oxidoreductase; groes-like fold, NAD(P)-bindi | 97.56 | |
| 3tl2_A | 315 | Malate dehydrogenase; center for structural genomi | 97.55 | |
| 2c0c_A | 362 | Zinc binding alcohol dehydrogenase, domain contain | 97.55 | |
| 2egg_A | 297 | AROE, shikimate 5-dehydrogenase; dimer, X-RAY diff | 97.55 | |
| 1mld_A | 314 | Malate dehydrogenase; oxidoreductase(NAD(A)-CHOH(D | 97.53 | |
| 1pjc_A | 361 | Protein (L-alanine dehydrogenase); oxidoreductase, | 97.53 | |
| 3k96_A | 356 | Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA | 97.52 | |
| 3fbg_A | 346 | Putative arginate lyase; structural genomics, unkn | 97.52 | |
| 1xa0_A | 328 | Putative NADPH dependent oxidoreductases; structur | 97.52 | |
| 4a0s_A | 447 | Octenoyl-COA reductase/carboxylase; oxidoreductase | 97.51 | |
| 2vns_A | 215 | Metalloreductase steap3; metal-binding, transmembr | 97.51 | |
| 2pv7_A | 298 | T-protein [includes: chorismate mutase (EC 5.4.99 | 97.5 | |
| 2raf_A | 209 | Putative dinucleotide-binding oxidoreductase; NP_7 | 97.49 | |
| 2ew2_A | 316 | 2-dehydropantoate 2-reductase, putative; alpha-str | 97.49 | |
| 1tt7_A | 330 | YHFP; alcohol dehydrogenase, Zn-dependent, NAD, st | 97.48 | |
| 1hye_A | 313 | L-lactate/malate dehydrogenase; nucleotide binding | 97.48 | |
| 1y6j_A | 318 | L-lactate dehydrogenase; southeast collaboratory f | 97.47 | |
| 4e12_A | 283 | Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1 | 97.47 | |
| 1o6z_A | 303 | MDH, malate dehydrogenase; halophilic, ION-binding | 97.46 | |
| 1dih_A | 273 | Dihydrodipicolinate reductase; oxidoreductase; HET | 97.46 | |
| 1bg6_A | 359 | N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L | 97.45 | |
| 2ewd_A | 317 | Lactate dehydrogenase,; protein-substrate_cofactor | 97.42 | |
| 3fbt_A | 282 | Chorismate mutase and shikimate 5-dehydrogenase fu | 97.41 | |
| 3dtt_A | 245 | NADP oxidoreductase; structural genomics, joint ce | 97.38 | |
| 3qha_A | 296 | Putative oxidoreductase; seattle structural genomi | 97.35 | |
| 2vhw_A | 377 | Alanine dehydrogenase; NAD, secreted, oxidoreducta | 97.34 | |
| 3ggo_A | 314 | Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-b | 97.34 | |
| 3nx4_A | 324 | Putative oxidoreductase; csgid, structural genomic | 97.32 | |
| 3gaz_A | 343 | Alcohol dehydrogenase superfamily protein; oxidore | 97.32 | |
| 1piw_A | 360 | Hypothetical zinc-type alcohol dehydrogenase- like | 97.32 | |
| 3oj0_A | 144 | Glutr, glutamyl-tRNA reductase; structural genomic | 97.31 | |
| 3l9w_A | 413 | Glutathione-regulated potassium-efflux system Pro | 97.3 | |
| 3krt_A | 456 | Crotonyl COA reductase; structural genomics, prote | 97.3 | |
| 1rjw_A | 339 | ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD | 97.3 | |
| 2vn8_A | 375 | Reticulon-4-interacting protein 1; mitochondrion, | 97.29 | |
| 3pef_A | 287 | 6-phosphogluconate dehydrogenase, NAD-binding; gam | 97.28 | |
| 3pqe_A | 326 | L-LDH, L-lactate dehydrogenase; FBP, oxidoreductas | 97.27 | |
| 1lld_A | 319 | L-lactate dehydrogenase; oxidoreductase(CHOH (D)-N | 97.26 | |
| 2uyy_A | 316 | N-PAC protein; long-chain dehydrogenase, cytokine; | 97.26 | |
| 3two_A | 348 | Mannitol dehydrogenase; cinnamyl-alcohol dehydroge | 97.24 | |
| 2nqt_A | 352 | N-acetyl-gamma-glutamyl-phosphate reductase; apopr | 97.24 | |
| 3doj_A | 310 | AT3G25530, dehydrogenase-like protein; gamma-hydro | 97.23 | |
| 5mdh_A | 333 | Malate dehydrogenase; oxidoreductase, (NAD(A)-CHOH | 97.22 | |
| 3gvi_A | 324 | Malate dehydrogenase; NAD, oxidoreductase, tricarb | 97.2 | |
| 4e21_A | 358 | 6-phosphogluconate dehydrogenase (decarboxylating; | 97.2 | |
| 3mog_A | 483 | Probable 3-hydroxybutyryl-COA dehydrogenase; struc | 97.19 | |
| 2hjr_A | 328 | Malate dehydrogenase; malaria, structural genomics | 97.19 | |
| 3fi9_A | 343 | Malate dehydrogenase; structural genomics, oxidore | 97.17 | |
| 4ezb_A | 317 | Uncharacterized conserved protein; structural geno | 97.17 | |
| 1ur5_A | 309 | Malate dehydrogenase; oxidoreductase, tricarboxyli | 97.14 | |
| 2ozp_A | 345 | N-acetyl-gamma-glutamyl-phosphate reductase; amino | 97.13 | |
| 3g0o_A | 303 | 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine | 97.12 | |
| 4gbj_A | 297 | 6-phosphogluconate dehydrogenase NAD-binding; stru | 97.11 | |
| 3gg2_A | 450 | Sugar dehydrogenase, UDP-glucose/GDP-mannose dehyd | 97.11 | |
| 2d8a_A | 348 | PH0655, probable L-threonine 3-dehydrogenase; pyro | 97.11 | |
| 1jw9_B | 249 | Molybdopterin biosynthesis MOEB protein; MOEB: mod | 97.1 | |
| 2qyt_A | 317 | 2-dehydropantoate 2-reductase; APC81190, porphyrom | 97.1 | |
| 3p2o_A | 285 | Bifunctional protein fold; structural genomics, ce | 97.08 | |
| 1yqd_A | 366 | Sinapyl alcohol dehydrogenase; lignin, monolignol, | 97.08 | |
| 1t2d_A | 322 | LDH-P, L-lactate dehydrogenase; ternary complex, o | 97.08 | |
| 1gu7_A | 364 | Enoyl-[acyl-carrier-protein] reductase [NADPH, B-s | 97.08 | |
| 2f1k_A | 279 | Prephenate dehydrogenase; tyrosine synthesis, X-RA | 97.06 | |
| 2rcy_A | 262 | Pyrroline carboxylate reductase; malaria, structur | 97.05 | |
| 3pdu_A | 287 | 3-hydroxyisobutyrate dehydrogenase family protein; | 97.04 | |
| 3goh_A | 315 | Alcohol dehydrogenase, zinc-containing; NP_718042. | 97.04 | |
| 3i83_A | 320 | 2-dehydropantoate 2-reductase; structural genomics | 97.03 | |
| 2rir_A | 300 | Dipicolinate synthase, A chain; structural genomic | 97.0 | |
| 1guz_A | 310 | Malate dehydrogenase; oxidoreductase, tricarboxyli | 97.0 | |
| 3uog_A | 363 | Alcohol dehydrogenase; structural genomics, protei | 97.0 | |
| 4dvj_A | 363 | Putative zinc-dependent alcohol dehydrogenase Pro; | 96.99 | |
| 3u62_A | 253 | Shikimate dehydrogenase; shikimate pathway, oxidor | 96.99 | |
| 1vpd_A | 299 | Tartronate semialdehyde reductase; structural geno | 96.98 | |
| 1uuf_A | 369 | YAHK, zinc-type alcohol dehydrogenase-like protein | 96.97 | |
| 1leh_A | 364 | Leucine dehydrogenase; oxidoreductase; 2.20A {Lysi | 96.97 | |
| 3hn2_A | 312 | 2-dehydropantoate 2-reductase; PSI-2, NYSGXRC, str | 96.96 | |
| 1e3j_A | 352 | NADP(H)-dependent ketose reductase; oxidoreductase | 96.96 | |
| 2gcg_A | 330 | Glyoxylate reductase/hydroxypyruvate reductase; NA | 96.95 | |
| 1ys4_A | 354 | Aspartate-semialdehyde dehydrogenase; oxidoreducta | 96.95 | |
| 2dpo_A | 319 | L-gulonate 3-dehydrogenase; structural genomics, N | 96.93 | |
| 1xyg_A | 359 | Putative N-acetyl-gamma-glutamyl-phosphate reduct; | 96.93 | |
| 4h7p_A | 345 | Malate dehydrogenase; ssgcid, structural G seattle | 96.93 | |
| 2dq4_A | 343 | L-threonine 3-dehydrogenase; NAD-dependent, oxidor | 96.93 | |
| 2v6b_A | 304 | L-LDH, L-lactate dehydrogenase; oxidoreductase, ra | 96.93 | |
| 2izz_A | 322 | Pyrroline-5-carboxylate reductase 1; amino-acid bi | 96.92 | |
| 2z2v_A | 365 | Hypothetical protein PH1688; L-lysine dehydrogenas | 96.92 | |
| 2hk9_A | 275 | Shikimate dehydrogenase; shikimate pathway, drug d | 96.92 | |
| 1kjq_A | 391 | GART 2, phosphoribosylglycinamide formyltransferas | 96.91 | |
| 3ngx_A | 276 | Bifunctional protein fold; methylenetetrahydrofola | 96.9 | |
| 1gpj_A | 404 | Glutamyl-tRNA reductase; tRNA-dependent tetrapyrro | 96.89 | |
| 3cky_A | 301 | 2-hydroxymethyl glutarate dehydrogenase; rossmann | 96.89 | |
| 3ghy_A | 335 | Ketopantoate reductase protein; oxidoreductase, NA | 96.89 | |
| 1mv8_A | 436 | GMD, GDP-mannose 6-dehydrogenase; rossman fold, do | 96.89 | |
| 3qsg_A | 312 | NAD-binding phosphogluconate dehydrogenase-like P; | 96.88 | |
| 3d4o_A | 293 | Dipicolinate synthase subunit A; NP_243269.1, stru | 96.88 | |
| 3s2e_A | 340 | Zinc-containing alcohol dehydrogenase superfamily; | 96.88 | |
| 2dbq_A | 334 | Glyoxylate reductase; D-3-phosphoglycerate dehydro | 96.88 | |
| 2h6e_A | 344 | ADH-4, D-arabinose 1-dehydrogenase; rossman fold, | 96.88 | |
| 3g17_A | 294 | Similar to 2-dehydropantoate 2-reductase; structur | 96.87 | |
| 3p7m_A | 321 | Malate dehydrogenase; putative dehydrogenase, enzy | 96.86 | |
| 1h2b_A | 359 | Alcohol dehydrogenase; oxidoreductase, archaea, hy | 96.86 | |
| 4dll_A | 320 | 2-hydroxy-3-oxopropionate reductase; structural ge | 96.86 | |
| 2b5w_A | 357 | Glucose dehydrogenase; nucleotide binding motif, o | 96.85 | |
| 3gqv_A | 371 | Enoyl reductase; medium-chain reductase (MDR super | 96.84 | |
| 3dfz_A | 223 | SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase | 96.83 | |
| 3ktd_A | 341 | Prephenate dehydrogenase; structural genomics, joi | 96.83 | |
| 2ahr_A | 259 | Putative pyrroline carboxylate reductase; pyrrolin | 96.82 | |
| 1oju_A | 294 | MDH, malate dehydrogenase; hyperthermophilic, oxid | 96.81 | |
| 2h78_A | 302 | Hibadh, 3-hydroxyisobutyrate dehydrogenase; APC601 | 96.81 | |
| 3tqh_A | 321 | Quinone oxidoreductase; HET: NDP; 2.44A {Coxiella | 96.8 | |
| 4a5o_A | 286 | Bifunctional protein fold; oxidoreductase, hydrola | 96.79 | |
| 1evy_A | 366 | Glycerol-3-phosphate dehydrogenase; rossmann fold, | 96.79 | |
| 1vj0_A | 380 | Alcohol dehydrogenase, zinc-containing; TM0436, st | 96.79 | |
| 3l07_A | 285 | Bifunctional protein fold; structural genomics, ID | 96.78 | |
| 3tri_A | 280 | Pyrroline-5-carboxylate reductase; amino acid bios | 96.77 | |
| 1txg_A | 335 | Glycerol-3-phosphate dehydrogenase [NAD(P)+]; oxid | 96.77 | |
| 1yqg_A | 263 | Pyrroline-5-carboxylate reductase; structural geno | 96.76 | |
| 3vku_A | 326 | L-LDH, L-lactate dehydrogenase; rossmann fold, NAD | 96.76 | |
| 1cdo_A | 374 | Alcohol dehydrogenase; oxidoreductase, oxidoreduct | 96.76 | |
| 1a5z_A | 319 | L-lactate dehydrogenase; oxidoreductase, glycolysi | 96.75 | |
| 2jhf_A | 374 | Alcohol dehydrogenase E chain; oxidoreductase, met | 96.74 | |
| 3ado_A | 319 | Lambda-crystallin; L-gulonate 3-dehydrogenase, str | 96.74 | |
| 1e3i_A | 376 | Alcohol dehydrogenase, class II; HET: NAD; 2.08A { | 96.74 | |
| 1yb4_A | 295 | Tartronic semialdehyde reductase; structural genom | 96.73 | |
| 3l6d_A | 306 | Putative oxidoreductase; structural genomics, prot | 96.71 | |
| 2vou_A | 397 | 2,6-dihydroxypyridine hydroxylase; oxidoreductase, | 96.7 |
| >4fn4_A Short chain dehydrogenase; NADH-binding, rossmann fold, oxidoreductase; HET: NAD; 1.75A {Sulfolobus acidocaldarius} | Back alignment and structure |
|---|
Probab=99.59 E-value=2.4e-15 Score=77.63 Aligned_cols=63 Identities=29% Similarity=0.171 Sum_probs=52.7
Q ss_pred CCCCCeEEEEecCcchHHHHHHHHHHHCCCEEEEEEeCCCCcchhHHhhhcCCCCceEEEEccC
Q 036468 1 MSGKGKVVCVTGASGFIASWLVKLLLQRSYTVKATVRDLNNHNAEHLLTLDGAEERLHLFKANS 64 (64)
Q Consensus 1 ~~~~~~~~~i~g~~~~ig~~~~~~l~~~~~~v~~~~r~~~~~~~~~~~~~~~~~~~~~~~~~Di 64 (64)
|++++|+++|||++++||+++++.|+++|++|++.+|+++..+ +..+++...+.++..+++|+
T Consensus 3 ~sL~gKvalVTGas~GIG~aiA~~la~~Ga~Vv~~~~~~~~~~-~~~~~i~~~g~~~~~~~~Dv 65 (254)
T 4fn4_A 3 QSLKNKVVIVTGAGSGIGRAIAKKFALNDSIVVAVELLEDRLN-QIVQELRGMGKEVLGVKADV 65 (254)
T ss_dssp GGGTTCEEEEETTTSHHHHHHHHHHHHTTCEEEEEESCHHHHH-HHHHHHHHTTCCEEEEECCT
T ss_pred CCCCCCEEEEeCCCCHHHHHHHHHHHHcCCEEEEEECCHHHHH-HHHHHHHhcCCcEEEEEccC
Confidence 4678899999999999999999999999999999999876554 34445555577889999986
|
| >3h7a_A Short chain dehydrogenase; oxidoreductase, PSI-2, NYSGXRC, structural genomics, protein structure initiative; 1.87A {Rhodopseudomonas palustris} | Back alignment and structure |
|---|
| >4gkb_A 3-oxoacyl-[acyl-carrier protein] reductase; putative sugar dehydrogenase, enzyme function initiative, EF structural genomics; 1.50A {Burkholderia multivorans} PDB: 4glo_A* | Back alignment and structure |
|---|
| >3lyl_A 3-oxoacyl-(acyl-carrier-protein) reductase; alpha and beta protein, NAD(P)-binding rossmann fold, csgid, oxidoreductase; 1.95A {Francisella tularensis subsp} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3r1i_A Short-chain type dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.95A {Mycobacterium marinum} | Back alignment and structure |
|---|
| >4g81_D Putative hexonate dehydrogenase; enzyme function initiative, EFI, structural genomics, dehydr oxidoreductase; 1.90A {Salmonella enterica subsp} | Back alignment and structure |
|---|
| >3qiv_A Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR protein] reductase; structural genomics; 2.25A {Mycobacterium avium subsp} | Back alignment and structure |
|---|
| >3rih_A Short chain dehydrogenase or reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: PG5; 2.15A {Mycobacterium abscessus} | Back alignment and structure |
|---|
| >4imr_A 3-oxoacyl-(acyl-carrier-protein) reductase; oxidoreductase, nicotinamide adenine dinucleotide phosphate, structural genomics; HET: NAP; 1.96A {Agrobacterium fabrum} | Back alignment and structure |
|---|
| >3v8b_A Putative dehydrogenase, possibly 3-oxoacyl-[acyl- protein] reductase; PSI-biology, structural genomics, protein structure initiati nysgrc; 2.70A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >2ae2_A Protein (tropinone reductase-II); oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to pseudotropine; HET: NAP PTO; 1.90A {Datura stramonium} SCOP: c.2.1.2 PDB: 2ae1_A* 1ipe_A* 1ipf_A* | Back alignment and structure |
|---|
| >3svt_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 2.00A {Mycobacterium ulcerans} | Back alignment and structure |
|---|
| >3pk0_A Short-chain dehydrogenase/reductase SDR; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 1.75A {Mycobacterium smegmatis} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >4iin_A 3-ketoacyl-acyl carrier protein reductase (FABG); structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 2.40A {Helicobacter pylori} PDB: 4ijk_A | Back alignment and structure |
|---|
| >3gaf_A 7-alpha-hydroxysteroid dehydrogenase; seattle structural genomics center for infectious disease, ssgcid, oxidoreductase, structural genomics; 2.20A {Brucella melitensis} | Back alignment and structure |
|---|
| >4hp8_A 2-deoxy-D-gluconate 3-dehydrogenase; enzyme function initiative, EFI, structural genomics, oxidor; HET: NAP; 1.35A {Agrobacterium tumefaciens} | Back alignment and structure |
|---|
| >3awd_A GOX2181, putative polyol dehydrogenase; oxidoreductase; 1.80A {Gluconobacter oxydans} | Back alignment and structure |
|---|
| >3sc4_A Short chain dehydrogenase (A0QTM2 homolog); ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; 2.50A {Mycobacterium thermoresistibile} | Back alignment and structure |
|---|
| >3edm_A Short chain dehydrogenase; structural genomics, oxidoreductase, PSI-2, P structure initiative; 2.30A {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >2hq1_A Glucose/ribitol dehydrogenase; CTH-1438, structural genomics, southeast collaboratory for structural genomics, secsg, PSI; 1.90A {Clostridium thermocellum} | Back alignment and structure |
|---|
| >3tfo_A Putative 3-oxoacyl-(acyl-carrier-protein) reducta; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.08A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >3m1a_A Putative dehydrogenase; short, PSI, MCSG, structural genomics, midwest center for structural genomics, protein structure initiative; 2.00A {Streptomyces avermitilis} | Back alignment and structure |
|---|
| >1ae1_A Tropinone reductase-I; oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to tropine, short-chain dehydrogenase; HET: NAP; 2.40A {Datura stramonium} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3imf_A Short chain dehydrogenase; structural genomics, infectious D center for structural genomics of infectious diseases, oxidoreductase, csgid; HET: MSE; 1.99A {Bacillus anthracis str} | Back alignment and structure |
|---|
| >3tpc_A Short chain alcohol dehydrogenase-related dehydro; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.34A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >3ged_A Short-chain dehydrogenase/reductase SDR; SCOR, rossmann fold, oxidoreductase; 1.70A {Clostridium thermocellum atcc 27405} PDB: 3geg_A* | Back alignment and structure |
|---|
| >3ai3_A NADPH-sorbose reductase; rossmann-fold, NADPH-dependent reductase, short chain dehydrogenase/reductase, oxidoreductase; HET: NAP SOL SOE; 1.80A {Gluconobacter frateurii} PDB: 3ai2_A* 3ai1_A* | Back alignment and structure |
|---|
| >4fs3_A Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; rossmann fold, short chain dehydrogenase, NADPH binding, oxidoreductase; HET: 0WD 0WE; 1.80A {Staphylococcus aureus subsp} PDB: 3gr6_A* 3gns_A* 4all_A* 3gnt_A 4alk_A* 4alj_A* 4ali_A* 4alm_A 4aln_A | Back alignment and structure |
|---|
| >3sju_A Keto reductase; short-chain dehydrogenase, oxidoreductase; HET: NDP; 2.40A {Streptomyces griseoruber} | Back alignment and structure |
|---|
| >3ksu_A 3-oxoacyl-acyl carrier protein reductase; structural genomics, PSI-2, dehydrogenase, protein structure initiative; 2.30A {Oenococcus oeni psu-1} | Back alignment and structure |
|---|
| >3rkr_A Short chain oxidoreductase; rossmann fold; HET: NAP; 2.42A {Uncultured bacterium BIO5} | Back alignment and structure |
|---|
| >3tjr_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, SCD, NAD; HET: UNL; 1.60A {Mycobacterium avium subsp} | Back alignment and structure |
|---|
| >4ibo_A Gluconate dehydrogenase; enzyme function initiative structural genomics, oxidoreductase; 2.10A {Agrobacterium fabrum} | Back alignment and structure |
|---|
| >3e03_A Short chain dehydrogenase; structural genomics, PSI-2, protein structure initiative, NEW YORK structural genomix research consortium; 1.69A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >3uf0_A Short-chain dehydrogenase/reductase SDR; gluconate, gluconate 5-dehydratase, NAD(P) dependent, enzyme initiative, EFI, oxidoreductase; HET: NAP; 2.00A {Beutenbergia cavernae} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >2c29_D Dihydroflavonol 4-reductase; flavonoids, short dehydrogenase reductase, NADPH, dihydroquercetin, rossmann fold, oxidoreductase; HET: NAP DQH; 1.81A {Vitis vinifera} PDB: 2iod_A* 2nnl_D* 3bxx_A* 3c1t_A* | Back alignment and structure |
|---|
| >2o23_A HADH2 protein; HSD17B10, schad, ERAB, type II HADH, 2-methyl-3-hydroxybuTyr dehydrogenase, MHBD, structural genomics, structural genomi consortium; HET: NAD GOL; 1.20A {Homo sapiens} SCOP: c.2.1.2 PDB: 1so8_A 1u7t_A* 1e3s_A* 1e3w_B* 1e3w_A* 1e6w_A* | Back alignment and structure |
|---|
| >4egf_A L-xylulose reductase; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, oxidoreductase; 2.30A {Mycobacterium smegmatis} | Back alignment and structure |
|---|
| >3ijr_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, infectious D center for structural genomics of infectious diseases; HET: NAD; 2.05A {Bacillus anthracis str} PDB: 3i3o_A* | Back alignment and structure |
|---|
| >2rhc_B Actinorhodin polyketide ketoreductase; oxidoreductase, combinatorial biosynthesis, short chain dehydrogenase/reductase; HET: NAP EMO; 2.10A {Streptomyces coelicolor} SCOP: c.2.1.2 PDB: 2rh4_A* 1w4z_A* 3csd_B* 3qrw_A* 3ri3_B* 2rhr_B* 1x7g_A* 1x7h_A* 1xr3_A* | Back alignment and structure |
|---|
| >3nyw_A Putative oxidoreductase; fatty acid synthesis,3-oxoacyl-[ACP] reductase, NADP+ bindin rossman fold, PSI-II, nysgxrc; 2.16A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >1yb1_A 17-beta-hydroxysteroid dehydrogenase type XI; short chain dehydrogenase, HUM structural genomics, structural genomics consortium, SGC; HET: AE2; 1.95A {Homo sapiens} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >1fmc_A 7 alpha-hydroxysteroid dehydrogenase; short-chain dehydrogenase/reductase, bIle acid catabolism, oxidoreductase; HET: CHO NAD; 1.80A {Escherichia coli} SCOP: c.2.1.2 PDB: 1ahi_A* 1ahh_A* | Back alignment and structure |
|---|
| >3v2g_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, protein structure initiati nysgrc; 2.30A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >4dmm_A 3-oxoacyl-[acyl-carrier-protein] reductase; rossmann fold, oxoacyl-ACP reductase, NADP binding, fatty AC biosynthsis, oxidoreductase; HET: NAP; 2.38A {Synechococcus elongatus} PDB: 4dml_A* | Back alignment and structure |
|---|
| >1xq1_A Putative tropinone reducatse; structural genomics, protein structure initiative, CESG, AT1 reductively methylated protein; 2.10A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2q45_A | Back alignment and structure |
|---|
| >3ucx_A Short chain dehydrogenase; ssgcid, seattle structural genomics center for infectious DI dehydrogenase, oxidoreductase; HET: 1PE; 1.85A {Mycobacterium smegmatis} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >3ioy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structure initiative; 1.90A {Novosphingobium aromaticivorans DSM12444} | Back alignment and structure |
|---|
| >4fgs_A Probable dehydrogenase protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, three layer; 1.76A {Rhizobium etli} | Back alignment and structure |
|---|
| >3i4f_A 3-oxoacyl-[acyl-carrier protein] reductase; structural genomics, 3-oxoacyl-reductase, PSI-2; 2.39A {Bacillus thuringiensis serovar kurstakorganism_taxid} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >3u5t_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.40A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >2b4q_A Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier-protein] reductase; RHLG-NADP complex, oxidoreductase; HET: NAP; 2.30A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >1xhl_A Short-chain dehydrogenase/reductase family member putative tropinone reductase-II...; parallel beta-sheet of seven strands in the order 3214567; HET: NDP TNE; 2.40A {Caenorhabditis elegans} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >1sby_A Alcohol dehydrogenase; ternary complex, NAD, trifluoroethanol, oxidoreductase; HET: NAD; 1.10A {Scaptodrosophila lebanonensis} SCOP: c.2.1.2 PDB: 1b14_A* 1b15_A* 1a4u_A* 1b2l_A* 1b16_A* 3rj5_A* 3rj9_A* 1mg5_A* | Back alignment and structure |
|---|
| >3afn_B Carbonyl reductase; alpha/beta/alpha, rossmann-fold, oxidoreductase; HET: NAP; 1.63A {Sphingomonas SP} PDB: 3afm_A* | Back alignment and structure |
|---|
| >1zem_A Xylitol dehydrogenase; rossmann fold, dinucleotide-binding domain, oxidoreductase; HET: NAD; 1.90A {Gluconobacter oxydans} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3rd5_A Mypaa.01249.C; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; HET: EPE; 1.50A {Mycobacterium paratuberculosis} | Back alignment and structure |
|---|
| >3tox_A Short chain dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; HET: NAP; 1.93A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >1g0o_A Trihydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, dinucleotide binding fold, oxidoreductase; HET: NDP PYQ; 1.70A {Magnaporthe grisea} SCOP: c.2.1.2 PDB: 1doh_A* 1g0n_A* 1ybv_A* | Back alignment and structure |
|---|
| >3tzq_B Short-chain type dehydrogenase/reductase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; 2.50A {Mycobacterium marinum} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >2jah_A Clavulanic acid dehydrogenase; short-chain dehydrogenase/reductase, lactamase inhibitor, AN biosynthesis, NADPH, oxidoreductase; HET: MSE NDP; 1.80A {Streptomyces clavuligerus} PDB: 2jap_A* | Back alignment and structure |
|---|
| >3osu_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, csgid, center for structural genomics O infectious diseases; 1.90A {Staphylococcus aureus subsp} SCOP: c.2.1.0 PDB: 3sj7_A* | Back alignment and structure |
|---|
| >1ja9_A 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, oxidoreductase, chain dehydrogenase; HET: NDP PYQ; 1.50A {Magnaporthe grisea} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >2zat_A Dehydrogenase/reductase SDR family member 4; alpha/beta, oxidoreductase; HET: NAP; 1.50A {Sus scrofa} PDB: 3o4r_A* | Back alignment and structure |
|---|
| >3n74_A 3-ketoacyl-(acyl-carrier-protein) reductase; seattle structural genomics center for infectious disease, S brucellosis; 2.20A {Brucella melitensis biovar abortus} | Back alignment and structure |
|---|
| >3o26_A Salutaridine reductase; short chain dehydrogenase/reductases, oxidoreductase; HET: NDP; 1.91A {Papaver somniferum} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >1xkq_A Short-chain reductase family member (5D234); parrallel beta-sheet of seven strands in the order 3214567; HET: NDP; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3zv4_A CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; oxidoreductase, short chain dehydrogenase/oxidoreductase, SD comamonas testosteroni; 1.80A {Pandoraea pnomenusa} SCOP: c.2.1.2 PDB: 2y99_A* 3zv3_A 2y93_A 3zv5_A* 3zv6_A* 1bdb_A* | Back alignment and structure |
|---|
| >2z1n_A Dehydrogenase; reductase, SDR, oxidoreductase; 1.80A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >3ppi_A 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, dehydrogenas mycobacterium avium, structural genomics; 2.00A {Mycobacterium avium} | Back alignment and structure |
|---|
| >3ctm_A Carbonyl reductase; alcohol dehydrogenase, short-chain dehydrogenases/reductases (SDR), X-RAY crystallography, oxidoreductase; 2.69A {Candida parapsilosis} | Back alignment and structure |
|---|
| >3enk_A UDP-glucose 4-epimerase; seattle structural genomics center for infectious disease, ssgcid, isomerase, NAD; HET: NAD GUD; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >4dqx_A Probable oxidoreductase protein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.00A {Rhizobium etli} | Back alignment and structure |
|---|
| >1h5q_A NADP-dependent mannitol dehydrogenase; oxidoreductase, mannitol metabolism; HET: NAP; 1.50A {Agaricus bisporus} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3v2h_A D-beta-hydroxybutyrate dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 3.00A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >1iy8_A Levodione reductase; oxidoreductase; HET: NAD; 1.60A {Leifsonia aquatica} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3lf2_A Short chain oxidoreductase Q9HYA2; SDR, SCOR, rossmann fold; HET: NAP; 2.30A {Pseudomonas aeruginosa} PDB: 3lf1_A* | Back alignment and structure |
|---|
| >3s55_A Putative short-chain dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 2.10A {Mycobacterium abscessus} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >3ruf_A WBGU; rossmann fold, UDP-hexose 4-epimerase, isomerase; HET: NAD UDP; 2.00A {Plesiomonas shigelloides} SCOP: c.2.1.2 PDB: 3ru9_A* 3rud_A* 3rue_A* 3rua_A* 3ruh_A* 3ruc_A* 3ru7_A* 3lu1_A* | Back alignment and structure |
|---|
| >4da9_A Short-chain dehydrogenase/reductase; structural genomics, protein structure initiative, PSI-biology; 2.50A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >2qq5_A DHRS1, dehydrogenase/reductase SDR family member 1; short-chain, structura genomics consortium, SGC, oxidoreductase; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3is3_A 17BETA-hydroxysteroid dehydrogenase; short chain dehydrogenase/REDU SDR, fungi, oxidoreductase; HET: GOL; 1.48A {Cochliobolus lunatus} PDB: 3qwf_A* 3qwh_A* 3qwi_A* 3itd_A | Back alignment and structure |
|---|
| >1w6u_A 2,4-dienoyl-COA reductase, mitochondrial precursor; short chain dehydrogenase, beta- oxidation, NADP, oxidoreductase; HET: HXC NAP; 1.75A {Homo sapiens} SCOP: c.2.1.2 PDB: 1w73_A* 1w8d_A* | Back alignment and structure |
|---|
| >2c07_A 3-oxoacyl-(acyl-carrier protein) reductase; oxidoreductase, FABG, short-chain alcohol reductase, fatty acid biosynthesis, apicoplast; 1.5A {Plasmodium falciparum} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3pxx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, NAD, tuberculosis; HET: NAD; 2.00A {Mycobacterium avium} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >3ftp_A 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid, 3-ketoacyl-(acyl-carrier- protein) reductase, oxidoreductase, structural genomics; 2.05A {Burkholderia pseudomallei} | Back alignment and structure |
|---|
| >3t4x_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, center for structural genomics of infec diseases, csgid; 2.80A {Bacillus anthracis} | Back alignment and structure |
|---|
| >2rh8_A Anthocyanidin reductase; flavonoids, rossmann fold, short chain dehydrogenase/reductase, oxidoreductase; 2.22A {Vitis vinifera} PDB: 3hfs_A | Back alignment and structure |
|---|
| >3pgx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.85A {Mycobacterium avium} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >2uvd_A 3-oxoacyl-(acyl-carrier-protein) reductase; beta-ketoacyl- (acyl carrier protein) reductase, short-chain dehydrogenase/reductase (SDR); 2.4A {Bacillus anthracis} | Back alignment and structure |
|---|
| >3oid_A Enoyl-[acyl-carrier-protein] reductase [NADPH]; fatty acid synthesis, enoyl-ACP reductases, FABL, rossmann-L NADPH binding, oxidoreductase; HET: TCL NDP; 1.80A {Bacillus subtilis} PDB: 3oic_A* | Back alignment and structure |
|---|
| >3l77_A Short-chain alcohol dehydrogenase; oxidoreductase; HET: NJP PG4; 1.60A {Thermococcus sibiricus} SCOP: c.2.1.0 PDB: 3tn7_A* | Back alignment and structure |
|---|
| >1geg_A Acetoin reductase; SDR family, oxidoreductase; HET: GLC NAD; 1.70A {Klebsiella pneumoniae} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3u9l_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.10A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >1spx_A Short-chain reductase family member (5L265); parallel beta-sheet of seven strands in the order 3214567; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >1wma_A Carbonyl reductase [NADPH] 1; oxidoreductase; HET: AB3 NDP PE5 P33; 1.24A {Homo sapiens} SCOP: c.2.1.2 PDB: 3bhi_A* 3bhj_A* 3bhm_A* 2pfg_A* 1n5d_A* 2hrb_A* | Back alignment and structure |
|---|
| >3sx2_A Putative 3-ketoacyl-(acyl-carrier-protein) reduct; ssgcid, 3-ketoacyl-(acyl-carrier-protein) reductase, mycobac paratuberculosis; HET: NAD; 1.50A {Mycobacterium avium subsp} | Back alignment and structure |
|---|
| >3gem_A Short chain dehydrogenase; structural genomics, APC65077, oxidoreductase, PSI-2, protein structure initiative; 1.83A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >2pd6_A Estradiol 17-beta-dehydrogenase 8; short-chain dehydrogenase/reductase, steroid metabolism, LIP metabolism, structural genomics; HET: NAD; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2q2v_A Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidoreductase; HET: NAD; 1.90A {Pseudomonas putida} PDB: 2q2q_A* 2q2w_A | Back alignment and structure |
|---|
| >3e8x_A Putative NAD-dependent epimerase/dehydratase; structural genomics, APC7755, NADP, P protein structure initiative; HET: MSE NAP; 2.10A {Bacillus halodurans} | Back alignment and structure |
|---|
| >2wsb_A Galactitol dehydrogenase; oxidoreductase, SDR, rossmann fold, tagatose; HET: NAD; 1.25A {Rhodobacter sphaeroides} PDB: 2wdz_A* 3lqf_A* | Back alignment and structure |
|---|
| >3kvo_A Hydroxysteroid dehydrogenase-like protein 2; HSDL2, human hydroxysteroid dehydrogenase like 2, SDHL2, STR genomics, structural genomics consortium; HET: NAP; 2.25A {Homo sapiens} | Back alignment and structure |
|---|
| >3r3s_A Oxidoreductase; structural genomics, csgid, center for structural genomics O infectious diseases, 3-layer(ABA) sandwich, rossmann fold; HET: NAD; 1.25A {Salmonella enterica subsp} | Back alignment and structure |
|---|
| >2pnf_A 3-oxoacyl-[acyl-carrier-protein] reductase; short chain oxidoreductase, rossmann fold, oxidoreductase; HET: 1PE MES; 1.80A {Aquifex aeolicus} PDB: 2p68_A* | Back alignment and structure |
|---|
| >3a28_C L-2.3-butanediol dehydrogenase; chiral substrate recognition, oxidoreductase; HET: NAD; 2.00A {Brevibacterium saccharolyticum} | Back alignment and structure |
|---|
| >1vl8_A Gluconate 5-dehydrogenase; TM0441, structural genomics, JCSG structure initiative, PSI, joint center for structural GENO oxidoreductase; HET: NAP; 2.07A {Thermotoga maritima} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >2x9g_A PTR1, pteridine reductase; short chain dehydrogenase, oxidoreductase; HET: NAP LYA; 1.10A {Trypanosoma brucei brucei} PDB: 2x9n_A* 2x9v_A* 3bmc_A* 3bmd_A* 3bme_A* 3bmf_A* 3bmg_A* 3bmh_A* 3bmi_A* 3bmj_A* 3bmk_A* 3bml_A* 3bmm_A* 3bmn_A* 3bmo_A* 3bmq_A* 3bmr_A* 3gn1_A* 3gn2_A* 3jq6_A* ... | Back alignment and structure |
|---|
| >4egb_A DTDP-glucose 4,6-dehydratase; rhamnose pathway, center for structural genomics of infectio diseases, csgid, niaid; HET: NAD SUC; 3.00A {Bacillus anthracis} | Back alignment and structure |
|---|
| >1sny_A Sniffer CG10964-PA; alpha and beta protein, rossmann fold, dinucleotide binding oxidoreductase; HET: NAP; 1.75A {Drosophila melanogaster} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >4e6p_A Probable sorbitol dehydrogenase (L-iditol 2-dehyd; NAD(P)-binding, structural genomics, PSI-biology; HET: MSE; 2.10A {Sinorhizobium meliloti} PDB: 1k2w_A | Back alignment and structure |
|---|
| >3uve_A Carveol dehydrogenase ((+)-trans-carveol dehydrog; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; HET: NAD PG4; 1.55A {Mycobacterium avium} SCOP: c.2.1.0 PDB: 3uwr_A* | Back alignment and structure |
|---|
| >3ak4_A NADH-dependent quinuclidinone reductase; SDR, (R)-3-quinuclidinol, chiral alcohol, oxidoreductase; HET: NAD; 2.00A {Agrobacterium tumefaciens} | Back alignment and structure |
|---|
| >3op4_A 3-oxoacyl-[acyl-carrier protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase; HET: MSE NAP; 1.60A {Vibrio cholerae o1 biovar el tor} SCOP: c.2.1.2 PDB: 3rsh_A* 3rro_A* 4i08_A* 3tzk_A 3tzc_A* 3u09_A 3tzh_A 1q7b_A* 1i01_A* 1q7c_A* 2cf2_E | Back alignment and structure |
|---|
| >3un1_A Probable oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.45A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >3l6e_A Oxidoreductase, short-chain dehydrogenase/reducta; structural genomics, PSI-2, protein structure initiative; 2.30A {Aeromonas hydrophila subsp} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >3f1l_A Uncharacterized oxidoreductase YCIK; E. coli, NADP+,; 0.95A {Escherichia coli K12} SCOP: c.2.1.0 PDB: 3f1k_A 3e9q_A* 3f5q_A 3gz4_A* 3f5s_A 3gy0_A* 3iah_A* 3g1t_A | Back alignment and structure |
|---|
| >2cfc_A 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidoreductase; HET: NAD KPC; 1.8A {Xanthobacter autotrophicus} | Back alignment and structure |
|---|
| >3grp_A 3-oxoacyl-(acyl carrierprotein) reductase; structural genomics, oxidoreductase, S structural genomics center for infectious disease, ssgcid; 2.09A {Bartonella henselae} PDB: 3enn_A 3emk_A | Back alignment and structure |
|---|
| >2ew8_A (S)-1-phenylethanol dehydrogenase; transferase; 2.10A {Azoarcus SP} SCOP: c.2.1.2 PDB: 2ewm_A* | Back alignment and structure |
|---|
| >2gdz_A NAD+-dependent 15-hydroxyprostaglandin dehydrogen; dehydrogenase, structural genomics, SH dehydrogenase/reductase, inflammation; HET: NAD; 1.65A {Homo sapiens} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3ezl_A Acetoacetyl-COA reductase; ssgcid, acetyacetyl-COA reductase, oxidoreductase, structural genomics; HET: P4C; 2.25A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >1yo6_A Putative carbonyl reductase sniffer; tyrosine-dependent oxidoreductase (SDR family), structural genomics, PSI; 2.60A {Caenorhabditis elegans} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >4iiu_A 3-oxoacyl-[acyl-carrier protein] reductase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAP; 2.10A {Escherichia coli} PDB: 4iiv_A* | Back alignment and structure |
|---|
| >1e7w_A Pteridine reductase; dihydrofolate reductase, shortchain dehydrogenase, methotrexate resistance, oxidoreductase; HET: NDP MTX; 1.75A {Leishmania major} SCOP: c.2.1.2 PDB: 1w0c_A* 1e92_A* 2bf7_A* 2bfa_A* 2bfm_A* 2bfo_A* 2bfp_A* 2p8k_A* 3h4v_A* 2xox_A 1p33_A* | Back alignment and structure |
|---|
| >2z1m_A GDP-D-mannose dehydratase; short-chain dehydrogenase/reductase, lyase, structural genom NPPSFA; HET: NDP GDP; 2.00A {Aquifex aeolicus} PDB: 2z95_A* | Back alignment and structure |
|---|
| >2bgk_A Rhizome secoisolariciresinol dehydrogenase; oxidoreductase; 1.6A {Podophyllum peltatum} SCOP: c.2.1.2 PDB: 2bgl_A* 2bgm_A* | Back alignment and structure |
|---|
| >3t7c_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.95A {Mycobacterium avium} | Back alignment and structure |
|---|
| >4dry_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.50A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >1yxm_A Pecra, peroxisomal trans 2-enoyl COA reductase; perioxisomes, fatty acid synthesis, short-chain dehydrogenases/reductases, structural genomics; HET: ADE; 1.90A {Homo sapiens} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3tsc_A Putative oxidoreductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, nucleotide; HET: NAD; 2.05A {Mycobacterium avium subsp} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >2ehd_A Oxidoreductase, oxidoreductase, short-chain dehydrogenase/reducta; rossman fold, structural genomics, NPPSFA; 2.40A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3gk3_A Acetoacetyl-COA reductase; acetoacetyl-CO reductase, oxidoreductase, structural genomics; 2.10A {Burkholderia pseudomallei 1710B} | Back alignment and structure |
|---|
| >1uls_A Putative 3-oxoacyl-acyl carrier protein reductase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.40A {Thermus thermophilus} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >1zk4_A R-specific alcohol dehydrogenase; short chain reductases/dehydrogenases, magnesium dependence, oxidoreductase; HET: NAP; 1.00A {Lactobacillus brevis} SCOP: c.2.1.2 PDB: 1nxq_A* 1zjy_A* 1zjz_A* 1zk0_A* 1zk1_A* 1zk2_A 1zk3_A | Back alignment and structure |
|---|
| >3rwb_A TPLDH, pyridoxal 4-dehydrogenase; short chain dehydrogenase/reductase, 4-pyridoxola NAD+, oxidoreductase; HET: NAD 4PL; 1.70A {Mesorhizobium loti} PDB: 3ndr_A* 3nug_A* | Back alignment and structure |
|---|
| >1gee_A Glucose 1-dehydrogenase; short-chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 1.60A {Bacillus megaterium} SCOP: c.2.1.2 PDB: 1rwb_A* 1gco_A* 1g6k_A* 3aus_A 3aut_A* 3auu_A* | Back alignment and structure |
|---|
| >3gvc_A Oxidoreductase, probable short-chain type dehydrogenase/reductase; ssgcid, decode, niaid, UWPPG, SBRI, structural genomics; 2.45A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >2qhx_A Pteridine reductase 1; oxidoreductase, short-chain dehydrogenase/reductase, trypanosomatid, pterin salvage, drug resistance; HET: NAP FE1; 2.61A {Leishmania major} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >1x1t_A D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, SDR, short chain dehydrogenase, ketone BODY, beta hydroxybutyrate, oxidoreductase; HET: NAD; 1.52A {Pseudomonas fragi} SCOP: c.2.1.2 PDB: 1wmb_A* 2ztl_A* 2ztv_A* 2ztm_A* 2ztu_A* 2yz7_A 2zea_A* 3eew_A* 3vdq_A* 3vdr_A* | Back alignment and structure |
|---|
| >3o38_A Short chain dehydrogenase; tuberculosis, ortholog from A non-pathogenic dehydrogenase, structural genomics; 1.95A {Mycobacterium smegmatis} | Back alignment and structure |
|---|
| >3sxp_A ADP-L-glycero-D-mannoheptose-6-epimerase; rossman fold, NAD binding, isomerase; HET: NAD; 2.55A {Helicobacter pylori} | Back alignment and structure |
|---|
| >4eso_A Putative oxidoreductase; NADP, structural genomics, PSI-biology, NEW structural genomics research consortium, nysgrc; HET: MSE NAP; 1.91A {Sinorhizobium meliloti} PDB: 3vc7_A | Back alignment and structure |
|---|
| >4fc7_A Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossmann fold, peroxisomal beta-oxidation, oxidoreductas; HET: NAP COA; 1.84A {Homo sapiens} PDB: 4fc6_A* | Back alignment and structure |
|---|
| >3qlj_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis; 1.80A {Mycobacterium avium} | Back alignment and structure |
|---|
| >2d1y_A Hypothetical protein TT0321; strucrtural genomics, thermus thermophilus HB8, structural genomics, NPPSFA; HET: NAD; 1.65A {Thermus thermophilus} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >1mxh_A Pteridine reductase 2; SDR topology, protein-substrate complex, oxidoreductase; HET: NAP DHF; 2.20A {Trypanosoma cruzi} SCOP: c.2.1.2 PDB: 1mxf_A* | Back alignment and structure |
|---|
| >1xu9_A Corticosteroid 11-beta-dehydrogenase, isozyme 1; hydroxysteroid, SDR, oxidoreductase; HET: NDP CPS MES; 1.55A {Homo sapiens} SCOP: c.2.1.2 PDB: 1xu7_A* 3bzu_A* 3czr_A* 3d3e_A* 3d4n_A* 3fco_A* 3frj_A* 3h6k_A* 3hfg_A* 3oq1_A* 3qqp_A* 3pdj_A* 3d5q_A* 2rbe_A* 3byz_A* 3ey4_A* 3tfq_A* 3ch6_A* 2irw_A* 2ilt_A* ... | Back alignment and structure |
|---|
| >2a4k_A 3-oxoacyl-[acyl carrier protein] reductase; reductase,hyperthermophIle, structural genomics, PSI, protei structure initiative; 2.30A {Thermus thermophilus} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3icc_A Putative 3-oxoacyl-(acyl carrier protein) reducta; structural genomics, putative 3-oxoacyl-(acyl carrier protei reductase, oxidoreductase; HET: NAP MES; 1.87A {Bacillus anthracis str} | Back alignment and structure |
|---|
| >3k31_A Enoyl-(acyl-carrier-protein) reductase; ssgcid, NIH, niaid, SBRI, UW, decode, eonyl-(acyl-carrier-PR reductase, NAD, oxidoreductase; HET: NAD; 1.80A {Anaplasma phagocytophilum} PDB: 3k2e_A* | Back alignment and structure |
|---|
| >3i1j_A Oxidoreductase, short chain dehydrogenase/reducta; dimer, MIXE beta, structural genomics, PSI-2; 1.90A {Pseudomonas syringae PV} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >3dqp_A Oxidoreductase YLBE; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 1.40A {Lactococcus lactis subsp} | Back alignment and structure |
|---|
| >2bd0_A Sepiapterin reductase; oxidoreductase; HET: NAP BIO; 1.70A {Chlorobium tepidum} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3oig_A Enoyl-[acyl-carrier-protein] reductase [NADH]; fatty acid synthesis, rossmann-like fold, enoyl-ACP reductas binding; HET: NAD IMJ; 1.25A {Bacillus subtilis} SCOP: c.2.1.2 PDB: 3oif_A* 2qio_A* 3oje_A 3ojf_A* | Back alignment and structure |
|---|
| >1hdc_A 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxidoreductase; HET: CBO; 2.20A {Streptomyces exfoliatus} SCOP: c.2.1.2 PDB: 2hsd_A* | Back alignment and structure |
|---|
| >1rpn_A GDP-mannose 4,6-dehydratase; short-chain dehydrogenase/reductase, rossmann fold, lyase; HET: NDP GDP; 2.15A {Pseudomonas aeruginosa} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >4h15_A Short chain alcohol dehydrogenase-related dehydro; structural genomics, PSI-biology, nysgrc; HET: MSE; 1.45A {Sinorhizobium meliloti} PDB: 4h16_A* | Back alignment and structure |
|---|
| >3d3w_A L-xylulose reductase; uronate cycle, short-chain dehydrogenase/reductase(SDR) superfamily, glucose metabolism, acetylation, carbohydrate metabolism; HET: NAP; 1.87A {Homo sapiens} PDB: 1wnt_A* 1pr9_A* | Back alignment and structure |
|---|
| >1cyd_A Carbonyl reductase; short-chain dehydrogenase, oxidoreductase; HET: NAP; 1.80A {Mus musculus} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3qvo_A NMRA family protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MNB; 2.30A {Shigella flexneri 2A} | Back alignment and structure |
|---|
| >3ew7_A LMO0794 protein; Q8Y8U8_lismo, putative NAD-dependent epimerase/dehydratase, LMR162, NESG, structural genomics, PSI-2; 2.73A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >3tl3_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 1.85A {Mycobacterium ulcerans} | Back alignment and structure |
|---|
| >1rkx_A CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 1.80A {Yersinia pseudotuberculosis} SCOP: c.2.1.2 PDB: 1wvg_A* | Back alignment and structure |
|---|
| >1oaa_A Sepiapterin reductase; tetrahydrobiopterin, oxidoreductase; HET: NAP; 1.25A {Mus musculus} SCOP: c.2.1.2 PDB: 1nas_A* 1sep_A* 1z6z_A* | Back alignment and structure |
|---|
| >3oec_A Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; ssgcid, structural genomics; 1.95A {Mycobacterium thermoresistibile} | Back alignment and structure |
|---|
| >1hxh_A 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-beta, rossmann fold, short-chain dehydrogenase, oxidoreductase; 1.22A {Comamonas testosteroni} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >4b79_A PA4098, probable short-chain dehydrogenase; oxidoreductase, infectious disease, structure-based inhibito; HET: NAD; 1.98A {Pseudomonas aeruginosa PAO1} | Back alignment and structure |
|---|
| >3r6d_A NAD-dependent epimerase/dehydratase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, veillo parvula; HET: MLZ; 1.25A {Veillonella parvula dsm 2008} PDB: 4hng_A 4hnh_A* 3r14_A* | Back alignment and structure |
|---|
| >2ag5_A DHRS6, dehydrogenase/reductase (SDR family) member 6; protein-CO-factor complex, structural genomics, structural G consortium, SGC, oxidoreductase; HET: NAD; 1.84A {Homo sapiens} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >2pzm_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, protein-nucleotide comple binding protein; HET: NAD UDP; 2.00A {Bordetella bronchiseptica} PDB: 2pzl_A* 2pzk_A* | Back alignment and structure |
|---|
| >2pd4_A Enoyl-[acyl-carrier-protein] reductase [NADH]; antibacterial target, type II fatty acid biosynthesis, enoyl-ACP-reductase, FABI; HET: NAD DCN; 2.30A {Helicobacter pylori} SCOP: c.2.1.2 PDB: 2pd3_A* | Back alignment and structure |
|---|
| >3slg_A PBGP3 protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid, melioidosis, glanders; 2.10A {Burkholderia pseudomallei} | Back alignment and structure |
|---|
| >4e3z_A Putative oxidoreductase protein; PSI-biology, structural genomics, protein structure initiati nysgrc,oxidoreductase; 2.00A {Rhizobium etli} | Back alignment and structure |
|---|
| >1nff_A Putative oxidoreductase RV2002; directed evolution, GFP, SDR, hydroxysteroid dehydrogenase, structural genomics, PSI; HET: NAD; 1.80A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1nfq_A* 1nfr_A* | Back alignment and structure |
|---|
| >4dyv_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.80A {Xanthobacter autotrophicus} | Back alignment and structure |
|---|
| >1xg5_A ARPG836; short chain dehydrogenase, human, SGC, structural genomics, structural genomics consortium, oxidoreductase; HET: NAP; 1.53A {Homo sapiens} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >2p4h_X Vestitone reductase; NADPH-dependent reductase, isoflavonoid, plant protein; 1.40A {Medicago sativa} | Back alignment and structure |
|---|
| >3rft_A Uronate dehydrogenase; apoenzyme, rossmann fold, NAD binding, oxidoreductase; 1.90A {Agrobacterium tumefaciens} PDB: 3rfv_A* 3rfx_A* | Back alignment and structure |
|---|
| >1orr_A CDP-tyvelose-2-epimerase; rossmann fold, short-chain dehydrogenase/reductase, isomeras; HET: NAD CDP; 1.50A {Salmonella typhi} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3dhn_A NAD-dependent epimerase/dehydratase; reductase, PF01370, Q89Z24_bactn, NESG, BTR310, structural genomics, PSI-2; 2.00A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >3guy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structur initiative; 1.90A {Vibrio parahaemolyticus} | Back alignment and structure |
|---|
| >1qsg_A Enoyl-[acyl-carrier-protein] reductase; enoyl reductase, oxidoreductase; HET: GLC NAD TCL; 1.75A {Escherichia coli} SCOP: c.2.1.2 PDB: 1c14_A* 1i2z_A* 1i30_A* 1lx6_A* 1lxc_A* 1mfp_A* 2fhs_A 1qg6_A* 1dfg_A* 1dfh_A* 1d8a_A* 1dfi_A* 3pje_A* 3pjd_A* 3pjf_A* | Back alignment and structure |
|---|
| >2q1w_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, sugar binding protein; HET: NAD; 2.19A {Bordetella bronchiseptica} | Back alignment and structure |
|---|
| >3ek2_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, oxidoreductase, structural genomics; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >2nwq_A Probable short-chain dehydrogenase; oxidoreductase; 2.30A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >2hun_A 336AA long hypothetical DTDP-glucose 4,6-dehydrat; rossmann fold, structural genomics, NPPSFA; HET: NAD; 2.07A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >2fwm_X 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; enterobactin, rossman fold, chorismate metabolism, short-CHA oxidoreductase, tetramer; 2.00A {Escherichia coli} | Back alignment and structure |
|---|
| >1t2a_A GDP-mannose 4,6 dehydratase; structural genomics consortium, rossman-fold, short-chain dehydrogenase/reductase, SDR, structural genomics,lyase; HET: NDP GDP; 1.84A {Homo sapiens} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >2dtx_A Glucose 1-dehydrogenase related protein; rossmann fold, oxidoreductase; HET: BMA; 1.60A {Thermoplasma acidophilum} PDB: 2dtd_A* 2dte_A* 2zk7_A | Back alignment and structure |
|---|
| >1ek6_A UDP-galactose 4-epimerase; short-chain dehydrogenase, galactosemia, isomerase; HET: NAI UPG; 1.50A {Homo sapiens} SCOP: c.2.1.2 PDB: 1ek5_A* 1hzj_A* 1i3k_A* 1i3l_A* 1i3m_A* 1i3n_A* | Back alignment and structure |
|---|
| >3h2s_A Putative NADH-flavin reductase; Q03B84, NESG, LCR19, structural genomics, PSI-2, protein structure initiative; HET: NDP; 1.78A {Lactobacillus casei atcc 334} | Back alignment and structure |
|---|
| >3f9i_A 3-oxoacyl-[acyl-carrier-protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase, FAT biosynthesis, lipid synthesis, NADP; 2.25A {Rickettsia prowazekii} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >3p19_A BFPVVD8, putative blue fluorescent protein; rossmann-fold, oxidoreductase; HET: NAP; 2.05A {Vibrio vulnificus} | Back alignment and structure |
|---|
| >1yde_A Retinal dehydrogenase/reductase 3; oxidoreductase, structural genomics, structural genomics CON SGC; 2.40A {Homo sapiens} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3nrc_A Enoyl-[acyl-carrier-protein] reductase (NADH); rossmann fold, NADH BI oxidoreductase; HET: NAD TCL; 2.10A {Francisella tularensis subsp} PDB: 3uic_A* 2jjy_A* | Back alignment and structure |
|---|
| >2nm0_A Probable 3-oxacyl-(acyl-carrier-protein) reductas; oxidoreductase; 1.99A {Streptomyces coelicolor} | Back alignment and structure |
|---|
| >1oc2_A DTDP-glucose 4,6-dehydratase; lyase, NADH, rhamnose; HET: TDX NAD; 1.5A {Streptococcus suis} SCOP: c.2.1.2 PDB: 1ker_A* 1ket_A* 1kep_A* | Back alignment and structure |
|---|
| >4b4o_A Epimerase family protein SDR39U1; isomerase; HET: NDP PE4; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >2b69_A UDP-glucuronate decarboxylase 1; UDP-glucoronic acid decarboxylase, structural genomics, STRU genomics consortium, SGC, lyase; HET: MSE NAD UDP; 1.21A {Homo sapiens} SCOP: c.2.1.2 PDB: 4ef7_A* | Back alignment and structure |
|---|
| >3gdg_A Probable NADP-dependent mannitol dehydrogenase; rossmann fold, beta-alpha-beta motifs, open twisted sheet, A NADP, oxidoreductase; 2.30A {Cladosporium herbarum} SCOP: c.2.1.0 PDB: 3gdf_A | Back alignment and structure |
|---|
| >1xgk_A Nitrogen metabolite repression regulator NMRA; rossmann fold, transcriptional regulation, short chain dehyd reductase, NADP binding; 1.40A {Emericella nidulans} SCOP: c.2.1.2 PDB: 1k6x_A* 1k6j_A 1k6i_A* 1ti7_A* 2vus_A 2vut_A* 2vuu_A* | Back alignment and structure |
|---|
| >2c5a_A GDP-mannose-3', 5'-epimerase; short chain dehydratase/reductase, GDP-gulose, GDP-galactose, keto intermediate, vitamin C, SDR; HET: GDC NAD BTB; 1.4A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2c59_A* 2c54_A* 2c5e_A* | Back alignment and structure |
|---|
| >2p91_A Enoyl-[acyl-carrier-protein] reductase [NADH]; NADH-dependent enoyl-ACP reductase, FABI, aquifex A VF5, structural genomics, PSI; 2.00A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >1sb8_A WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCNAC, SDR, G SYK, UDP, N-acetylglucosamine, N- acetylgalactosamine, UDP-GLC, isomerase; HET: NAD UD2; 2.10A {Pseudomonas aeruginosa} SCOP: c.2.1.2 PDB: 1sb9_A* | Back alignment and structure |
|---|
| >2wyu_A Enoyl-[acyl carrier protein] reductase; oxidoreductase, fatty acid biosynthesis, oxidation reduction; 1.50A {Thermus thermophilus} PDB: 1ulu_A 2wyv_A* 2wyw_A* 2yw9_A* | Back alignment and structure |
|---|
| >3e9n_A Putative short-chain dehydrogenase/reductase; structural genomics, unknown function, oxidoreductase, PSI- 2; 2.40A {Corynebacterium glutamicum} | Back alignment and structure |
|---|
| >3grk_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, niaid, structural genomics, seattle structural genomics center for infectious disease; 2.35A {Brucella melitensis} PDB: 4eit_A* | Back alignment and structure |
|---|
| >1edo_A Beta-keto acyl carrier protein reductase; nucleotide fold, rossmann fold, oxidoreductase; HET: NAP; 2.30A {Brassica napus} SCOP: c.2.1.2 PDB: 2cdh_G | Back alignment and structure |
|---|
| >1hdo_A Biliverdin IX beta reductase; foetal metabolism, HAEM degradation, flavin reductase, diaphorase, green HAEM binding protein; HET: NAP; 1.15A {Homo sapiens} SCOP: c.2.1.2 PDB: 1he2_A* 1he3_A* 1he4_A* 1he5_A* | Back alignment and structure |
|---|
| >3m2p_A UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J, isomerase, structural genomics, PSI-2, protein structure initiative; HET: UDP; 2.95A {Bacillus cereus} | Back alignment and structure |
|---|
| >2hrz_A AGR_C_4963P, nucleoside-diphosphate-sugar epimerase; agrobacterium tumefa structural genomics, PSI-2, protein structure initiative; 1.85A {Agrobacterium tumefaciens} | Back alignment and structure |
|---|
| >4id9_A Short-chain dehydrogenase/reductase; putative dehydrogenase, enzyme function initiative, EFI, STR genomics, oxidoreductase; HET: NAD; 1.60A {Agrobacterium fabrum} PDB: 4idg_A* | Back alignment and structure |
|---|
| >4dqv_A Probable peptide synthetase NRP (peptide synthase; GXXGXXG motif, rossmann fold, short chain dehydrogenase/REDU family, reductase; 2.30A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >2bka_A CC3, TAT-interacting protein TIP30; NADPH, PEG600, transcription; HET: NDP PE8; 1.7A {Homo sapiens} SCOP: c.2.1.2 PDB: 2fmu_A | Back alignment and structure |
|---|
| >2ph3_A 3-oxoacyl-[acyl carrier protein] reductase; TTHA0415, structural genomics, southea collaboratory for structural genomics, secsg; 1.91A {Thermus thermophilus HB8} | Back alignment and structure |
|---|
| >1n7h_A GDP-D-mannose-4,6-dehydratase; rossmann fold, SDR, short-chain dehydrogenase/reductase, LYA; HET: NDP GDP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1n7g_A* | Back alignment and structure |
|---|
| >1db3_A GDP-mannose 4,6-dehydratase; NADP, GDP-fucose, lyase; 2.30A {Escherichia coli} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >2a35_A Hypothetical protein PA4017; alpha-beta-alpha sandwich, structura genomics, PSI, protein structure initiative; 1.50A {Pseudomonas aeruginosa} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >2q1s_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NADH complex, sugar binding protein; HET: NAI; 1.50A {Bordetella bronchiseptica} PDB: 2pzj_A* 2q1t_A* 2q1u_A* | Back alignment and structure |
|---|
| >2x4g_A Nucleoside-diphosphate-sugar epimerase; isomerase; 2.65A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >1kew_A RMLB;, DTDP-D-glucose 4,6-dehydratase; rossmann fold, lyase; HET: TYD NAD; 1.80A {Salmonella enterica subsp} SCOP: c.2.1.2 PDB: 1g1a_A* 1keu_A* 1bxk_A* | Back alignment and structure |
|---|
| >3rku_A Oxidoreductase YMR226C; substrate fingerprint, short chain oxidoreductase, rossmann oxidoreductase; HET: NAP; 2.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1r6d_A TDP-glucose-4,6-dehydratase; rossmann fold, short-chain dehydrogenase/reductase, lyase; HET: NAD DAU; 1.35A {Streptomyces venezuelae} SCOP: c.2.1.2 PDB: 1r66_A* | Back alignment and structure |
|---|
| >3vtz_A Glucose 1-dehydrogenase; rossmann fold, oxidoreductase, NAD binding; 2.30A {Thermoplasma volcanium} | Back alignment and structure |
|---|
| >3i6i_A Putative leucoanthocyanidin reductase 1; rossmann fold, short chain dehydrogenase reductase, flavonoi oxidoreductase; HET: NDP; 1.75A {Vitis vinifera} PDB: 3i5m_A 3i52_A* 3i6q_A* | Back alignment and structure |
|---|
| >3ko8_A NAD-dependent epimerase/dehydratase; isomerase, UDP-galactose 4-epimerase; HET: NAD; 1.80A {Pyrobaculum calidifontis} SCOP: c.2.1.0 PDB: 3icp_A* 3aw9_A* | Back alignment and structure |
|---|
| >3asu_A Short-chain dehydrogenase/reductase SDR; SDR family, rossmann-fold, short-chain dehydrogenase/reducta ALLO-threonine dehydrogenase; 1.90A {Escherichia coli} PDB: 3asv_A* | Back alignment and structure |
|---|
| >2r6j_A Eugenol synthase 1; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, plant protein; HET: NDP; 1.50A {Ocimum basilicum} PDB: 2qys_A 2qx7_A* 2qzz_A* 2r2g_A* 3c3x_A* 2qw8_A* | Back alignment and structure |
|---|
| >1y1p_A ARII, aldehyde reductase II; rossmann fold, short chain dehydrogenase reductase, oxidoreductase; HET: NMN AMP; 1.60A {Sporidiobolus salmonicolor} SCOP: c.2.1.2 PDB: 1ujm_A* 1zze_A | Back alignment and structure |
|---|
| >2gn4_A FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann fold, TYK triad, SDR, enzyme, NADP, NADPH, lyase; HET: NDP UD1 MES; 1.90A {Helicobacter pylori} PDB: 2gn6_A* 2gn8_A* 2gn9_A* 2gna_A* | Back alignment and structure |
|---|
| >1xq6_A Unknown protein; structural genomics, protein structure initiative, CESG, AT5G02240, NADP, center for eukaryotic structural genomics; HET: NAP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1ybm_A* 2q46_A* 2q4b_A* | Back alignment and structure |
|---|
| >4f6c_A AUSA reductase domain protein; thioester reductase, oxidoreductase; 2.81A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >1z45_A GAL10 bifunctional protein; epimerase, mutarotase, metabolism, isomerase; HET: GAL NAD GUD; 1.85A {Saccharomyces cerevisiae} SCOP: b.30.5.4 c.2.1.2 | Back alignment and structure |
|---|
| >2h7i_A Enoyl-[acyl-carrier-protein] reductase [NADH]; oxidoreductase, INHA, enoyl acyl carrier reductase, pyrrolid carboxamide; HET: NAD 566; 1.62A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1p44_A* 1p45_A* 2b35_A* 2b36_A* 2b37_A* 2aq8_A* 2h7l_A* 2h7m_A* 2h7n_A* 2h7p_A* 2nsd_A* 2pr2_A* 2x22_A* 2x23_A* 3fne_A* 3fnf_A* 3fng_A* 3fnh_A* 3oew_A* 2aqh_A* ... | Back alignment and structure |
|---|
| >1udb_A Epimerase, UDP-galactose-4-epimerase; isomerase; HET: NAD UFG; 1.65A {Escherichia coli} SCOP: c.2.1.2 PDB: 1lrj_A* 1nai_A* 1uda_A* 1nah_A* 1xel_A* 1kvq_A* 1kvs_A* 1udc_A* 2udp_A* 1a9z_A* 1kvt_A* 1kvr_A* 1lrk_A* 1lrl_A* 1kvu_A* 1a9y_A* | Back alignment and structure |
|---|
| >2wm3_A NMRA-like family domain containing protein 1; unknown function; HET: NAP NFL; 1.85A {Homo sapiens} PDB: 2wmd_A* 2exx_A* 3dxf_A 3e5m_A | Back alignment and structure |
|---|
| >3mje_A AMPHB; rossmann fold, oxidoreductase; HET: NDP; 1.36A {Streptomyces nodosus} PDB: 3mjc_A* 3mjs_A* 3mjv_A* 3mjt_A* | Back alignment and structure |
|---|
| >3ius_A Uncharacterized conserved protein; APC63810, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.66A {Ruegeria pomeroyi dss-3} | Back alignment and structure |
|---|
| >2bll_A Protein YFBG; decarboxylase, short chain dehydrogenase, L-ARA4N biosynthes methyltransferase, transferase; 2.3A {Escherichia coli} SCOP: c.2.1.2 PDB: 1u9j_A 1z73_A 1z75_A 1z7b_A 1z74_A | Back alignment and structure |
|---|
| >2pk3_A GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, short-chain dehydrogenase/reductase, rossmann fold, oxidoreductase; HET: A2R GDD; 1.82A {Aneurinibacillus thermoaerophilus} | Back alignment and structure |
|---|
| >1jtv_A 17 beta-hydroxysteroid dehydrogenase type 1; steroid hormones, alternative binding mode, oxidoreductase; HET: TES; 1.54A {Homo sapiens} SCOP: c.2.1.2 PDB: 1dht_A* 1equ_A* 1bhs_A* 1i5r_A* 1qyv_A* 1qyw_A* 1qyx_A* 3dey_X* 3dhe_A* 3hb4_X* 3hb5_X* 3klp_X* 3km0_A* 1iol_A* 1fds_A* 1fdt_A* 3klm_X* 1fdw_A* 1fdu_A* 1fdv_A* ... | Back alignment and structure |
|---|
| >1gy8_A UDP-galactose 4-epimerase; oxidoreductase; HET: NAD UDP; 2.0A {Trypanosoma brucei} SCOP: c.2.1.2 PDB: 2cnb_A* | Back alignment and structure |
|---|
| >2c20_A UDP-glucose 4-epimerase; carbohydrate metabolism, galactose metabolism, isomerase, NAD, spine; HET: NAD; 2.7A {Bacillus anthracis} | Back alignment and structure |
|---|
| >1o5i_A 3-oxoacyl-(acyl carrier protein) reductase; TM1169, structur genomics, JCSG, PSI, protein structure initiative, joint CE structural genomics; HET: NAD; 2.50A {Thermotoga maritima} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >1uay_A Type II 3-hydroxyacyl-COA dehydrogenase; beta oxidation, fatty acid, structural genomi structural genomics/proteomics initiative, RSGI; HET: ADN; 1.40A {Thermus thermophilus} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >2ekp_A 2-deoxy-D-gluconate 3-dehydrogenase; structural genomics, NPPSFA, nation project on protein structural and functional analyses; HET: NAD; 1.15A {Thermus thermophilus} PDB: 1x1e_A* 2ekq_A | Back alignment and structure |
|---|
| >1ooe_A Dihydropteridine reductase; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics; HET: MES; 1.65A {Caenorhabditis elegans} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3orf_A Dihydropteridine reductase; alpha-beta-alpha sandwich, rossmann fold, oxidoreductase (AC NADH), NADH binding, oxidoreductase; HET: NAD; 2.16A {Dictyostelium discoideum} | Back alignment and structure |
|---|
| >2z5l_A Tylkr1, tylactone synthase starter module and modules 1 & 2; short-chain dehydrogenase/reductase, rossman fold; 1.95A {Streptomyces fradiae} | Back alignment and structure |
|---|
| >1uzm_A 3-oxoacyl-[acyl-carrier protein] reductase; beta-ketoacyl reductase, oxidoreductase; 1.49A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1uzn_A* 2ntn_A 1uzl_A | Back alignment and structure |
|---|
| >1qyc_A Phenylcoumaran benzylic ether reductase PT1; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.20A {Pinus taeda} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >1dhr_A Dihydropteridine reductase; oxidoreductase(acting on NADH or NADPH); HET: NAD; 2.30A {Rattus norvegicus} SCOP: c.2.1.2 PDB: 1dir_A* 1hdr_A* | Back alignment and structure |
|---|
| >2v6g_A Progesterone 5-beta-reductase; tyrosine-dependent oxidoreductase, oxidoreductase, SDR, cardenolides, cardiac glycosides; HET: NAP; 2.3A {Digitalis lanata} PDB: 2v6f_A* | Back alignment and structure |
|---|
| >3uxy_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: NAD; 2.10A {Rhodobacter sphaeroides} | Back alignment and structure |
|---|
| >3e48_A Putative nucleoside-diphosphate-sugar epimerase; alpha-beta protein., structural genomics, PSI-2, protein STR initiative; 1.60A {Staphylococcus aureus subsp} | Back alignment and structure |
|---|
| >3kzv_A Uncharacterized oxidoreductase YIR035C; cytoplasmic protein, unknown function, structural genomics, MCSG, protein structure initiative; 2.00A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3gpi_A NAD-dependent epimerase/dehydratase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.44A {Methylobacillus flagellatus KT} | Back alignment and structure |
|---|
| >4e4y_A Short chain dehydrogenase family protein; structural genomics, the center for structural genomics of I diseases, csgid, niaid; 1.80A {Francisella tularensis subsp} | Back alignment and structure |
|---|
| >2gas_A Isoflavone reductase; NADPH-dependent reductase, oxidoreductase; 1.60A {Medicago sativa} | Back alignment and structure |
|---|
| >1qyd_A Pinoresinol-lariciresinol reductase; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.50A {Thuja plicata} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3c1o_A Eugenol synthase; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, oxidoreductase; HET: NAP; 1.80A {Clarkia breweri} | Back alignment and structure |
|---|
| >3uce_A Dehydrogenase; rossmann fold, oxidoreductase; HET: NDP; 1.80A {Vibrio vulnificus} | Back alignment and structure |
|---|
| >2fr1_A Erythromycin synthase, eryai; short chain dehydrogenase/reductase, oxidoreductase; HET: NDP; 1.79A {Saccharopolyspora erythraea} SCOP: c.2.1.2 c.2.1.2 PDB: 2fr0_A* | Back alignment and structure |
|---|
| >1i24_A Sulfolipid biosynthesis protein SQD1; SDR, short-chain dehydrogenase/reductase, rossmann fold, BIO protein; HET: NAD UPG; 1.20A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1i2c_A* 1i2b_A* 1qrr_A* | Back alignment and structure |
|---|
| >2yy7_A L-threonine dehydrogenase; thermolabIle, flavobacterium FRIG KUC-1, oxidoreductase; HET: PE8 NAD MES; 2.06A {Flavobacterium frigidimaris} | Back alignment and structure |
|---|
| >3s8m_A Enoyl-ACP reductase; rossmann fold, oxidoreductase, NADH binding, fatty acid SYNT enoyl-ACP; 1.60A {Xanthomonas oryzae PV} | Back alignment and structure |
|---|
| >2p5y_A UDP-glucose 4-epimerase; TTHA0591, structural genomics, PSI; HET: NAD; 1.92A {Thermus thermophilus HB8} PDB: 2p5u_A* | Back alignment and structure |
|---|
| >3vps_A TUNA, NAD-dependent epimerase/dehydratase; tunicamycins, biosynthesis, EXO-glycal, rossman transferase; HET: UD1 NAD; 1.90A {Streptomyces chartreusis} | Back alignment and structure |
|---|
| >1z7e_A Protein aRNA; rossmann fold, OB-like fold, hydrolase; HET: ATP UGA; 3.00A {Escherichia coli} SCOP: b.46.1.1 c.2.1.2 c.65.1.1 | Back alignment and structure |
|---|
| >2dkn_A 3-alpha-hydroxysteroid dehydrogenase; oxidoreductase, rossmann fold; HET: NAI; 1.80A {Pseudomonas SP} | Back alignment and structure |
|---|
| >2jl1_A Triphenylmethane reductase; oxidoreductase, bioremediation; HET: NAP GOL; 1.96A {Citrobacter SP} PDB: 2vrb_A* 2vrc_A 2vrc_D | Back alignment and structure |
|---|
| >3ay3_A NAD-dependent epimerase/dehydratase; glucuronic acid dehydrogeanse, oxidoreductase; 2.10A {Chromohalobacter salexigens} | Back alignment and structure |
|---|
| >1fjh_A 3alpha-hydroxysteroid dehydrogenase/carbonyl reductase; short chain dehydrogenase, SDR, xenobiotic, metyrapone, oligomerisation; 1.68A {Comamonas testosteroni} SCOP: c.2.1.2 PDB: 1fk8_A* | Back alignment and structure |
|---|
| >2ydy_A Methionine adenosyltransferase 2 subunit beta; oxidoreductase; 2.25A {Homo sapiens} PDB: 2ydx_A | Back alignment and structure |
|---|
| >4f6l_B AUSA reductase domain protein; thioester reductase, oxidoreductase; 3.86A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >2et6_A (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-oxidation, peroxisome, SDR, oxido; 2.22A {Candida tropicalis} | Back alignment and structure |
|---|
| >3zu3_A Putative reductase YPO4104/Y4119/YP_4011; oxidoreductase, fatty acid biosynthesis II, short-chain dehydrogenase reductase superfamily; HET: NAI; 1.80A {Yersinia pestis} PDB: 3zu4_A* 3zu5_A* 3zu2_A* | Back alignment and structure |
|---|
| >3qp9_A Type I polyketide synthase pikaii; rossmann fold, ketoreductase, epimerization, oxidoreductase; 1.88A {Streptomyces venezuelae} | Back alignment and structure |
|---|
| >4eue_A Putative reductase CA_C0462; TER, biofuel, synthetic biology, catalytic mechan substrate specificity, oxidoreductase; HET: NAI; 2.00A {Clostridium acetobutylicum} PDB: 4euf_A* 4euh_A* | Back alignment and structure |
|---|
| >2zcu_A Uncharacterized oxidoreductase YTFG; alpha-beta sandwich; 1.80A {Escherichia coli} PDB: 2zcv_A* | Back alignment and structure |
|---|
| >3oh8_A Nucleoside-diphosphate sugar epimerase (SULA FAMI; DUF1731_C, northeast structural genomics consortium, NESG, C PSI-biology; 2.00A {Corynebacterium glutamicum} | Back alignment and structure |
|---|
| >3d7l_A LIN1944 protein; APC89317, structural genomics, PS protein structure initiative, midwest center for structural genomics, MCSG; 2.06A {Listeria innocua} | Back alignment and structure |
|---|
| >3slk_A Polyketide synthase extender module 2; rossmann fold, NADPH, oxidoreductase; HET: NDP; 3.00A {Saccharopolyspora spinosa} | Back alignment and structure |
|---|
| >3u0b_A Oxidoreductase, short chain dehydrogenase/reducta protein; structural genomics, ssgcid; 1.70A {Mycobacterium smegmatis} PDB: 3lls_A 3v1t_C 3v1u_A* 4fw8_A* 3q6i_A* 3m1l_A | Back alignment and structure |
|---|
| >2pff_A Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl-carrier-PR; fatty acid synthase, acyl-carrier-protein, beta-ketoacyl RED beta-ketoacyl synthase, dehydratase; 4.00A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1d7o_A Enoyl-[acyl-carrier protein] reductase (NADH) PRE; triclosan, enoyl reductase, oxidoreductase; HET: NAD TCL; 1.90A {Brassica napus} SCOP: c.2.1.2 PDB: 1eno_A* 1enp_A* 1cwu_A* | Back alignment and structure |
|---|
| >3zen_D Fatty acid synthase; transferase, mycolic acid biosynthesis, multifunctional ENZY substrate channeling; HET: FMN; 7.50A {Mycobacterium smegmatis} PDB: 4b3y_A* | Back alignment and structure |
|---|
| >2uv9_A Fatty acid synthase alpha subunits; fungal, dehydratase, enoyl reductase, ketoacyl synthase, ketoacyl reductase; 3.1A {Thermomyces lanuginosus} PDB: 2uvb_A* | Back alignment and structure |
|---|
| >2uv8_A Fatty acid synthase subunit alpha (FAS2); fatty acid biosynthesis, malonyl/palmitoyl transferase, phosphopantetheine, transferase; HET: GVL FMN; 3.10A {Saccharomyces cerevisiae} PDB: 2vkz_A* 3hmj_A* | Back alignment and structure |
|---|
| >1zmt_A Haloalcohol dehalogenase HHEC; halohydrin dehalogenase, epoxide catalysis, enantioselectivity, lyase; HET: RNO; 1.70A {Agrobacterium tumefaciens} SCOP: c.2.1.2 PDB: 1pwz_A 1px0_A* 1pwx_A* 1zo8_A* | Back alignment and structure |
|---|
| >1gz6_A Estradiol 17 beta-dehydrogenase 4; 17BETA-HSD4, MFE-2, beta-oxidation, peroxisome, SDR, steroid biosynthesis, oxidoreductase, NADP; HET: NAI; 2.38A {Rattus norvegicus} SCOP: c.2.1.2 PDB: 1zbq_A* | Back alignment and structure |
|---|
| >3ehe_A UDP-glucose 4-epimerase (GALE-1); PSI-II, NYSGXRC, ST genomics, protein structure initiative, NEW YORK SGX resear for structural genomics; HET: NAD; 1.87A {Archaeoglobus fulgidus} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >2et6_A (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-oxidation, peroxisome, SDR, oxido; 2.22A {Candida tropicalis} | Back alignment and structure |
|---|
| >2x6t_A ADP-L-glycero-D-manno-heptose-6-epimerase; isomerase, carbohydrate metabolism, stress response; HET: NAP ADP BMA; 2.36A {Escherichia coli} PDB: 2x86_A* | Back alignment and structure |
|---|
| >3oml_A GH14720P, peroxisomal multifunctional enzyme type 2, CG3415; rossmann fold, hot-DOG fold, hydratase 2 motif, peroxisomes, oxidoreductase; 2.15A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >3lt0_A Enoyl-ACP reductase; triclosan, triclosan variant, oxidoredu P.falciparum; HET: NAD FT1; 1.96A {Plasmodium falciparum} SCOP: c.2.1.2 PDB: 1v35_A* 3lsy_A* 1uh5_A* 3lt1_A* 3lt2_A* 3lt4_A* 3am4_A* 3am3_A* 3am5_A* 2o2y_A* 2oos_A* 2ol4_A* 2op0_A* 2op1_A* 1vrw_A* 1zsn_A* 1zw1_A* 1zxb_A* 1zxl_A* 2foi_A* ... | Back alignment and structure |
|---|
| >1vl0_A DTDP-4-dehydrorhamnose reductase, RFBD ortholog; structural joint center for structural genomics, JCSG, protein structu initiative; HET: NAI UNL; 2.05A {Clostridium acetobutylicum} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >2o2s_A Enoyl-acyl carrier reductase; enoyl reductase, triclosan, rossmann fold, oxidoreductase; HET: NAD TCL; 2.60A {Toxoplasma gondii} PDB: 2o50_A 3nj8_A* | Back alignment and structure |
|---|
| >2ptg_A Enoyl-acyl carrier reductase; apicomplexa, enoyl (acyl-carrier-P reductase, oxidoreductase; 2.60A {Eimeria tenella} | Back alignment and structure |
|---|
| >1lu9_A Methylene tetrahydromethanopterin dehydrogenase; alpha/beta twisted open sheet structure, oxidoreductase; 1.90A {Methylobacterium extorquens} SCOP: c.2.1.7 c.58.1.4 PDB: 1lua_A* | Back alignment and structure |
|---|
| >2yut_A Putative short-chain oxidoreductase; alpha and beta proteins (A/B), NAD(P)-binding rossmann-fold structural genomics, NPPSFA; HET: NAP; 2.20A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3sc6_A DTDP-4-dehydrorhamnose reductase; RFBD, structural genomics, infectious diseases, bacillus anthracis STR. AMES, rhamnose biosynthetic pathway; HET: NAP; 2.65A {Bacillus anthracis} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi} | Back alignment and structure |
|---|
| >1e6u_A GDP-fucose synthetase; epimerase/reductase, SDR, RED; HET: NAP; 1.45A {Escherichia coli} SCOP: c.2.1.2 PDB: 1e7q_A* 1bsv_A* 1fxs_A* 1gfs_A 1e7s_A* 1bws_A* 1e7r_A* | Back alignment and structure |
|---|
| >3ajr_A NDP-sugar epimerase; L-threonine dehydrogenase, L-3- hydroxynorvaline, oxidoreductase; HET: NAD; 1.77A {Thermoplasma volcanium} PDB: 3a9w_A* 3a4v_A* 3a1n_A* | Back alignment and structure |
|---|
| >2vz8_A Fatty acid synthase; transferase, phosphopantetheine, multienzyme, megasynthase, fatty acid synthesis; 3.2A {Sus scrofa} PDB: 2vz9_A* | Back alignment and structure |
|---|
| >1n2s_A DTDP-4-, DTDP-glucose oxidoreductase; rossman-fold, sugar-nucleotide-binding domain; HET: NAD; 2.00A {Salmonella enterica subsp} SCOP: c.2.1.2 PDB: 1kc1_A* 1kc3_A* 1kbz_A* | Back alignment and structure |
|---|
| >1zmo_A Halohydrin dehalogenase; haloalcohol dehalogenase, short- chain dehydrogenase/reductase family, lyase; 2.00A {Arthrobacter SP} | Back alignment and structure |
|---|
| >2ggs_A 273AA long hypothetical DTDP-4-dehydrorhamnose reductase; alpha, beta, oxidoreductase; HET: NDP; 1.70A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >1eq2_A ADP-L-glycero-D-mannoheptose 6-epimerase; N-terminal domain rossmann fold, C-terminal mixed alpha/beta domain; HET: NAP ADQ; 2.00A {Escherichia coli} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3st7_A Capsular polysaccharide synthesis enzyme CAP5F; rossmann fold, cupid domain, short-chain dehydrogenase/reduc NADPH; 2.45A {Staphylococcus aureus} PDB: 2zkl_A 3vhr_A | Back alignment and structure |
|---|
| >1u7z_A Coenzyme A biosynthesis bifunctional protein coabc; ligase; HET: PMT; 2.30A {Escherichia coli} SCOP: c.72.3.1 PDB: 1u7w_A* 1u7u_A* 1u80_A* | Back alignment and structure |
|---|
| >4ggo_A Trans-2-enoyl-COA reductase; rossmann fold, oxidoreductase; 2.00A {Treponema denticola atcc 35405} PDB: 4ggp_A | Back alignment and structure |
|---|
| >2gk4_A Conserved hypothetical protein; alpha-beta-alpha sandwich, flavoprotein, structural genomics protein structure initiative; 1.83A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >4b8w_A GDP-L-fucose synthase; oxidoreductase; HET: NAP GDP; 2.75A {Homo sapiens} | Back alignment and structure |
|---|
| >1y7t_A Malate dehydrogenase; NAD-dependent-MDH-NADPH complex, oxidoreductase; HET: NDP; 1.65A {Thermus thermophilus} SCOP: c.2.1.5 d.162.1.1 PDB: 1iz9_A* 2cvq_A* 1bmd_A* 1bdm_A* 1wze_A* 1wzi_A* | Back alignment and structure |
|---|
| >1ff9_A Saccharopine reductase; lysine biosynthesis, alpha-aminoadipate pathway, dehydrogenase, oxidoreductase; 2.00A {Magnaporthe grisea} SCOP: c.2.1.3 d.81.1.2 PDB: 1e5l_A* 1e5q_A | Back alignment and structure |
|---|
| >2hmt_A YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane protein, ION transporter, symporter, transport protein; HET: NAI; 2.20A {Bacillus subtilis} SCOP: c.2.1.9 PDB: 2hms_A* 2hmu_A* 2hmv_A* 2hmw_A* 1lsu_A* | Back alignment and structure |
|---|
| >1id1_A Putative potassium channel protein; RCK domain, E.coli potassium channel, BK channel, rossmann fold, membrane protein; 2.40A {Escherichia coli} SCOP: c.2.1.9 | Back alignment and structure |
|---|
| >1pqw_A Polyketide synthase; rossmann fold, dimer, structural genomics, PSI, protein STRU initiative; 2.66A {Mycobacterium tuberculosis} SCOP: c.2.1.1 | Back alignment and structure |
|---|
| >4ina_A Saccharopine dehydrogenase; structural genomics, PSI-biology, northeast structural genom consortium, NESG, oxidoreductas; 2.49A {Wolinella succinogenes} | Back alignment and structure |
|---|
| >1b8p_A Protein (malate dehydrogenase); oxidoreductase; 1.90A {Aquaspirillum arcticum} SCOP: c.2.1.5 d.162.1.1 PDB: 1b8u_A* 1b8v_A* 3d5t_A | Back alignment and structure |
|---|
| >2g1u_A Hypothetical protein TM1088A; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.50A {Thermotoga maritima} PDB: 3l4b_A* | Back alignment and structure |
|---|
| >1lss_A TRK system potassium uptake protein TRKA homolog; KTN domain, NAD, RCK domain, potassium transport, potassium channel, KTRA; HET: NAD; 2.30A {Methanocaldococcus jannaschii} SCOP: c.2.1.9 | Back alignment and structure |
|---|
| >2axq_A Saccharopine dehydrogenase; rossmann fold variant, saccharopine reductase fold (domain II), alpha/beta protein; 1.70A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1jay_A Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossman fold, structural genomics; HET: NAP F42; 1.65A {Archaeoglobus fulgidus} SCOP: c.2.1.6 PDB: 1jax_A* | Back alignment and structure |
|---|
| >3l4b_C TRKA K+ channel protien TM1088B; potassium channel, ring-gating complex, structural GEN PSI-2-2, protein structure initiative; HET: AMP; 3.45A {Thermotoga maritima} | Back alignment and structure |
|---|
| >1nyt_A Shikimate 5-dehydrogenase; alpha/beta domains, WIDE cleft separation, oxidoreductase; HET: NAP; 1.50A {Escherichia coli} SCOP: c.2.1.7 c.58.1.5 | Back alignment and structure |
|---|
| >1v3u_A Leukotriene B4 12- hydroxydehydrogenase/prostaglandin 15-keto reductase; rossmann fold, riken structural genomics/proteomics initiative, RSGI; 2.00A {Cavia porcellus} SCOP: b.35.1.2 c.2.1.1 PDB: 1v3t_A 1v3v_A* 2dm6_A* 1zsv_A 2y05_A* | Back alignment and structure |
|---|
| >2hcy_A Alcohol dehydrogenase 1; tetramer of asymmetric dimers, zinc coordination, intramolec disulfide bonds, oxidoreductase; HET: 8ID; 2.44A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1smk_A Malate dehydrogenase, glyoxysomal; tricarboxylic cycle, glyoxysome, NAD, glyoxylate bypass, oxidoreductase; HET: CIT; 2.50A {Citrullus lanatus} PDB: 1sev_A | Back alignment and structure |
|---|
| >3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12} | Back alignment and structure |
|---|
| >3c24_A Putative oxidoreductase; YP_511008.1, structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.62A {Jannaschia SP} | Back alignment and structure |
|---|
| >1p77_A Shikimate 5-dehydrogenase; NADPH, oxidoreductase; HET: ATR; 1.95A {Haemophilus influenzae} SCOP: c.2.1.7 c.58.1.5 PDB: 1p74_A* | Back alignment and structure |
|---|
| >1nvt_A Shikimate 5'-dehydrogenase; structural genomics, PSI, protein structure initiative; HET: NAP; 2.35A {Methanocaldococcus jannaschii} SCOP: c.2.1.7 c.58.1.5 | Back alignment and structure |
|---|
| >1qor_A Quinone oxidoreductase; HET: NAP; 2.20A {Escherichia coli} SCOP: b.35.1.2 c.2.1.1 | Back alignment and structure |
|---|
| >3o8q_A Shikimate 5-dehydrogenase I alpha; structural genomics, center for structural genomics of infec diseases, csgid; HET: EPE; 1.45A {Vibrio cholerae biovar el tor} PDB: 3sef_A* 3pgj_A* 3o8q_B* | Back alignment and structure |
|---|
| >1wly_A CAAR, 2-haloacrylate reductase; NADPH-dependent oxidoreductase, oxidoreductase; 1.30A {Burkholderia SP} | Back alignment and structure |
|---|
| >1iz0_A Quinone oxidoreductase; APO-enzyme, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.30A {Thermus thermophilus} SCOP: b.35.1.2 c.2.1.1 PDB: 1iyz_A 2cf2_D | Back alignment and structure |
|---|
| >3tnl_A Shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD SKM; 1.45A {Listeria monocytogenes} PDB: 3toz_A* | Back alignment and structure |
|---|
| >1yb5_A Quinone oxidoreductase; medium-chain dehydrogenase/reductase, quinon reduction, structural genomics, structural genomics consort; HET: NAP; 1.85A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 | Back alignment and structure |
|---|
| >2j8z_A Quinone oxidoreductase; medium-chain dehydrogenase- reductases, QUIN oxidoreductase, oxidative stress response; HET: NAP; 2.50A {Homo sapiens} PDB: 2oby_A* | Back alignment and structure |
|---|
| >2j3h_A NADP-dependent oxidoreductase P1; double bond reductase (AT5G16970), APO form; 2.5A {Arabidopsis thaliana} PDB: 2j3i_A* 2j3j_A* 2j3k_A* | Back alignment and structure |
|---|
| >3jyo_A Quinate/shikimate dehydrogenase; enzyme-cofactor complex, amino-acid biosynthesis, aromatic A biosynthesis, NAD, oxidoreductase; HET: NAD; 1.00A {Corynebacterium glutamicum} PDB: 3jyp_A* 3jyq_A* 2nlo_A | Back alignment and structure |
|---|
| >4b7c_A Probable oxidoreductase; NADP cofactor, rossmann fold; HET: MES; 2.10A {Pseudomonas aeruginosa PA01} PDB: 4b7x_A* | Back alignment and structure |
|---|
| >4eye_A Probable oxidoreductase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.10A {Mycobacterium abscessus} | Back alignment and structure |
|---|
| >4g65_A TRK system potassium uptake protein TRKA; structural genomics, center for structural genomics of infec diseases, csgid, niaid; HET: MSE; 2.09A {Vibrio vulnificus} | Back alignment and structure |
|---|
| >3ond_A Adenosylhomocysteinase; plant protein, enzyme-substrate complex, NAD cofactor, regul SAM-dependent methylation reactions; HET: NAD ADN; 1.17A {Lupinus luteus} PDB: 3one_A* 3onf_A* | Back alignment and structure |
|---|
| >2zb4_A Prostaglandin reductase 2; rossmann fold, alternative splicing, cytoplasm, NADP, oxidoreductase; HET: NAP 5OP; 1.63A {Homo sapiens} PDB: 2zb7_A* 2zb8_A* 2w98_A* 2vna_A* 2w4q_A* 1vj1_A 2zb3_A* | Back alignment and structure |
|---|
| >3abi_A Putative uncharacterized protein PH1688; L-lysine dehydrogenase, oxidoreductase; HET: NAD; 2.44A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >3pwz_A Shikimate dehydrogenase 3; alpha-beta, oxidoreductase; 1.71A {Pseudomonas putida} | Back alignment and structure |
|---|
| >4dup_A Quinone oxidoreductase; PSI-biology, structural genomics, protein structure initiati structural genomics research consortium, nysgrc; 2.45A {Rhizobium etli} | Back alignment and structure |
|---|
| >3gms_A Putative NADPH:quinone reductase; structural genomics, putative quinone oxidoreductase, unknown function, PSI-2; 1.76A {Bacillus thuringiensis} | Back alignment and structure |
|---|
| >2o7s_A DHQ-SDH PR, bifunctional 3-dehydroquinate dehydratase/shikima dehydrogenase; shikimate, NADPH, dehydroshikimate, bifunctional enzyme; HET: DHK TLA NAP; 1.78A {Arabidopsis thaliana} PDB: 2o7q_A* 2gpt_A* | Back alignment and structure |
|---|
| >3phh_A Shikimate dehydrogenase; shikimate pathway, helicobacter PYL oxidoreductase, alpha/beta domain, rossmann fold; HET: SKM; 1.42A {Helicobacter pylori} PDB: 3phg_A* 3phi_A* 3phj_A* 4foo_A 4fpx_A 4fos_A* 4fr5_A* 4fq8_A* | Back alignment and structure |
|---|
| >3qwb_A Probable quinone oxidoreductase; rossmann fold, quinone oxidoreductases, NADPH, cytoplasm and oxidoreductase; HET: NDP; 1.59A {Saccharomyces cerevisiae} PDB: 3qwa_A* | Back alignment and structure |
|---|
| >2eez_A Alanine dehydrogenase; TTHA0216, structural genomic NPPSFA, national project on protein structural and function analyses; 2.71A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3jyn_A Quinone oxidoreductase; rossmann fold, protein-NADPH complex; HET: NDP; 2.01A {Pseudomonas syringae PV} PDB: 3jyl_A* | Back alignment and structure |
|---|
| >1pzg_A LDH, lactate dehydrogenase; apicomplexa, APAD, tetramer, rossmann fold, oxidoreductase; HET: CME A3D; 1.60A {Toxoplasma gondii} SCOP: c.2.1.5 d.162.1.1 PDB: 1pzf_A* 1pze_A* 1pzh_A* 3om9_A* 1sov_A 1sow_A* 3czm_A* | Back alignment and structure |
|---|
| >2eih_A Alcohol dehydrogenase; zinc ION binding protein, structural genomics, NPPSFA, natio project on protein structural and functional analyses; 2.30A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3don_A Shikimate dehydrogenase; alpha-beta structure, rossman fold, amino-acid biosynthesis, amino acid biosynthesis, NADP, oxidoreductase; 2.10A {Staphylococcus epidermidis} PDB: 3doo_A* | Back alignment and structure |
|---|
| >1f0y_A HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive ternary complex, oxidoreductase; HET: CAA NAD; 1.80A {Homo sapiens} SCOP: a.100.1.3 c.2.1.6 PDB: 3rqs_A 1lsj_A* 1il0_A* 1lso_A* 1m76_A* 1m75_A* 1f14_A 1f12_A 1f17_A* 3had_A* 2hdh_A* 3hdh_A* | Back alignment and structure |
|---|
| >2aef_A Calcium-gated potassium channel MTHK; rossmann fold, helix-turn-helix, Ca2+ binding, flexible interface; 1.70A {Methanothermobacterthermautotrophicus} PDB: 2aej_A 2aem_A 3rbx_A 2ogu_A 2fy8_A 3kxd_A | Back alignment and structure |
|---|
| >1jvb_A NAD(H)-dependent alcohol dehydrogenase; archaeon, zinc, oxidoreductase; HET: MSE; 1.85A {Sulfolobus solfataricus} SCOP: b.35.1.2 c.2.1.1 PDB: 1r37_A* 1nto_A 1nvg_A 3i4c_A 2eer_A* | Back alignment and structure |
|---|
| >3t4e_A Quinate/shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 1.95A {Salmonella enterica subsp} PDB: 1npd_A* 1o9b_A* 1vi2_A* | Back alignment and structure |
|---|
| >4huj_A Uncharacterized protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, dinucleotide-binding; 1.77A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >2cdc_A Glucose dehydrogenase glucose 1-dehydrogenase, DHG-1; reductase, oxidoreductase, MDR family; HET: XYS XYP NAP; 1.50A {Sulfolobus solfataricus} PDB: 2cdb_A* 2cd9_A 2cda_A* | Back alignment and structure |
|---|
| >1ks9_A KPA reductase;, 2-dehydropantoate 2-reductase; PANE, APBA, ketopantoate reductase, rossman fold, monomer, APO, oxidoreductase; 1.70A {Escherichia coli} SCOP: a.100.1.7 c.2.1.6 PDB: 1yon_A* 1yjq_A* 2ofp_A* | Back alignment and structure |
|---|
| >3lk7_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; agalacitae, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: MSE; 1.50A {Streptococcus agalactiae} | Back alignment and structure |
|---|
| >3c85_A Putative glutathione-regulated potassium-efflux S protein KEFB; TRKA domain; HET: AMP; 1.90A {Vibrio parahaemolyticus rimd 2210633} | Back alignment and structure |
|---|
| >3pi7_A NADH oxidoreductase; groes-like fold, NAD(P)-binding rossmann fold, structural GE joint center for structural genomics, JCSG; HET: MSE; 1.71A {Mesorhizobium loti} | Back alignment and structure |
|---|
| >3tl2_A Malate dehydrogenase; center for structural genomics of infectious diseases, csgid dehydrogenase, oxidoreductase, citric acid cycle; 1.70A {Bacillus anthracis} | Back alignment and structure |
|---|
| >2c0c_A Zinc binding alcohol dehydrogenase, domain containing 2; oxidoreductase, quinone oxidoreductase, medium-chain dehydrogenase/reductase; HET: NAP; 1.45A {Homo sapiens} PDB: 2x1h_A* 2x7h_A* 2wek_A* | Back alignment and structure |
|---|
| >2egg_A AROE, shikimate 5-dehydrogenase; dimer, X-RAY diffraction, structural genomics, NPPSFA; 2.25A {Geobacillus kaustophilus} | Back alignment and structure |
|---|
| >1mld_A Malate dehydrogenase; oxidoreductase(NAD(A)-CHOH(D)); HET: CIT; 1.83A {Sus scrofa} SCOP: c.2.1.5 d.162.1.1 PDB: 2dfd_A* | Back alignment and structure |
|---|
| >1pjc_A Protein (L-alanine dehydrogenase); oxidoreductase, NAD; HET: NAD; 2.00A {Phormidium lapideum} SCOP: c.2.1.4 c.23.12.2 PDB: 1pjb_A* 1say_A | Back alignment and structure |
|---|
| >3k96_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA, IDP01976, oxidoreductase, phospholipid biosynthesis; HET: EPE; 2.10A {Coxiella burnetii} | Back alignment and structure |
|---|
| >3fbg_A Putative arginate lyase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.60A {Staphylococcus haemolyticus} | Back alignment and structure |
|---|
| >1xa0_A Putative NADPH dependent oxidoreductases; structural genomics, protein structure initiative, MCSG; HET: DTY; 2.80A {Geobacillus stearothermophilus} SCOP: b.35.1.2 c.2.1.1 | Back alignment and structure |
|---|
| >4a0s_A Octenoyl-COA reductase/carboxylase; oxidoreductase, transferase, cinnabaramide PKS biosynthesis; HET: CO8 NAP; 1.90A {Streptomyces SP} PDB: 4a10_A | Back alignment and structure |
|---|
| >2vns_A Metalloreductase steap3; metal-binding, transmembrane, rossmann fold, transport, cell cycle, transferrin, flavoprotein, alternative splicing; HET: CIT; 2.0A {Homo sapiens} PDB: 2vq3_A* | Back alignment and structure |
|---|
| >2pv7_A T-protein [includes: chorismate mutase (EC 5.4.99 and prephenate dehydrogenase (EC...; 1574749, chorismate mutase type II; HET: MSE TYR NAD; 2.00A {Haemophilus influenzae} SCOP: a.100.1.12 c.2.1.6 | Back alignment and structure |
|---|
| >2raf_A Putative dinucleotide-binding oxidoreductase; NP_786167.1, NADP oxidoreductase coenzyme F420-dependent, structural genomics; HET: MSE NAP; 1.60A {Lactobacillus plantarum WCFS1} | Back alignment and structure |
|---|
| >2ew2_A 2-dehydropantoate 2-reductase, putative; alpha-structure, alpha-beta structure, structural genomics, protein structure initiative; HET: MSE; 2.00A {Enterococcus faecalis} | Back alignment and structure |
|---|
| >1tt7_A YHFP; alcohol dehydrogenase, Zn-dependent, NAD, structural genomics, protein structure initiative, PSI; 2.70A {Bacillus subtilis} SCOP: b.35.1.2 c.2.1.1 PDB: 1y9e_A* | Back alignment and structure |
|---|
| >1hye_A L-lactate/malate dehydrogenase; nucleotide binding domain, oxidoreductase; HET: NAP; 1.90A {Methanocaldococcus jannaschii} SCOP: c.2.1.5 d.162.1.1 PDB: 1hyg_A* | Back alignment and structure |
|---|
| >1y6j_A L-lactate dehydrogenase; southeast collaboratory for structural genomics, secsg, protein struc initiative, PSI, oxidoreductase; 3.01A {Clostridium thermocellum} SCOP: c.2.1.5 d.162.1.1 | Back alignment and structure |
|---|
| >4e12_A Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1.93A {Acinetobacter baylyi} PDB: 4dyd_A* 4e13_A* | Back alignment and structure |
|---|
| >1o6z_A MDH, malate dehydrogenase; halophilic, ION-binding, protein-solvent interaction, oxidoreductase; HET: NAD; 1.95A {Haloarcula marismortui} SCOP: c.2.1.5 d.162.1.1 PDB: 1gt2_A* 2x0r_A* 2j5k_A 2j5q_A 2j5r_A 1d3a_A 1hlp_A* 2hlp_A | Back alignment and structure |
|---|
| >1dih_A Dihydrodipicolinate reductase; oxidoreductase; HET: NDP; 2.20A {Escherichia coli} SCOP: c.2.1.3 d.81.1.3 PDB: 1arz_A* 1dru_A* 1drv_A* 1drw_A* | Back alignment and structure |
|---|
| >1bg6_A N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L) stereospecific opine dehydrogenase, oxidoreductase; 1.80A {Arthrobacter SP} SCOP: a.100.1.5 c.2.1.6 | Back alignment and structure |
|---|
| >2ewd_A Lactate dehydrogenase,; protein-substrate_cofactor analog complex, oxidoreductase; HET: A3D; 2.00A {Cryptosporidium parvum} PDB: 2frm_A 2fn7_A* 2fnz_A* 2fm3_A | Back alignment and structure |
|---|
| >3fbt_A Chorismate mutase and shikimate 5-dehydrogenase fusion protein; structural genomics, oxidoreductase, amino-acid biosynthesis; 2.10A {Clostridium acetobutylicum} | Back alignment and structure |
|---|
| >3dtt_A NADP oxidoreductase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: NAP; 1.70A {Arthrobacter SP} | Back alignment and structure |
|---|
| >3qha_A Putative oxidoreductase; seattle structural genomics center for infectious disease, S mycobacterium avium 104, rossmann fold; 2.25A {Mycobacterium avium} | Back alignment and structure |
|---|
| >2vhw_A Alanine dehydrogenase; NAD, secreted, oxidoreductase; HET: NAI; 2.0A {Mycobacterium tuberculosis} PDB: 2vhx_A* 2vhy_A 2vhz_A* 2vhv_A* 2voe_A 2voj_A* | Back alignment and structure |
|---|
| >3ggo_A Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-beta, oxidoreductase; HET: NAI ENO; 2.15A {Aquifex aeolicus} PDB: 3ggg_D* 3ggp_A* | Back alignment and structure |
|---|
| >3nx4_A Putative oxidoreductase; csgid, structural genomics, center for struc genomics of infectious diseases, PSI, protein structure INI; HET: MSE NAP; 1.90A {Salmonella enterica subsp} PDB: 1o89_A 1o8c_A* | Back alignment and structure |
|---|
| >3gaz_A Alcohol dehydrogenase superfamily protein; oxidoreductase, PSI-II, alcohol dehydrogenase superf structural genomics; 1.96A {Novosphingobium aromaticivorans} | Back alignment and structure |
|---|
| >1piw_A Hypothetical zinc-type alcohol dehydrogenase- like protein in PRE5-FET4 intergenic...; ADH topology, NADP(H)dependent, oxidoreductase; HET: NAP; 3.00A {Saccharomyces cerevisiae} SCOP: b.35.1.2 c.2.1.1 PDB: 1ps0_A* 1q1n_A | Back alignment and structure |
|---|
| >3oj0_A Glutr, glutamyl-tRNA reductase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE SO4; 1.65A {Thermoplasma volcanium} | Back alignment and structure |
|---|
| >3l9w_A Glutathione-regulated potassium-efflux system Pro linker, ancillary protein KEFF; potassium channel regulation, domains, antiport; HET: FMN AMP GSH; 1.75A {Escherichia coli} PDB: 3eyw_A* 3l9x_A* | Back alignment and structure |
|---|
| >3krt_A Crotonyl COA reductase; structural genomics, protein structure initiative, NYSGXRC, PSI-2; 2.19A {Streptomyces coelicolor} PDB: 3hzz_A | Back alignment and structure |
|---|
| >1rjw_A ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD, zinc, tetramer; 2.35A {Geobacillus stearothermophilus} SCOP: b.35.1.2 c.2.1.1 PDB: 3pii_A | Back alignment and structure |
|---|
| >2vn8_A Reticulon-4-interacting protein 1; mitochondrion, transit peptide, receptor inhibitor; HET: NDP CIT; 2.1A {Homo sapiens} | Back alignment and structure |
|---|
| >3pef_A 6-phosphogluconate dehydrogenase, NAD-binding; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R geobacter metallireducens; HET: NAP; 2.07A {Geobacter metallireducens} | Back alignment and structure |
|---|
| >3pqe_A L-LDH, L-lactate dehydrogenase; FBP, oxidoreductase; 2.20A {Bacillus subtilis} PDB: 3pqf_A* 3pqd_A* | Back alignment and structure |
|---|
| >1lld_A L-lactate dehydrogenase; oxidoreductase(CHOH (D)-NAD (A)); HET: NAD; 2.00A {Bifidobacterium longum subsp} SCOP: c.2.1.5 d.162.1.1 PDB: 1lth_T* | Back alignment and structure |
|---|
| >2uyy_A N-PAC protein; long-chain dehydrogenase, cytokine; HET: NA7; 2.5A {Homo sapiens} | Back alignment and structure |
|---|
| >3two_A Mannitol dehydrogenase; cinnamyl-alcohol dehydrogenase, NADP(H) oxidoreductase; HET: NDP; 2.18A {Helicobacter pylori} | Back alignment and structure |
|---|
| >2nqt_A N-acetyl-gamma-glutamyl-phosphate reductase; apoprotein, dimer, rossmann fold, structural genomics, PSI, protein structure initiative; 1.58A {Mycobacterium tuberculosis} PDB: 2i3a_A* 2i3g_A | Back alignment and structure |
|---|
| >3doj_A AT3G25530, dehydrogenase-like protein; gamma-hydroxybutyrate dehydrogenase, 4-hydroxybutyrate dehydrogenase; 2.10A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >5mdh_A Malate dehydrogenase; oxidoreductase, (NAD(A)-CHOH(D)); HET: NAD; 2.40A {Sus scrofa} SCOP: c.2.1.5 d.162.1.1 PDB: 4mdh_A* | Back alignment and structure |
|---|
| >3gvi_A Malate dehydrogenase; NAD, oxidoreductase, tricarboxylic acid cycle, structural genomics; HET: ADP; 2.25A {Brucella melitensis biovar ABORTUS2308} PDB: 3gvh_A* | Back alignment and structure |
|---|
| >4e21_A 6-phosphogluconate dehydrogenase (decarboxylating; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.30A {Geobacter metallireducens} | Back alignment and structure |
|---|
| >3mog_A Probable 3-hydroxybutyryl-COA dehydrogenase; structural genomics, PSI, protein structure initiative, NYSG oxidoreductase; 2.20A {Escherichia coli} | Back alignment and structure |
|---|
| >2hjr_A Malate dehydrogenase; malaria, structural genomics, structural genomics consortium, SGC, oxidoreductase; HET: CIT APR; 2.20A {Cryptosporidium parvum} | Back alignment and structure |
|---|
| >3fi9_A Malate dehydrogenase; structural genomics, oxidoreductase, PSI-2, protein structur initiative; 1.90A {Porphyromonas gingivalis} | Back alignment and structure |
|---|
| >4ezb_A Uncharacterized conserved protein; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 2.10A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >1ur5_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle; HET: NAD; 1.75A {Chloroflexus aurantiacus} SCOP: c.2.1.5 d.162.1.1 PDB: 1uxg_A* 1guy_A* 1uxk_A* 1uxh_A* 1uxj_A* 1uxi_A* | Back alignment and structure |
|---|
| >2ozp_A N-acetyl-gamma-glutamyl-phosphate reductase; amino acid biosynthesis, structural genomics, riken structur genomics/proteomics initiative; 2.01A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3g0o_A 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine catabolism, tartaric acid, target 11128H, NYSGXRC, PSI-2, structural genomics; HET: TLA; 1.80A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >4gbj_A 6-phosphogluconate dehydrogenase NAD-binding; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.05A {Dyadobacter fermentans} | Back alignment and structure |
|---|
| >3gg2_A Sugar dehydrogenase, UDP-glucose/GDP-mannose dehydrogenase family; structural genomics, oxidoreductase, PSI-2; HET: UGA; 1.70A {Porphyromonas gingivalis} | Back alignment and structure |
|---|
| >2d8a_A PH0655, probable L-threonine 3-dehydrogenase; pyrococcus horikoshii OT3, structural genomics; HET: NAD; 2.05A {Pyrococcus horikoshii} PDB: 2dfv_A* 3gfb_A* | Back alignment and structure |
|---|
| >1jw9_B Molybdopterin biosynthesis MOEB protein; MOEB: modified rossmann fold, (2) Cys-X-X-Cys zinc-binding M MOAD: ubiquitin-like fold; 1.70A {Escherichia coli} SCOP: c.111.1.1 PDB: 1jwa_B* 1jwb_B* | Back alignment and structure |
|---|
| >2qyt_A 2-dehydropantoate 2-reductase; APC81190, porphyromonas gingi W83, structural genomics, PSI-2; HET: MSE; 2.15A {Porphyromonas gingivalis} | Back alignment and structure |
|---|
| >3p2o_A Bifunctional protein fold; structural genomics, center for structural genomics of infec diseases, csgid, alpha-beta-alpha sandwich; HET: NAD; 2.23A {Campylobacter jejuni subsp} | Back alignment and structure |
|---|
| >1yqd_A Sinapyl alcohol dehydrogenase; lignin, monolignol, oxidoreductase, zinc-dependent, plant DE biosynthesis, substrate inhibition; HET: NAP; 1.65A {Populus tremuloides} PDB: 1yqx_A* | Back alignment and structure |
|---|
| >1t2d_A LDH-P, L-lactate dehydrogenase; ternary complex, oxidoreductase; HET: NAD; 1.10A {Plasmodium falciparum} SCOP: c.2.1.5 d.162.1.1 PDB: 1t25_A* 1t26_A* 1t2c_A* 1t24_A* 2x8l_A 2ydn_A* 2a94_A* 1u4s_A* 1u5a_A* 1u5c_A* 1u4o_A* 1t2e_A* 1xiv_A* 1ceq_A 1ldg_A* 1cet_A* 1oc4_A* 2a92_A* 2aa3_A* | Back alignment and structure |
|---|
| >1gu7_A Enoyl-[acyl-carrier-protein] reductase [NADPH, B-specific] 1,mitochondrial; oxidoreductase, thioester reduction, fatty acids; 1.70A {Candida tropicalis} SCOP: b.35.1.2 c.2.1.1 PDB: 1guf_A* 1n9g_B* 1n9g_A* 1gyr_A 1h0k_A | Back alignment and structure |
|---|
| >2f1k_A Prephenate dehydrogenase; tyrosine synthesis, X-RA crystallography structure, oxidoreductase; HET: OMT NAP; 1.55A {Synechocystis SP} SCOP: a.100.1.12 c.2.1.6 | Back alignment and structure |
|---|
| >2rcy_A Pyrroline carboxylate reductase; malaria, structural genomics, pyrroline reductase, oxidoredu structural genomics consortium, SGC; HET: NAP; 2.30A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >3pdu_A 3-hydroxyisobutyrate dehydrogenase family protein; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R glyoxylate metabolism; HET: NAP; 1.89A {Geobacter sulfurreducens} | Back alignment and structure |
|---|
| >3goh_A Alcohol dehydrogenase, zinc-containing; NP_718042.1, alcohol dehydrogenase superfamily protein, ALCO dehydrogenase groes-like domain; 1.55A {Shewanella oneidensis} | Back alignment and structure |
|---|
| >3i83_A 2-dehydropantoate 2-reductase; structural genomics, oxidoreductase, NADP, pantothenate BIOS PSI-2, protein structure initiative; 1.90A {Methylococcus capsulatus} | Back alignment and structure |
|---|
| >2rir_A Dipicolinate synthase, A chain; structural genomics, APC1343, PSI-2, structure initiative; HET: MSE NAP; 2.79A {Bacillus subtilis} | Back alignment and structure |
|---|
| >1guz_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle, NAD; HET: NAD; 2.0A {Chlorobium vibrioforme} SCOP: c.2.1.5 d.162.1.1 PDB: 1gv1_A 1gv0_A* | Back alignment and structure |
|---|
| >3uog_A Alcohol dehydrogenase; structural genomics, protein structure initiative, PSI-biolo YORK structural genomics research consortium; 2.20A {Sinorhizobium meliloti 1021} | Back alignment and structure |
|---|
| >4dvj_A Putative zinc-dependent alcohol dehydrogenase Pro; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.99A {Rhizobium etli} | Back alignment and structure |
|---|
| >3u62_A Shikimate dehydrogenase; shikimate pathway, oxidoreductase; 1.45A {Thermotoga maritima} | Back alignment and structure |
|---|
| >1vpd_A Tartronate semialdehyde reductase; structural genomics, MCSG, protein structure initiative, PSI, midwest center for structural genomics; HET: MSE TLA; 1.65A {Salmonella typhimurium} SCOP: a.100.1.1 c.2.1.6 | Back alignment and structure |
|---|
| >1uuf_A YAHK, zinc-type alcohol dehydrogenase-like protein YAHK; oxidoreductase, zinc binding, oxydoreductase, metal-binding; 1.76A {Escherichia coli} SCOP: b.35.1.2 c.2.1.1 | Back alignment and structure |
|---|
| >1leh_A Leucine dehydrogenase; oxidoreductase; 2.20A {Lysinibacillus sphaericus} SCOP: c.2.1.7 c.58.1.1 | Back alignment and structure |
|---|
| >3hn2_A 2-dehydropantoate 2-reductase; PSI-2, NYSGXRC, structural GE protein structure initiative; 2.50A {Geobacter metallireducens} | Back alignment and structure |
|---|
| >1e3j_A NADP(H)-dependent ketose reductase; oxidoreductase, fructose reduction; 2.3A {Bemisia argentifolii} SCOP: b.35.1.2 c.2.1.1 | Back alignment and structure |
|---|
| >2gcg_A Glyoxylate reductase/hydroxypyruvate reductase; NAD(P) rossmann fold, formate/glycerate dehydrogenase substr binding domain, oxidoreductase; HET: NDP; 2.20A {Homo sapiens} PDB: 2wwr_A 2h1s_A 2q50_A | Back alignment and structure |
|---|
| >1ys4_A Aspartate-semialdehyde dehydrogenase; oxidoreductase, asadh; HET: NAP; 2.29A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >1xyg_A Putative N-acetyl-gamma-glutamyl-phosphate reduct; structural genomics, protein structure initiative, CENT eukaryotic structural genomics; 2.19A {Arabidopsis thaliana} SCOP: c.2.1.3 d.81.1.1 PDB: 2q49_A 2cvo_A | Back alignment and structure |
|---|
| >4h7p_A Malate dehydrogenase; ssgcid, structural G seattle structural genomics center for infectious disease, oxidoreductase; 1.30A {Leishmania major} | Back alignment and structure |
|---|
| >2dq4_A L-threonine 3-dehydrogenase; NAD-dependent, oxidoreductase, structural genomics, NPPSFA; HET: MES; 2.50A {Thermus thermophilus} PDB: 2ejv_A* | Back alignment and structure |
|---|
| >2v6b_A L-LDH, L-lactate dehydrogenase; oxidoreductase, radioresistance, NAD, cytoplasm, mesophilic, glycolysis; 2.50A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >2izz_A Pyrroline-5-carboxylate reductase 1; amino-acid biosynthesis, NADP, oxidoreductase, proline biosy; HET: NAD; 1.95A {Homo sapiens} PDB: 2ger_A 2gr9_A* 2gra_A* | Back alignment and structure |
|---|
| >2hk9_A Shikimate dehydrogenase; shikimate pathway, drug design, oxidoreductase; HET: ATR SKM NAP; 2.20A {Aquifex aeolicus} PDB: 2hk8_A 2hk7_A | Back alignment and structure |
|---|
| >1kjq_A GART 2, phosphoribosylglycinamide formyltransferase 2, 5'-; ATP-grAsp, purine biosynthesis, nucleotide; HET: ADP MPO; 1.05A {Escherichia coli} SCOP: b.84.2.1 c.30.1.1 d.142.1.2 PDB: 1kj9_A* 1kji_A* 1kjj_A* 1kj8_A* 1eyz_A* 1ez1_A* | Back alignment and structure |
|---|
| >3ngx_A Bifunctional protein fold; methylenetetrahydrofolate dehydrogenase/cyclohydrolase; 2.30A {Thermoplasma acidophilum} PDB: 3ngl_A | Back alignment and structure |
|---|
| >1gpj_A Glutamyl-tRNA reductase; tRNA-dependent tetrapyrrole biosynthesis; HET: GMC CIT; 1.95A {Methanopyrus kandleri} SCOP: a.151.1.1 c.2.1.7 d.58.39.1 | Back alignment and structure |
|---|
| >3cky_A 2-hydroxymethyl glutarate dehydrogenase; rossmann fold, two domain enzyme, oxidoreductase; 2.30A {Eubacterium barkeri} | Back alignment and structure |
|---|
| >3ghy_A Ketopantoate reductase protein; oxidoreductase, NAD-binding domain, PSI-2, NYSGXRC, structur genomics, protein structure initiative; 2.00A {Ralstonia solanacearum} | Back alignment and structure |
|---|
| >1mv8_A GMD, GDP-mannose 6-dehydrogenase; rossman fold, domain-swapped dimer, enzyme complex with COFA product, oxidoreductase; HET: SUC NAD GDX; 1.55A {Pseudomonas aeruginosa} SCOP: a.100.1.4 c.2.1.6 c.26.3.1 PDB: 1mfz_A* 1muu_A* | Back alignment and structure |
|---|
| >3qsg_A NAD-binding phosphogluconate dehydrogenase-like P; structural genomics, PSI-biology, midwest center for structu genomics; 1.90A {Alicyclobacillus acidocaldarius subsp} | Back alignment and structure |
|---|
| >3d4o_A Dipicolinate synthase subunit A; NP_243269.1, structural GEN joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: MSE TAR; 2.10A {Bacillus halodurans} | Back alignment and structure |
|---|
| >3s2e_A Zinc-containing alcohol dehydrogenase superfamily; FURX, oxidoreductase; HET: NAD; 1.76A {Ralstonia eutropha} PDB: 3s1l_A* 3s2f_A* 3s2g_A* 3s2i_A* 1llu_A* 3meq_A* | Back alignment and structure |
|---|
| >2dbq_A Glyoxylate reductase; D-3-phosphoglycerate dehydrogenase, ST genomics, NPPSFA; HET: NAP; 1.70A {Pyrococcus horikoshii} PDB: 2dbr_A* 2dbz_A* | Back alignment and structure |
|---|
| >2h6e_A ADH-4, D-arabinose 1-dehydrogenase; rossman fold, medium chain alcohol dehydrogenase, oxidoreduc; 1.80A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >3g17_A Similar to 2-dehydropantoate 2-reductase; structural genomics, putative 2-dehydropantoate 2-reductase, protein structure initiative; 2.30A {Staphylococcus aureus subsp} | Back alignment and structure |
|---|
| >3p7m_A Malate dehydrogenase; putative dehydrogenase, enzyme, structural genomics, center structural genomics of infectious diseases, csgid; 2.20A {Francisella tularensis} | Back alignment and structure |
|---|
| >1h2b_A Alcohol dehydrogenase; oxidoreductase, archaea, hyperthermophIle, zinc; HET: OCA NAJ; 1.62A {Aeropyrum pernix} SCOP: b.35.1.2 c.2.1.1 | Back alignment and structure |
|---|
| >4dll_A 2-hydroxy-3-oxopropionate reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.11A {Polaromonas SP} | Back alignment and structure |
|---|
| >2b5w_A Glucose dehydrogenase; nucleotide binding motif, oxidoreductase; HET: FLC NAP; 1.60A {Haloferax mediterranei} PDB: 2b5v_A* 2vwg_A* 2vwh_A* 2vwp_A* 2vwq_A* | Back alignment and structure |
|---|
| >3gqv_A Enoyl reductase; medium-chain reductase (MDR superfamily), rossmann fold, NAD binding, oxidoreductase; HET: NAP; 1.74A {Aspergillus terreus} PDB: 3b6z_A* 3b70_A* | Back alignment and structure |
|---|
| >3dfz_A SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase, cobalamin biosynthesis, NAD, oxidoreducta porphyrin biosynthesis; 2.30A {Bacillus megaterium} | Back alignment and structure |
|---|
| >3ktd_A Prephenate dehydrogenase; structural genomics, joint center F structural genomics, JCSG, protein structure initiative; 2.60A {Corynebacterium glutamicum atcc 13032} | Back alignment and structure |
|---|
| >2ahr_A Putative pyrroline carboxylate reductase; pyrroline reductase, proline biosynthesis, NAD(P protein, rossmann fold, doain swapping; HET: NAP; 2.15A {Streptococcus pyogenes} SCOP: a.100.1.10 c.2.1.6 PDB: 2amf_A | Back alignment and structure |
|---|
| >1oju_A MDH, malate dehydrogenase; hyperthermophilic, oxidoreductase; HET: ENA; 2.79A {Archaeoglobus fulgidus} PDB: 1ojs_A* 2x0i_A* 2x0j_A* | Back alignment and structure |
|---|
| >3tqh_A Quinone oxidoreductase; HET: NDP; 2.44A {Coxiella burnetii} | Back alignment and structure |
|---|
| >4a5o_A Bifunctional protein fold; oxidoreductase, hydrolase; 2.20A {Pseudomonas aeruginosa PAO1} | Back alignment and structure |
|---|
| >1evy_A Glycerol-3-phosphate dehydrogenase; rossmann fold, oxidoreductase; HET: MYS; 1.75A {Leishmania mexicana} SCOP: a.100.1.6 c.2.1.6 PDB: 1evz_A* 1jdj_A* 1m66_A* 1m67_A* 1n1e_A* 1n1g_A* | Back alignment and structure |
|---|
| >1vj0_A Alcohol dehydrogenase, zinc-containing; TM0436, structural G JCSG, PSI, protein structure initiative, joint center for S genomics; 2.00A {Thermotoga maritima} SCOP: b.35.1.2 c.2.1.1 | Back alignment and structure |
|---|
| >3l07_A Bifunctional protein fold; structural genomics, IDP01849, methylenetetrahydrofolate dehydrogenase; 1.88A {Francisella tularensis} | Back alignment and structure |
|---|
| >3tri_A Pyrroline-5-carboxylate reductase; amino acid biosynthesis, oxidoreductase; HET: NAP; 2.50A {Coxiella burnetii} | Back alignment and structure |
|---|
| >1txg_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; oxidoreductase; 1.70A {Archaeoglobus fulgidus} SCOP: a.100.1.6 c.2.1.6 | Back alignment and structure |
|---|
| >1yqg_A Pyrroline-5-carboxylate reductase; structural genomics, PSI, structure initiative, midwest center for structural genomic oxidoreductase; 1.90A {Neisseria meningitidis} SCOP: a.100.1.10 c.2.1.6 PDB: 2ag8_A* | Back alignment and structure |
|---|
| >3vku_A L-LDH, L-lactate dehydrogenase; rossmann fold, NADH binding, oxidoreductase; 1.96A {Lactobacillus casei} PDB: 2zqz_A 2zqy_A 3vkv_A* 1llc_A* | Back alignment and structure |
|---|
| >1cdo_A Alcohol dehydrogenase; oxidoreductase, oxidoreductase (CH-OH(D)-NAD(A)); HET: NAD; 2.05A {Gadus callarias} SCOP: b.35.1.2 c.2.1.1 | Back alignment and structure |
|---|
| >1a5z_A L-lactate dehydrogenase; oxidoreductase, glycolysis, hyperthermophiles, thermotoga MA protein stability; HET: FBP NAD; 2.10A {Thermotoga maritima} SCOP: c.2.1.5 d.162.1.1 | Back alignment and structure |
|---|
| >2jhf_A Alcohol dehydrogenase E chain; oxidoreductase, metal coordination, NAD, zinc, inhibition, acetylation, metal-binding; HET: NAD; 1.0A {Equus caballus} SCOP: b.35.1.2 c.2.1.1 PDB: 1adc_A* 1adf_A* 1adg_A* 1adb_A* 1bto_A* 1heu_A* 1hf3_A* 1hld_A* 1lde_A* 1ldy_A* 1mg0_A* 1n92_A* 1p1r_A* 1ye3_A 1het_A* 2jhg_A* 2ohx_A* 2oxi_A* 3bto_A* 4dwv_A* ... | Back alignment and structure |
|---|
| >3ado_A Lambda-crystallin; L-gulonate 3-dehydrogenase, structural genomics, riken struc genomics/proteomics initiative, RSGI, acetylation; 1.70A {Oryctolagus cuniculus} PDB: 3adp_A* 3f3s_A* | Back alignment and structure |
|---|
| >1e3i_A Alcohol dehydrogenase, class II; HET: NAD; 2.08A {Mus musculus} SCOP: b.35.1.2 c.2.1.1 PDB: 1e3e_A* 1e3l_A* 3cos_A* | Back alignment and structure |
|---|
| >1yb4_A Tartronic semialdehyde reductase; structural genomics, oxidoreductase, salmonella typhimurium LT2, PSI, protein ST initiative; 2.40A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >3l6d_A Putative oxidoreductase; structural genomics, protein structure initiative, oxidoredu PSI-2; HET: MSE; 1.90A {Pseudomonas putida} | Back alignment and structure |
|---|
| >2vou_A 2,6-dihydroxypyridine hydroxylase; oxidoreductase, aromatic hydroxylase, nicotine degradation, mono-oxygenase; HET: FAD; 2.6A {Arthrobacter nicotinovorans} SCOP: c.3.1.2 d.16.1.2 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 64 | ||||
| d1y1pa1 | 342 | c.2.1.2 (A:2-343) Aldehyde reductase II {Sporobolo | 7e-18 | |
| d1xgka_ | 350 | c.2.1.2 (A:) Negative transcriptional regulator Nm | 8e-14 | |
| d1rkxa_ | 356 | c.2.1.2 (A:) CDP-glucose-4,6-dehydratase {Yersinia | 1e-11 | |
| d1rpna_ | 321 | c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Pseudomo | 8e-11 | |
| d1n7ha_ | 339 | c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Thale-cr | 1e-10 | |
| d1qyda_ | 312 | c.2.1.2 (A:) Pinoresinol-lariciresinol reductase { | 4e-10 | |
| d1t2aa_ | 347 | c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Human (H | 7e-10 | |
| d1db3a_ | 357 | c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Escheric | 8e-10 | |
| d1hdoa_ | 205 | c.2.1.2 (A:) Biliverdin IX beta reductase {Human ( | 1e-09 | |
| d1qyca_ | 307 | c.2.1.2 (A:) Phenylcoumaran benzylic ether reducta | 2e-09 | |
| d1oc2a_ | 346 | c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) { | 3e-09 | |
| d1z45a2 | 347 | c.2.1.2 (A:11-357) Uridine diphosphogalactose-4-ep | 7e-09 | |
| d1sb8a_ | 341 | c.2.1.2 (A:) UDP-N-acetylglucosamine 4-epimerase W | 1e-08 | |
| d1i24a_ | 393 | c.2.1.2 (A:) Sulfolipid biosynthesis protein SQD1 | 2e-08 | |
| d2q46a1 | 252 | c.2.1.2 (A:2-253) Hypothetical protein At5g02240 ( | 4e-08 | |
| d2c5aa1 | 363 | c.2.1.2 (A:13-375) GDP-mannose-3', 5'-epimerase {T | 7e-08 | |
| d2blla1 | 342 | c.2.1.2 (A:316-657) Polymyxin resistance protein A | 1e-07 | |
| d2a35a1 | 212 | c.2.1.2 (A:4-215) Hypothetical protein PA4017 {Pse | 1e-07 | |
| d1eq2a_ | 307 | c.2.1.2 (A:) ADP-L-glycero-D-mannoheptose 6-epimer | 2e-07 | |
| d1kewa_ | 361 | c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) { | 2e-07 | |
| d1ek6a_ | 346 | c.2.1.2 (A:) Uridine diphosphogalactose-4-epimeras | 2e-07 | |
| d2b69a1 | 312 | c.2.1.2 (A:4-315) UDP-glucuronate decarboxylase 1 | 3e-07 | |
| d1orra_ | 338 | c.2.1.2 (A:) CDP-tyvelose-2-epimerase {Salmonella | 3e-07 | |
| d1udca_ | 338 | c.2.1.2 (A:) Uridine diphosphogalactose-4-epimeras | 4e-07 | |
| d2bkaa1 | 232 | c.2.1.2 (A:5-236) TAT-interacting protein TIP30 {H | 4e-07 | |
| d1vl0a_ | 281 | c.2.1.2 (A:) DTDP-4-dehydrorhamnose reductase RfbD | 5e-07 | |
| d1r6da_ | 322 | c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) { | 7e-07 | |
| d1e6ua_ | 315 | c.2.1.2 (A:) GDP-4-keto-6-deoxy-d-mannose epimeras | 9e-07 | |
| d1n2sa_ | 298 | c.2.1.2 (A:) dTDP-6-deoxy-L-lyxo-4-hexulose reduct | 2e-06 | |
| d1sbya1 | 254 | c.2.1.2 (A:1-254) Drosophila alcohol dehydrogenase | 1e-05 | |
| d1gy8a_ | 383 | c.2.1.2 (A:) Uridine diphosphogalactose-4-epimeras | 5e-05 | |
| d1zk4a1 | 251 | c.2.1.2 (A:1-251) R-specific alcohol dehydrogenase | 2e-04 | |
| d2bgka1 | 268 | c.2.1.2 (A:11-278) Rhizome secoisolariciresinol de | 2e-04 | |
| d1uzma1 | 237 | c.2.1.2 (A:9-245) beta-keto acyl carrier protein r | 3e-04 | |
| d2o23a1 | 248 | c.2.1.2 (A:6-253) Type II 3-hydroxyacyl-CoA dehydr | 3e-04 | |
| d1h5qa_ | 260 | c.2.1.2 (A:) Mannitol dehydrogenase {Mushroom (Aga | 4e-04 | |
| d1xu9a_ | 269 | c.2.1.2 (A:) 11-beta-hydroxysteroid dehydrogenase | 4e-04 | |
| d1xhla_ | 274 | c.2.1.2 (A:) Hypothetical protein F25D1.5 {Caenorh | 5e-04 | |
| d1xg5a_ | 257 | c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC41 | 5e-04 | |
| d1q7ba_ | 243 | c.2.1.2 (A:) beta-keto acyl carrier protein reduct | 6e-04 | |
| d1xkqa_ | 272 | c.2.1.2 (A:) Hypothetical protein R05D8.7 {Caenorh | 6e-04 | |
| d1k2wa_ | 256 | c.2.1.2 (A:) Sorbitol dehydrogenase {Rhodobacter s | 6e-04 | |
| d1spxa_ | 264 | c.2.1.2 (A:) Glucose dehydrogenase (5l265) {Nemato | 8e-04 | |
| d1geea_ | 261 | c.2.1.2 (A:) Glucose dehydrogenase {Bacillus megat | 8e-04 | |
| d1g0oa_ | 272 | c.2.1.2 (A:) 1,3,8-trihydroxynaphtalene reductase | 0.001 | |
| d1fmca_ | 255 | c.2.1.2 (A:) 7-alpha-hydroxysteroid dehydrogenase | 0.001 | |
| d1gz6a_ | 302 | c.2.1.2 (A:) (3R)-hydroxyacyl-CoA dehydrogenase do | 0.001 | |
| d1pr9a_ | 244 | c.2.1.2 (A:) Carbonyl reductase {Human (Homo sapie | 0.001 | |
| d1dhra_ | 236 | c.2.1.2 (A:) Dihydropteridin reductase (pteridine | 0.001 | |
| d1zema1 | 260 | c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconoba | 0.001 | |
| d1ulsa_ | 242 | c.2.1.2 (A:) beta-keto acyl carrier protein reduct | 0.002 | |
| d1bdba_ | 276 | c.2.1.2 (A:) Cis-biphenyl-2,3-dihydrodiol-2,3-dehy | 0.002 | |
| d1cyda_ | 242 | c.2.1.2 (A:) Carbonyl reductase {Mouse (Mus muscul | 0.002 | |
| d2ag5a1 | 245 | c.2.1.2 (A:1-245) Dehydrogenase/reductase SDR fami | 0.002 | |
| d1xq1a_ | 259 | c.2.1.2 (A:) Tropinone reductase {Thale cress (Ara | 0.002 | |
| d1o5ia_ | 234 | c.2.1.2 (A:) beta-keto acyl carrier protein reduct | 0.002 | |
| d1vl8a_ | 251 | c.2.1.2 (A:) Gluconate 5-dehydrogenase {Thermotoga | 0.002 | |
| d1ydea1 | 250 | c.2.1.2 (A:4-253) Retinal dehydrogenase/reductase | 0.002 | |
| d2ae2a_ | 259 | c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datu | 0.002 | |
| d1ae1a_ | 258 | c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datu | 0.002 | |
| d1ja9a_ | 259 | c.2.1.2 (A:) 1,3,6,8-tetrahydroxynaphthalene reduc | 0.002 | |
| d1yxma1 | 297 | c.2.1.2 (A:7-303) Peroxisomal trans 2-enoyl CoA re | 0.003 | |
| d1iy8a_ | 258 | c.2.1.2 (A:) Levodione reductase {Corynebacterium | 0.003 | |
| d2a4ka1 | 241 | c.2.1.2 (A:2-242) beta-keto acyl carrier protein r | 0.003 | |
| d1nffa_ | 244 | c.2.1.2 (A:) Putative oxidoreductase Rv2002 {Mycob | 0.003 | |
| d1yb1a_ | 244 | c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase | 0.003 | |
| d1w6ua_ | 294 | c.2.1.2 (A:) 2,4-dienoyl-CoA reductase, mitochondr | 0.003 | |
| d1hxha_ | 253 | c.2.1.2 (A:) 3beta/17beta hydroxysteroid dehydroge | 0.003 | |
| d2c07a1 | 251 | c.2.1.2 (A:54-304) beta-keto acyl carrier protein | 0.004 | |
| d1yo6a1 | 250 | c.2.1.2 (A:1-250) Putative carbonyl reductase snif | 0.004 | |
| d1x1ta1 | 260 | c.2.1.2 (A:1-260) D(-)-3-hydroxybutyrate dehydroge | 0.004 | |
| d2gdza1 | 254 | c.2.1.2 (A:3-256) 15-hydroxyprostaglandin dehydrog | 0.004 |
| >d1y1pa1 c.2.1.2 (A:2-343) Aldehyde reductase II {Sporobolomyces salmonicolor [TaxId: 5005]} Length = 342 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: NAD(P)-binding Rossmann-fold domains superfamily: NAD(P)-binding Rossmann-fold domains family: Tyrosine-dependent oxidoreductases domain: Aldehyde reductase II species: Sporobolomyces salmonicolor [TaxId: 5005]
Score = 72.5 bits (176), Expect = 7e-18
Identities = 18/61 (29%), Positives = 29/61 (47%), Gaps = 1/61 (1%)
Query: 4 KGKVVCVTGASGFIASWLVKLLLQRSYTVKATVRDLNN-HNAEHLLTLDGAEERLHLFKA 62
+G +V VTGA+GF+AS +V+ LL+ Y V+ T R + N +
Sbjct: 10 EGSLVLVTGANGFVASHVVEQLLEHGYKVRGTARSASKLANLQKRWDAKYPGRFETAVVE 69
Query: 63 N 63
+
Sbjct: 70 D 70
|
| >d1xgka_ c.2.1.2 (A:) Negative transcriptional regulator NmrA {Aspergillus nidulans [TaxId: 162425]} Length = 350 | Back information, alignment and structure |
|---|
| >d1rkxa_ c.2.1.2 (A:) CDP-glucose-4,6-dehydratase {Yersinia pseudotuberculosis [TaxId: 633]} Length = 356 | Back information, alignment and structure |
|---|
| >d1rpna_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Pseudomonas aeruginosa [TaxId: 287]} Length = 321 | Back information, alignment and structure |
|---|
| >d1n7ha_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 339 | Back information, alignment and structure |
|---|
| >d1qyda_ c.2.1.2 (A:) Pinoresinol-lariciresinol reductase {Giant arborvitae (Thuja plicata) [TaxId: 3316]} Length = 312 | Back information, alignment and structure |
|---|
| >d1t2aa_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Human (Homo sapiens) [TaxId: 9606]} Length = 347 | Back information, alignment and structure |
|---|
| >d1db3a_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Escherichia coli [TaxId: 562]} Length = 357 | Back information, alignment and structure |
|---|
| >d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]} Length = 205 | Back information, alignment and structure |
|---|
| >d1qyca_ c.2.1.2 (A:) Phenylcoumaran benzylic ether reductase {Loblolly pine (Pinus taeda) [TaxId: 3352]} Length = 307 | Back information, alignment and structure |
|---|
| >d1oc2a_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} Length = 346 | Back information, alignment and structure |
|---|
| >d1z45a2 c.2.1.2 (A:11-357) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 347 | Back information, alignment and structure |
|---|
| >d1sb8a_ c.2.1.2 (A:) UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomonas aeruginosa [TaxId: 287]} Length = 341 | Back information, alignment and structure |
|---|
| >d1i24a_ c.2.1.2 (A:) Sulfolipid biosynthesis protein SQD1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 393 | Back information, alignment and structure |
|---|
| >d2q46a1 c.2.1.2 (A:2-253) Hypothetical protein At5g02240 (T7H20_290) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 252 | Back information, alignment and structure |
|---|
| >d2c5aa1 c.2.1.2 (A:13-375) GDP-mannose-3', 5'-epimerase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 363 | Back information, alignment and structure |
|---|
| >d2blla1 c.2.1.2 (A:316-657) Polymyxin resistance protein ArnA (PrmI) {Escherichia coli [TaxId: 562]} Length = 342 | Back information, alignment and structure |
|---|
| >d2a35a1 c.2.1.2 (A:4-215) Hypothetical protein PA4017 {Pseudomonas aeruginosa [TaxId: 287]} Length = 212 | Back information, alignment and structure |
|---|
| >d1eq2a_ c.2.1.2 (A:) ADP-L-glycero-D-mannoheptose 6-epimerase {Escherichia coli [TaxId: 562]} Length = 307 | Back information, alignment and structure |
|---|
| >d1kewa_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} Length = 361 | Back information, alignment and structure |
|---|
| >d1ek6a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Human (Homo sapiens) [TaxId: 9606]} Length = 346 | Back information, alignment and structure |
|---|
| >d2b69a1 c.2.1.2 (A:4-315) UDP-glucuronate decarboxylase 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 312 | Back information, alignment and structure |
|---|
| >d1orra_ c.2.1.2 (A:) CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 90370]} Length = 338 | Back information, alignment and structure |
|---|
| >d1udca_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Escherichia coli [TaxId: 562]} Length = 338 | Back information, alignment and structure |
|---|
| >d2bkaa1 c.2.1.2 (A:5-236) TAT-interacting protein TIP30 {Human (Homo sapiens) [TaxId: 9606]} Length = 232 | Back information, alignment and structure |
|---|
| >d1vl0a_ c.2.1.2 (A:) DTDP-4-dehydrorhamnose reductase RfbD {Clostridium acetobutylicum [TaxId: 1488]} Length = 281 | Back information, alignment and structure |
|---|
| >d1r6da_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptomyces venezuelae [TaxId: 54571]} Length = 322 | Back information, alignment and structure |
|---|
| >d1e6ua_ c.2.1.2 (A:) GDP-4-keto-6-deoxy-d-mannose epimerase/reductase (GDP-fucose synthetase) {Escherichia coli [TaxId: 562]} Length = 315 | Back information, alignment and structure |
|---|
| >d1n2sa_ c.2.1.2 (A:) dTDP-6-deoxy-L-lyxo-4-hexulose reductase (RmlD) {Salmonella enterica serovar typhimurium [TaxId: 90371]} Length = 298 | Back information, alignment and structure |
|---|
| >d1sbya1 c.2.1.2 (A:1-254) Drosophila alcohol dehydrogenase {Fly (Drosophila lebanonensis) [TaxId: 7225]} Length = 254 | Back information, alignment and structure |
|---|
| >d1gy8a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Trypanosoma brucei [TaxId: 5691]} Length = 383 | Back information, alignment and structure |
|---|
| >d1zk4a1 c.2.1.2 (A:1-251) R-specific alcohol dehydrogenase {Lactobacillus brevis [TaxId: 1580]} Length = 251 | Back information, alignment and structure |
|---|
| >d2bgka1 c.2.1.2 (A:11-278) Rhizome secoisolariciresinol dehydrogenase {Mayapple (Podophyllum peltatum) [TaxId: 35933]} Length = 268 | Back information, alignment and structure |
|---|
| >d1uzma1 c.2.1.2 (A:9-245) beta-keto acyl carrier protein reductase {Mycobacterium tuberculosis [TaxId: 1773]} Length = 237 | Back information, alignment and structure |
|---|
| >d2o23a1 c.2.1.2 (A:6-253) Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Length = 248 | Back information, alignment and structure |
|---|
| >d1h5qa_ c.2.1.2 (A:) Mannitol dehydrogenase {Mushroom (Agaricus bisporus) [TaxId: 5341]} Length = 260 | Back information, alignment and structure |
|---|
| >d1xu9a_ c.2.1.2 (A:) 11-beta-hydroxysteroid dehydrogenase 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 269 | Back information, alignment and structure |
|---|
| >d1xhla_ c.2.1.2 (A:) Hypothetical protein F25D1.5 {Caenorhabditis elegans [TaxId: 6239]} Length = 274 | Back information, alignment and structure |
|---|
| >d1xg5a_ c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC4172) {Human (Homo sapiens) [TaxId: 9606]} Length = 257 | Back information, alignment and structure |
|---|
| >d1q7ba_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Escherichia coli [TaxId: 562]} Length = 243 | Back information, alignment and structure |
|---|
| >d1xkqa_ c.2.1.2 (A:) Hypothetical protein R05D8.7 {Caenorhabditis elegans [TaxId: 6239]} Length = 272 | Back information, alignment and structure |
|---|
| >d1k2wa_ c.2.1.2 (A:) Sorbitol dehydrogenase {Rhodobacter sphaeroides [TaxId: 1063]} Length = 256 | Back information, alignment and structure |
|---|
| >d1spxa_ c.2.1.2 (A:) Glucose dehydrogenase (5l265) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 264 | Back information, alignment and structure |
|---|
| >d1geea_ c.2.1.2 (A:) Glucose dehydrogenase {Bacillus megaterium [TaxId: 1404]} Length = 261 | Back information, alignment and structure |
|---|
| >d1g0oa_ c.2.1.2 (A:) 1,3,8-trihydroxynaphtalene reductase (THNR, naphtol reductase) {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Length = 272 | Back information, alignment and structure |
|---|
| >d1fmca_ c.2.1.2 (A:) 7-alpha-hydroxysteroid dehydrogenase {Escherichia coli [TaxId: 562]} Length = 255 | Back information, alignment and structure |
|---|
| >d1gz6a_ c.2.1.2 (A:) (3R)-hydroxyacyl-CoA dehydrogenase domain of estradiol 17 beta-Dehydrogenase 4 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 302 | Back information, alignment and structure |
|---|
| >d1pr9a_ c.2.1.2 (A:) Carbonyl reductase {Human (Homo sapiens) [TaxId: 9606]} Length = 244 | Back information, alignment and structure |
|---|
| >d1dhra_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 236 | Back information, alignment and structure |
|---|
| >d1zema1 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconobacter oxydans [TaxId: 442]} Length = 260 | Back information, alignment and structure |
|---|
| >d1ulsa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermus thermophilus [TaxId: 274]} Length = 242 | Back information, alignment and structure |
|---|
| >d1bdba_ c.2.1.2 (A:) Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Pseudomonas sp., lb400 [TaxId: 306]} Length = 276 | Back information, alignment and structure |
|---|
| >d1cyda_ c.2.1.2 (A:) Carbonyl reductase {Mouse (Mus musculus) [TaxId: 10090]} Length = 242 | Back information, alignment and structure |
|---|
| >d2ag5a1 c.2.1.2 (A:1-245) Dehydrogenase/reductase SDR family member 6, DHRS6 {Human (Homo sapiens) [TaxId: 9606]} Length = 245 | Back information, alignment and structure |
|---|
| >d1xq1a_ c.2.1.2 (A:) Tropinone reductase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 259 | Back information, alignment and structure |
|---|
| >d1o5ia_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermotoga maritima [TaxId: 2336]} Length = 234 | Back information, alignment and structure |
|---|
| >d1vl8a_ c.2.1.2 (A:) Gluconate 5-dehydrogenase {Thermotoga maritima [TaxId: 2336]} Length = 251 | Back information, alignment and structure |
|---|
| >d1ydea1 c.2.1.2 (A:4-253) Retinal dehydrogenase/reductase 3 {Human (Homo sapiens) [TaxId: 9606]} Length = 250 | Back information, alignment and structure |
|---|
| >d2ae2a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), II [TaxId: 4076]} Length = 259 | Back information, alignment and structure |
|---|
| >d1ae1a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), I [TaxId: 4076]} Length = 258 | Back information, alignment and structure |
|---|
| >d1ja9a_ c.2.1.2 (A:) 1,3,6,8-tetrahydroxynaphthalene reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Length = 259 | Back information, alignment and structure |
|---|
| >d1yxma1 c.2.1.2 (A:7-303) Peroxisomal trans 2-enoyl CoA reductase {Human (Homo sapiens) [TaxId: 9606]} Length = 297 | Back information, alignment and structure |
|---|
| >d1iy8a_ c.2.1.2 (A:) Levodione reductase {Corynebacterium aquaticum [TaxId: 144185]} Length = 258 | Back information, alignment and structure |
|---|
| >d2a4ka1 c.2.1.2 (A:2-242) beta-keto acyl carrier protein reductase {Thermus thermophilus, TTHB020 [TaxId: 274]} Length = 241 | Back information, alignment and structure |
|---|
| >d1nffa_ c.2.1.2 (A:) Putative oxidoreductase Rv2002 {Mycobacterium tuberculosis [TaxId: 1773]} Length = 244 | Back information, alignment and structure |
|---|
| >d1yb1a_ c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase type XI {Human (Homo sapiens) [TaxId: 9606]} Length = 244 | Back information, alignment and structure |
|---|
| >d1w6ua_ c.2.1.2 (A:) 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {Human (Homo sapiens), [TaxId: 9606]} Length = 294 | Back information, alignment and structure |
|---|
| >d1hxha_ c.2.1.2 (A:) 3beta/17beta hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Length = 253 | Back information, alignment and structure |
|---|
| >d2c07a1 c.2.1.2 (A:54-304) beta-keto acyl carrier protein reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Length = 251 | Back information, alignment and structure |
|---|
| >d1yo6a1 c.2.1.2 (A:1-250) Putative carbonyl reductase sniffer {Caenorhabditis elegans [TaxId: 6239]} Length = 250 | Back information, alignment and structure |
|---|
| >d1x1ta1 c.2.1.2 (A:1-260) D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas fragi [TaxId: 296]} Length = 260 | Back information, alignment and structure |
|---|
| >d2gdza1 c.2.1.2 (A:3-256) 15-hydroxyprostaglandin dehydrogenase, PGDH {Human (Homo sapiens) [TaxId: 9606]} Length = 254 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 64 | |||
| d1fmca_ | 255 | 7-alpha-hydroxysteroid dehydrogenase {Escherichia | 99.6 | |
| d2ae2a_ | 259 | Tropinone reductase {Jimsonweed (Datura stramonium | 99.59 | |
| d1h5qa_ | 260 | Mannitol dehydrogenase {Mushroom (Agaricus bisporu | 99.59 | |
| d1ae1a_ | 258 | Tropinone reductase {Jimsonweed (Datura stramonium | 99.58 | |
| d2c07a1 | 251 | beta-keto acyl carrier protein reductase {Malaria | 99.57 | |
| d1yb1a_ | 244 | 17-beta-hydroxysteroid dehydrogenase type XI {Huma | 99.57 | |
| d1xq1a_ | 259 | Tropinone reductase {Thale cress (Arabidopsis thal | 99.56 | |
| d1k2wa_ | 256 | Sorbitol dehydrogenase {Rhodobacter sphaeroides [T | 99.55 | |
| d1zema1 | 260 | Xylitol dehydrogenase {Gluconobacter oxydans [TaxI | 99.54 | |
| d1sbya1 | 254 | Drosophila alcohol dehydrogenase {Fly (Drosophila | 99.53 | |
| d1cyda_ | 242 | Carbonyl reductase {Mouse (Mus musculus) [TaxId: 1 | 99.52 | |
| d1xkqa_ | 272 | Hypothetical protein R05D8.7 {Caenorhabditis elega | 99.52 | |
| d1g0oa_ | 272 | 1,3,8-trihydroxynaphtalene reductase (THNR, naphto | 99.52 | |
| d1vl8a_ | 251 | Gluconate 5-dehydrogenase {Thermotoga maritima [Ta | 99.52 | |
| d1geea_ | 261 | Glucose dehydrogenase {Bacillus megaterium [TaxId: | 99.52 | |
| d1xg5a_ | 257 | Putative dehydrogenase ARPG836 (MGC4172) {Human (H | 99.52 | |
| d1bdba_ | 276 | Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Ps | 99.52 | |
| d2rhca1 | 257 | beta-keto acyl carrier protein reductase {Streptom | 99.51 | |
| d1rpna_ | 321 | GDP-mannose 4,6-dehydratase {Pseudomonas aeruginos | 99.51 | |
| d1ja9a_ | 259 | 1,3,6,8-tetrahydroxynaphthalene reductase {Rice bl | 99.51 | |
| d1spxa_ | 264 | Glucose dehydrogenase (5l265) {Nematode (Caenorhab | 99.51 | |
| d1pr9a_ | 244 | Carbonyl reductase {Human (Homo sapiens) [TaxId: 9 | 99.5 | |
| d1xhla_ | 274 | Hypothetical protein F25D1.5 {Caenorhabditis elega | 99.5 | |
| d1ulsa_ | 242 | beta-keto acyl carrier protein reductase {Thermus | 99.5 | |
| d2ew8a1 | 247 | (s)-1-phenylethanol dehydrogenase {Azoarcus sp. eb | 99.49 | |
| d1rkxa_ | 356 | CDP-glucose-4,6-dehydratase {Yersinia pseudotuberc | 99.49 | |
| d1gega_ | 255 | meso-2,3-butanediol dehydrogenase {Klebsiella pneu | 99.49 | |
| d1snya_ | 248 | Carbonyl reductase sniffer {Fruit fly (Drosophila | 99.49 | |
| d2gdza1 | 254 | 15-hydroxyprostaglandin dehydrogenase, PGDH {Human | 99.48 | |
| d1zk4a1 | 251 | R-specific alcohol dehydrogenase {Lactobacillus br | 99.48 | |
| d1w6ua_ | 294 | 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {H | 99.47 | |
| d1iy8a_ | 258 | Levodione reductase {Corynebacterium aquaticum [Ta | 99.47 | |
| d2bgka1 | 268 | Rhizome secoisolariciresinol dehydrogenase {Mayapp | 99.47 | |
| d1hdca_ | 254 | 3-alpha,20-beta-hydroxysteroid dehydrogenase {Stre | 99.47 | |
| d1nffa_ | 244 | Putative oxidoreductase Rv2002 {Mycobacterium tube | 99.45 | |
| d1q7ba_ | 243 | beta-keto acyl carrier protein reductase {Escheric | 99.45 | |
| d2o23a1 | 248 | Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Ho | 99.44 | |
| d1yxma1 | 297 | Peroxisomal trans 2-enoyl CoA reductase {Human (Ho | 99.44 | |
| d1hdoa_ | 205 | Biliverdin IX beta reductase {Human (Homo sapiens) | 99.43 | |
| d2a4ka1 | 241 | beta-keto acyl carrier protein reductase {Thermus | 99.43 | |
| d1x1ta1 | 260 | D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas | 99.43 | |
| d1xu9a_ | 269 | 11-beta-hydroxysteroid dehydrogenase 1 {Human (Hom | 99.42 | |
| d1orra_ | 338 | CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: | 99.42 | |
| d1ydea1 | 250 | Retinal dehydrogenase/reductase 3 {Human (Homo sap | 99.42 | |
| d1ulua_ | 256 | Enoyl-ACP reductase {Thermus thermophilus [TaxId: | 99.41 | |
| d1yo6a1 | 250 | Putative carbonyl reductase sniffer {Caenorhabditi | 99.39 | |
| d1udca_ | 338 | Uridine diphosphogalactose-4-epimerase (UDP-galact | 99.39 | |
| d1oaaa_ | 259 | Sepiapterin reductase {Mouse (Mus musculus) [TaxId | 99.39 | |
| d1wmaa1 | 275 | Carbonyl reductase/20beta-hydroxysteroid dehydroge | 99.39 | |
| d1t2aa_ | 347 | GDP-mannose 4,6-dehydratase {Human (Homo sapiens) | 99.39 | |
| d1hxha_ | 253 | 3beta/17beta hydroxysteroid dehydrogenase {Comamon | 99.38 | |
| d1ek6a_ | 346 | Uridine diphosphogalactose-4-epimerase (UDP-galact | 99.38 | |
| d1uzma1 | 237 | beta-keto acyl carrier protein reductase {Mycobact | 99.37 | |
| d1edoa_ | 244 | beta-keto acyl carrier protein reductase {Oil seed | 99.37 | |
| d1y1pa1 | 342 | Aldehyde reductase II {Sporobolomyces salmonicolor | 99.36 | |
| d1n7ha_ | 339 | GDP-mannose 4,6-dehydratase {Thale-cress (Arabidop | 99.36 | |
| d1xgka_ | 350 | Negative transcriptional regulator NmrA {Aspergill | 99.36 | |
| d2ag5a1 | 245 | Dehydrogenase/reductase SDR family member 6, DHRS6 | 99.35 | |
| d1db3a_ | 357 | GDP-mannose 4,6-dehydratase {Escherichia coli [Tax | 99.35 | |
| d1qyda_ | 312 | Pinoresinol-lariciresinol reductase {Giant arborvi | 99.34 | |
| d2fr1a1 | 259 | Erythromycin synthase, eryAI, 1st ketoreductase mo | 99.33 | |
| d1kewa_ | 361 | dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus | 99.33 | |
| d1o5ia_ | 234 | beta-keto acyl carrier protein reductase {Thermoto | 99.33 | |
| d2bd0a1 | 240 | Bacterial sepiapterin reductase {Chlorobium tepidu | 99.33 | |
| d1luaa1 | 191 | Methylene-tetrahydromethanopterin dehydrogenase {M | 99.33 | |
| d2d1ya1 | 248 | Hypothetical protein TTHA0369 {Thermus thermophilu | 99.33 | |
| d1qyca_ | 307 | Phenylcoumaran benzylic ether reductase {Loblolly | 99.32 | |
| d1oc2a_ | 346 | dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus | 99.32 | |
| d2pd4a1 | 274 | Enoyl-ACP reductase {Helicobacter pylori [TaxId: 2 | 99.32 | |
| d2c5aa1 | 363 | GDP-mannose-3', 5'-epimerase {Thale cress (Arabido | 99.31 | |
| d1z45a2 | 347 | Uridine diphosphogalactose-4-epimerase (UDP-galact | 99.3 | |
| d2blla1 | 342 | Polymyxin resistance protein ArnA (PrmI) {Escheric | 99.3 | |
| d1i24a_ | 393 | Sulfolipid biosynthesis protein SQD1 {Thale cress | 99.3 | |
| d1sb8a_ | 341 | UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomo | 99.27 | |
| d1qsga_ | 258 | Enoyl-ACP reductase {Escherichia coli [TaxId: 562] | 99.26 | |
| d1jtva_ | 285 | Human estrogenic 17beta-hydroxysteroid dehydrogena | 99.2 | |
| d2b69a1 | 312 | UDP-glucuronate decarboxylase 1 {Human (Homo sapie | 99.2 | |
| d1gz6a_ | 302 | (3R)-hydroxyacyl-CoA dehydrogenase domain of estra | 99.19 | |
| d2h7ma1 | 268 | Enoyl-ACP reductase {Mycobacterium tuberculosis, T | 99.18 | |
| d1uaya_ | 241 | Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus t | 99.18 | |
| d2q46a1 | 252 | Hypothetical protein At5g02240 (T7H20_290) {Thale | 99.18 | |
| d1mxha_ | 266 | Dihydropteridin reductase (pteridine reductase) {T | 99.17 | |
| d1fjha_ | 257 | 3-alpha-hydroxysteroid dehydrogenase {Comamonas te | 99.16 | |
| d2bkaa1 | 232 | TAT-interacting protein TIP30 {Human (Homo sapiens | 99.14 | |
| d1ooea_ | 235 | Dihydropteridin reductase (pteridine reductase) {N | 99.12 | |
| d1e7wa_ | 284 | Dihydropteridin reductase (pteridine reductase) {L | 99.12 | |
| d1dhra_ | 236 | Dihydropteridin reductase (pteridine reductase) {R | 99.11 | |
| d1vl0a_ | 281 | DTDP-4-dehydrorhamnose reductase RfbD {Clostridium | 99.1 | |
| d1r6da_ | 322 | dTDP-glucose 4,6-dehydratase (RmlB) {Streptomyces | 99.06 | |
| d1d7oa_ | 297 | Enoyl-ACP reductase {Oil seed rape (Brassica napus | 99.06 | |
| d1jaya_ | 212 | Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archae | 99.02 | |
| d2a35a1 | 212 | Hypothetical protein PA4017 {Pseudomonas aeruginos | 98.98 | |
| d1gy8a_ | 383 | Uridine diphosphogalactose-4-epimerase (UDP-galact | 98.96 | |
| d1e6ua_ | 315 | GDP-4-keto-6-deoxy-d-mannose epimerase/reductase ( | 98.93 | |
| d1zmta1 | 252 | Halohydrin dehalogenase HheC {Agrobacterium tumefa | 98.79 | |
| d1eq2a_ | 307 | ADP-L-glycero-D-mannoheptose 6-epimerase {Escheric | 98.75 | |
| d1n2sa_ | 298 | dTDP-6-deoxy-L-lyxo-4-hexulose reductase (RmlD) {S | 98.66 | |
| d1e5qa1 | 182 | Saccharopine reductase {Rice blast fungus (Magnapo | 98.57 | |
| d1lssa_ | 132 | Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax | 98.57 | |
| d1uh5a_ | 329 | Enoyl-ACP reductase {Malaria parasite (Plasmodium | 98.52 | |
| d2pv7a2 | 152 | Prephenate dehydrogenase TyrA {Haemophilus influen | 98.48 | |
| d1o8ca2 | 77 | Hypothetical protein YhdH {Escherichia coli [TaxId | 98.46 | |
| d1ks9a2 | 167 | Ketopantoate reductase PanE {Escherichia coli [Tax | 98.27 | |
| d2jfga1 | 93 | UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase | 98.06 | |
| d2hmva1 | 134 | Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} | 98.02 | |
| d1f0ya2 | 192 | Short chain L-3-hydroxyacyl CoA dehydrogenase {Hum | 97.94 | |
| d1tt7a2 | 167 | Hypothetical protein YhfP {Bacillus subtilis [TaxI | 97.93 | |
| d1iz0a2 | 171 | Quinone oxidoreductase {Thermus thermophilus [TaxI | 97.91 | |
| d1nyta1 | 170 | Shikimate 5-dehydrogenase AroE {Escherichia coli [ | 97.9 | |
| d1xa0a2 | 176 | B. subtilis YhfP homologue {Bacillus stearothermop | 97.9 | |
| d1o89a2 | 177 | Hypothetical protein YhdH {Escherichia coli [TaxId | 97.9 | |
| d1yb5a2 | 174 | Quinone oxidoreductase {Human (Homo sapiens) [TaxI | 97.85 | |
| d1bg6a2 | 184 | N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A | 97.79 | |
| d1v3va2 | 182 | Leukotriene b4 12-hydroxydehydrogenase/prostagland | 97.77 | |
| d2f1ka2 | 165 | Prephenate dehydrogenase TyrA {Synechocystis sp. p | 97.77 | |
| d1id1a_ | 153 | Rck domain from putative potassium channel Kch {Es | 97.71 | |
| d1pqwa_ | 183 | Putative enoyl reductase domain of polyketide synt | 97.67 | |
| d1qora2 | 179 | Quinone oxidoreductase {Escherichia coli [TaxId: 5 | 97.65 | |
| d1piwa2 | 168 | Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas | 97.54 | |
| d1wdka3 | 186 | Fatty oxidation complex alpha subunit, middle doma | 97.54 | |
| d1c0pa1 | 268 | D-aminoacid oxidase, N-terminal domain {Rhodotorul | 97.53 | |
| d1p77a1 | 171 | Shikimate 5-dehydrogenase AroE {Haemophilus influe | 97.51 | |
| d1txga2 | 180 | Glycerol-3- phosphate dehydrogenase {Archaeoglobus | 97.51 | |
| d1pzga1 | 154 | Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5 | 97.49 | |
| d1pjqa1 | 113 | Siroheme synthase CysG, domain 1 {Salmonella typhi | 97.48 | |
| d1ez4a1 | 146 | Lactate dehydrogenase {Lactobacillus pentosus [Tax | 97.48 | |
| d1n1ea2 | 189 | Glycerol-3- phosphate dehydrogenase {Trypanosome ( | 97.47 | |
| d1kyqa1 | 150 | Bifunctional dehydrogenase/ferrochelatase Met8p, N | 97.46 | |
| d1hyea1 | 145 | MJ0490, lactate/malate dehydrogenase {Archaeon Met | 97.45 | |
| d1vi2a1 | 182 | Putative shikimate dehydrogenase YdiB {Escherichia | 97.4 | |
| d2cvoa1 | 183 | Putative semialdehyde dehydrogenase {Rice (Oryza s | 97.34 | |
| d2g17a1 | 179 | N-acetyl-gamma-glutamyl-phosphate reductase ArgC { | 97.34 | |
| d1gpja2 | 159 | Glutamyl tRNA-reductase middle domain {Archaeon Me | 97.33 | |
| d2pgda2 | 176 | 6-phosphogluconate dehydrogenase {Sheep (Ovis orie | 97.31 | |
| d1npya1 | 167 | Shikimate 5-dehydrogenase-like protein HI0607 {Hae | 97.29 | |
| d1llua2 | 166 | Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax | 97.27 | |
| d1vpda2 | 161 | Hydroxyisobutyrate dehydrogenase {Salmonella typhi | 97.27 | |
| d1vj0a2 | 182 | Hypothetical protein TM0436 {Thermotoga maritima [ | 97.26 | |
| d3cuma2 | 162 | Hydroxyisobutyrate dehydrogenase {Pseudomonas aeru | 97.25 | |
| d1vm6a3 | 128 | Dihydrodipicolinate reductase {Thermotoga maritima | 97.24 | |
| d1guza1 | 142 | Malate dehydrogenase {Chlorobium vibrioforme [TaxI | 97.23 | |
| d1uufa2 | 168 | Hypothetical protein YahK {Escherichia coli [TaxId | 97.23 | |
| d1t4ba1 | 146 | Aspartate beta-semialdehyde dehydrogenase {Escheri | 97.21 | |
| d1e3ja2 | 170 | Ketose reductase (sorbitol dehydrogenase) {Silverl | 97.2 | |
| d2hjsa1 | 144 | Usg-1 protein homolog PA3116 {Pseudomonas aerugino | 97.2 | |
| d1mv8a2 | 202 | GDP-mannose 6-dehydrogenase {Pseudomonas aeruginos | 97.19 | |
| d1v59a2 | 122 | Dihydrolipoamide dehydrogenase {Baker's yeast (Sac | 97.18 | |
| d1c1da1 | 201 | Phenylalanine dehydrogenase {Rhodococcus sp., M4 [ | 97.17 | |
| d1pgja2 | 178 | 6-phosphogluconate dehydrogenase {Trypanosoma bruc | 97.17 | |
| d1ebda2 | 117 | Dihydrolipoamide dehydrogenase {Bacillus stearothe | 97.13 | |
| d1vkna1 | 176 | N-acetyl-gamma-glutamyl-phosphate reductase ArgC { | 97.11 | |
| d1yqga2 | 152 | Pyrroline-5-carboxylate reductase ProC {Neisseria | 97.11 | |
| d1djqa2 | 156 | Trimethylamine dehydrogenase, C-terminal domain {M | 97.07 | |
| d1ldna1 | 148 | Lactate dehydrogenase {Bacillus stearothermophilus | 97.07 | |
| d1i36a2 | 152 | Conserved hypothetical protein MTH1747 {Archaeon M | 97.06 | |
| d1r0ka2 | 150 | 1-deoxy-D-xylulose-5-phosphate reductoisomerase {Z | 97.05 | |
| d1gu7a2 | 189 | 2,4-dienoyl-CoA reductase {Yeast (Candida tropical | 97.03 | |
| d1mb4a1 | 147 | Aspartate beta-semialdehyde dehydrogenase {Vibrio | 97.02 | |
| d1ihua2 | 279 | Arsenite-translocating ATPase ArsA {Escherichia co | 96.99 | |
| d3lada2 | 119 | Dihydrolipoamide dehydrogenase {Azotobacter vinela | 96.95 | |
| d7mdha1 | 175 | Malate dehydrogenase {Sorghum (Sorghum vulgare), c | 96.94 | |
| d1y7ta1 | 154 | Malate dehydrogenase {Thermus thermophilus [TaxId: | 96.93 | |
| d1pl8a2 | 171 | Ketose reductase (sorbitol dehydrogenase) {Human ( | 96.93 | |
| d1y6ja1 | 142 | Lactate dehydrogenase {Clostridium thermocellum [T | 96.93 | |
| d1h6va2 | 122 | Mammalian thioredoxin reductase {Rat (Rattus norve | 96.91 | |
| d1mlda1 | 144 | Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 | 96.91 | |
| d2gz1a1 | 154 | Aspartate beta-semialdehyde dehydrogenase {Strepto | 96.91 | |
| d2g5ca2 | 171 | Prephenate dehydrogenase TyrA {Aquifex aeolicus [T | 96.86 | |
| d1jvba2 | 170 | Alcohol dehydrogenase {Archaeon Sulfolobus solfata | 96.85 | |
| d2ivda1 | 347 | Protoporphyrinogen oxidase {Myxococcus xanthus [Ta | 96.83 | |
| d1gesa2 | 116 | Glutathione reductase {Escherichia coli [TaxId: 56 | 96.8 | |
| d1dxla2 | 123 | Dihydrolipoamide dehydrogenase {Garden pea (Pisum | 96.79 | |
| d1ps9a3 | 179 | 2,4-dienoyl-CoA reductase, middle domain {Escheric | 96.76 | |
| d2voua1 | 265 | Dihydroxypyridine hydroxylase DhpH {Arthrobacter n | 96.75 | |
| d1cp2a_ | 269 | Nitrogenase iron protein {Clostridium pasteurianum | 96.74 | |
| d3grsa2 | 125 | Glutathione reductase {Human (Homo sapiens) [TaxId | 96.74 | |
| d2jhfa2 | 176 | Alcohol dehydrogenase {Horse (Equus caballus) [Tax | 96.73 | |
| d1onfa2 | 117 | Glutathione reductase {Plasmodium falciparum [TaxI | 96.72 | |
| d1vj1a2 | 187 | Putative zinc-binding alcohol dehydrogenase {Mouse | 96.69 | |
| d1nhpa2 | 123 | NADH peroxidase {Enterococcus faecalis [TaxId: 135 | 96.69 | |
| d1d7ya2 | 121 | NADH-dependent ferredoxin reductase, BphA4 {Pseudo | 96.68 | |
| d1d1ta2 | 176 | Alcohol dehydrogenase {Human (Homo sapiens), diffe | 96.68 | |
| d1lvla2 | 115 | Dihydrolipoamide dehydrogenase {Pseudomonas putida | 96.67 | |
| d2cmda1 | 145 | Malate dehydrogenase {Escherichia coli [TaxId: 562 | 96.66 | |
| d1hyha1 | 146 | L-2-hydroxyisocapronate dehydrogenase, L-HICDH {La | 96.65 | |
| d1j6ua1 | 89 | UDP-N-acetylmuramate-alanine ligase MurC {Thermoto | 96.64 | |
| d1rjwa2 | 168 | Alcohol dehydrogenase {Bacillus stearothermophilus | 96.63 | |
| d2bcgg1 | 297 | Guanine nucleotide dissociation inhibitor, GDI {Ba | 96.62 | |
| d1p3da1 | 96 | UDP-N-acetylmuramate-alanine ligase MurC {Haemophi | 96.58 | |
| d2ldxa1 | 159 | Lactate dehydrogenase {Mouse (Mus musculus) [TaxId | 96.57 | |
| d1q0qa2 | 151 | 1-deoxy-D-xylulose-5-phosphate reductoisomerase {E | 96.56 | |
| d5mdha1 | 154 | Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 | 96.56 | |
| d1a5za1 | 140 | Lactate dehydrogenase {Thermotoga maritima [TaxId: | 96.55 | |
| d1u7za_ | 223 | Coenzyme A biosynthesis bifunctional protein CoaBC | 96.54 | |
| d1seza1 | 373 | Protoporphyrinogen oxidase {Tobacco (Nicotiana tab | 96.53 | |
| d1ojta2 | 125 | Dihydrolipoamide dehydrogenase {Neisseria meningit | 96.51 | |
| d2bi7a1 | 314 | UDP-galactopyranose mutase, N-terminal domain {Kle | 96.5 | |
| d1kjqa2 | 111 | Glycinamide ribonucleotide transformylase PurT, N- | 96.49 | |
| d1ryia1 | 276 | Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} | 96.47 | |
| d1gtea4 | 196 | Dihydropyrimidine dehydrogenase, domain 2 {Pig (Su | 96.46 | |
| d1xhca2 | 122 | NADH oxidase /nitrite reductase {Pyrococcus furios | 96.45 | |
| d1uxja1 | 142 | Malate dehydrogenase {Chloroflexus aurantiacus [Ta | 96.45 | |
| d1ojua1 | 142 | Malate dehydrogenase {Archaeon Archaeoglobus fulgi | 96.44 | |
| d1g3qa_ | 237 | Cell division regulator MinD {Archaeon Pyrococcus | 96.42 | |
| d1p0fa2 | 174 | Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: | 96.41 | |
| d2iida1 | 370 | L-aminoacid oxidase {Malayan pit viper (Calloselas | 96.4 | |
| d1o6za1 | 142 | Malate dehydrogenase {Archaeon Haloarcula marismor | 96.38 | |
| d1d5ta1 | 336 | Guanine nucleotide dissociation inhibitor, GDI {Co | 96.37 | |
| d1q1ra2 | 133 | Putidaredoxin reductase {Pseudomonas putida [TaxId | 96.36 | |
| d2ahra2 | 152 | Pyrroline-5-carboxylate reductase ProC {Streptococ | 96.35 | |
| d1li4a1 | 163 | S-adenosylhomocystein hydrolase {Human (Homo sapie | 96.32 | |
| d1dlja2 | 196 | UDP-glucose dehydrogenase (UDPGDH) {Streptococcus | 96.31 | |
| d1byia_ | 224 | Dethiobiotin synthetase {Escherichia coli [TaxId: | 96.31 | |
| d1llda1 | 143 | Lactate dehydrogenase {Bifidobacterium longum, str | 96.31 | |
| d1jw9b_ | 247 | Molybdenum cofactor biosynthesis protein MoeB {Esc | 96.31 | |
| d1jqba2 | 174 | Bacterial secondary alcohol dehydrogenase {Clostri | 96.27 | |
| d1a4ia1 | 170 | Methylenetetrahydrofolate dehydrogenase/cyclohydro | 96.26 | |
| d1t2da1 | 150 | Lactate dehydrogenase {Malaria parasite (Plasmodiu | 96.23 | |
| d1f0ka_ | 351 | Peptidoglycan biosynthesis glycosyltransferase Mur | 96.23 | |
| d1b0aa1 | 166 | Methylenetetrahydrofolate dehydrogenase/cyclohydro | 96.23 | |
| d1p9oa_ | 290 | Phosphopantothenoylcysteine synthetase {Human (Hom | 96.19 | |
| d1nvta1 | 177 | Shikimate 5-dehydrogenase AroE {Archaeon Methanoco | 96.16 | |
| d1qp8a1 | 181 | Putative formate dehydrogenase {Archaeon Pyrobacul | 96.16 | |
| d1yl7a1 | 135 | Dihydrodipicolinate reductase {Mycobacterium tuber | 96.12 | |
| d1edza1 | 171 | Methylenetetrahydrofolate dehydrogenase/cyclohydro | 96.09 | |
| d1mo9a2 | 121 | NADH-dependent 2-ketopropyl coenzyme M oxidoreduct | 96.06 | |
| d1v9la1 | 242 | Glutamate dehydrogenase {Pyrobaculum islandicum [T | 96.06 | |
| d1hyqa_ | 232 | Cell division regulator MinD {Archaeon Archaeoglob | 96.06 | |
| d1k0ia1 | 292 | p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas a | 96.0 | |
| d1a9xa3 | 127 | Carbamoyl phosphate synthetase (CPS), large subuni | 95.91 | |
| d1e3ia2 | 174 | Alcohol dehydrogenase {Mouse (Mus musculus), class | 95.86 | |
| d1hwxa1 | 293 | Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: | 95.83 | |
| d1leha1 | 230 | Leucine dehydrogenase {Bacillus sphaericus [TaxId: | 95.81 | |
| d1i0za1 | 160 | Lactate dehydrogenase {Human (Homo sapiens), heart | 95.8 | |
| d2fzwa2 | 176 | Alcohol dehydrogenase {Human (Homo sapiens), diffe | 95.8 | |
| d2dw4a2 | 449 | Lysine-specific histone demethylase 1, LSD1 {Human | 95.77 | |
| d1bgva1 | 255 | Glutamate dehydrogenase {Clostridium symbiosum [Ta | 95.77 | |
| d1djqa3 | 233 | Trimethylamine dehydrogenase, middle domain {Methy | 95.76 | |
| d1pj5a2 | 305 | N,N-dimethylglycine oxidase {Arthrobacter globifor | 95.75 | |
| d1f8fa2 | 174 | Benzyl alcohol dehydrogenase {Acinetobacter calcoa | 95.74 | |
| d1diha1 | 162 | Dihydrodipicolinate reductase {Escherichia coli [T | 95.67 | |
| d2afhe1 | 289 | Nitrogenase iron protein {Azotobacter vinelandii [ | 95.65 | |
| d1dxya1 | 199 | D-2-hydroxyisocaproate dehydrogenase {Lactobacillu | 95.65 | |
| d2fy8a1 | 129 | Potassium channel-related protein MthK {Archaeon M | 95.63 | |
| d1a9xa4 | 121 | Carbamoyl phosphate synthetase (CPS), large subuni | 95.6 | |
| d1kola2 | 195 | Formaldehyde dehydrogenase {Pseudomonas putida [Ta | 95.54 | |
| d1j4aa1 | 197 | D-lactate dehydrogenase {Lactobacillus helveticus | 95.48 | |
| d1h2ba2 | 172 | Alcohol dehydrogenase {Archaeon Aeropyrum pernix [ | 95.35 | |
| d1mx3a1 | 193 | Transcription corepressor CtbP {Human (Homo sapien | 95.28 | |
| d2gf3a1 | 281 | Sarcosine oxidase {Bacillus sp., strain b0618 [Tax | 95.25 | |
| d1yovb1 | 426 | UBA3 {Human (Homo sapiens) [TaxId: 9606]} | 95.25 | |
| d3c96a1 | 288 | Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: | 95.19 | |
| d2gv8a1 | 335 | Flavin-dependent monoxygenase SPBP16F5.08c {Schizo | 95.12 | |
| d2d59a1 | 139 | Hypothetical protein PH1109 {Pyrococcus horikoshii | 95.08 | |
| d1cdoa2 | 175 | Alcohol dehydrogenase {Cod (Gadus callarias) [TaxI | 95.02 | |
| d1ihua1 | 296 | Arsenite-translocating ATPase ArsA {Escherichia co | 95.0 | |
| d1ygya1 | 184 | Phosphoglycerate dehydrogenase {Mycobacterium tube | 95.0 | |
| d2f5va1 | 379 | Pyranose 2-oxidase {White-rot fungus (Peniophora s | 94.93 | |
| d1fcda1 | 186 | Flavocytochrome c sulfide dehydrogenase, FCSD, fla | 94.78 | |
| d1i8ta1 | 298 | UDP-galactopyranose mutase, N-terminal domain {Esc | 94.64 | |
| d1b5qa1 | 347 | Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} | 94.63 | |
| d2bisa1 | 437 | Glycogen synthase 1, GlgA {Pyrococcus abyssi [TaxI | 94.49 | |
| d2gqfa1 | 253 | Hypothetical protein HI0933 {Haemophilus influenza | 94.46 | |
| d1aoga2 | 117 | Trypanothione reductase {Trypanosoma cruzi [TaxId: | 94.43 | |
| d1y81a1 | 116 | Hypothetical protein PF0725 {Pyrococcus furiosus [ | 94.42 | |
| d1m6ya2 | 192 | TM0872, methyltransferase domain {Thermotoga marit | 94.36 | |
| d1gesa1 | 217 | Glutathione reductase {Escherichia coli [TaxId: 56 | 94.3 | |
| d1rp0a1 | 278 | Thiazole biosynthetic enzyme Thi4 {Thale cress(Ara | 94.27 | |
| d2naca1 | 188 | Formate dehydrogenase {Pseudomonas sp., strain 101 | 94.15 | |
| d1sc6a1 | 188 | Phosphoglycerate dehydrogenase {Escherichia coli [ | 93.89 | |
| d1y8ca_ | 246 | Putative methyltransferase CAC2371 {Clostridium ac | 93.86 | |
| d1q1ra1 | 185 | Putidaredoxin reductase {Pseudomonas putida [TaxId | 93.77 | |
| d2v5za1 | 383 | Monoamine oxidase B {Human (Homo sapiens) [TaxId: | 93.7 | |
| d1d7ya1 | 183 | NADH-dependent ferredoxin reductase, BphA4 {Pseudo | 93.68 | |
| d1nhpa1 | 198 | NADH peroxidase {Enterococcus faecalis [TaxId: 135 | 93.67 | |
| d1cjca2 | 230 | Adrenodoxin reductase of mitochondrial p450 system | 93.58 | |
| d1pjza_ | 201 | Thiopurine S-methyltransferase {Pseudomonas syring | 93.43 | |
| d1vdca1 | 192 | Thioredoxin reductase {Mouse-ear cress (Arabidopsi | 93.24 | |
| d2i0za1 | 251 | Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396] | 93.12 | |
| d1gtma1 | 239 | Glutamate dehydrogenase {Archaeon Pyrococcus furio | 93.02 | |
| d1gdha1 | 191 | D-glycerate dehydrogenase {Hyphomicrobium methylov | 92.92 | |
| d1v8ba1 | 163 | S-adenosylhomocystein hydrolase {Plasmodium falcip | 92.9 | |
| d1dxla1 | 221 | Dihydrolipoamide dehydrogenase {Garden pea (Pisum | 92.89 | |
| d1yova1 | 529 | Amyloid beta precursor protein-binding protein 1, | 92.87 | |
| d1wzna1 | 251 | Hypothetical methyltransferase PH1305 {Archaeon Py | 92.8 | |
| d1pn0a1 | 360 | Phenol hydroxylase {Soil-living yeast (Trichosporo | 92.67 | |
| d3grsa1 | 221 | Glutathione reductase {Human (Homo sapiens) [TaxId | 92.63 | |
| d1n4wa1 | 367 | Cholesterol oxidase of GMC family {Streptomyces sp | 92.63 | |
| d1b26a1 | 234 | Glutamate dehydrogenase {Thermotoga maritima [TaxI | 92.59 | |
| d2fyta1 | 311 | Protein arginine N-methyltransferase 3, PRMT3 {Hum | 92.58 | |
| d1kifa1 | 246 | D-aminoacid oxidase, N-terminal domain {Pig (Sus s | 92.41 | |
| d2blna2 | 203 | Polymyxin resistance protein ArnA, N-terminal doma | 92.37 | |
| d1w4xa1 | 298 | Phenylacetone monooxygenase {Thermobifida fusca [T | 92.21 | |
| d1y0pa2 | 308 | Flavocytochrome c3 (respiratory fumarate reductase | 92.18 | |
| d1ve3a1 | 226 | Hypothetical protein PH0226 {Archaeon Pyrococcus h | 92.03 | |
| d2cvza2 | 156 | Hydroxyisobutyrate dehydrogenase {Thermus thermoph | 92.02 | |
| d1f06a1 | 170 | Diaminopimelic acid dehydrogenase (DAPDH) {Coryneb | 92.01 | |
| d1rzua_ | 477 | Glycogen synthase 1, GlgA {Agrobacterium tumefacie | 91.95 | |
| d1pn3a_ | 391 | TDP-epi-vancosaminyltransferase GtfA {Amycolatopsi | 91.89 | |
| d2i76a2 | 153 | Hypothetical protein TM1727 {Thermotoga maritima [ | 91.86 | |
| d2csua1 | 129 | Acetate-CoA ligase alpha chain, AcdA, N-terminal d | 91.81 | |
| d1lqta2 | 239 | Ferredoxin:NADP reductase FprA {Mycobacterium tube | 91.55 | |
| d2bw0a2 | 203 | 10-formyltetrahydrofolate dehydrogenase domain 1 { | 91.11 | |
| d1oria_ | 316 | Protein arginine N-methyltransferase 1, PRMT1 {Rat | 91.08 | |
| d1trba1 | 190 | Thioredoxin reductase {Escherichia coli [TaxId: 56 | 91.08 | |
| d3etja2 | 78 | N5-carboxyaminoimidazole ribonucleotide synthetase | 91.08 | |
| d1v59a1 | 233 | Dihydrolipoamide dehydrogenase {Baker's yeast (Sac | 90.92 | |
| d2gv8a2 | 107 | Flavin-dependent monoxygenase SPBP16F5.08c {Schizo | 90.89 | |
| d1d4ca2 | 322 | Flavocytochrome c3 (respiratory fumarate reductase | 90.59 | |
| d1iuka_ | 136 | Hypothetical protein TT1466 {Thermus thermophilus | 90.59 | |
| d1iira_ | 401 | UDP-glucosyltransferase GtfB {Amycolatopsis orient | 90.43 | |
| d2i3ba1 | 189 | Cancer-related NTPase, C1orf57 {Human (Homo sapien | 90.29 | |
| d2bzga1 | 229 | Thiopurine S-methyltransferase {Human (Homo sapien | 90.25 | |
| d1pvva2 | 163 | Ornithine transcarbamoylase {Archaeon Pyrococcus f | 89.97 | |
| d1fl2a2 | 126 | Alkyl hydroperoxide reductase subunit F (AhpF), C- | 89.84 | |
| d1rrva_ | 401 | TDP-vancosaminyltransferase GftD {Amycolatopsis or | 89.8 | |
| d1m6ia2 | 137 | Apoptosis-inducing factor (AIF) {Human (Homo sapie | 89.8 | |
| d3coxa1 | 370 | Cholesterol oxidase of GMC family {Brevibacterium | 89.72 | |
| d1ebda1 | 223 | Dihydrolipoamide dehydrogenase {Bacillus stearothe | 89.69 | |
| d1feca2 | 117 | Trypanothione reductase {Crithidia fasciculata [Ta | 89.62 | |
| d1iowa1 | 96 | D-Ala-D-Ala ligase, N-domain {Escherichia coli, ge | 89.59 | |
| d1jg1a_ | 215 | Protein-L-isoaspartyl O-methyltransferase {Archaeo | 89.57 | |
| d1lvla1 | 220 | Dihydrolipoamide dehydrogenase {Pseudomonas putida | 89.49 | |
| d3lada1 | 229 | Dihydrolipoamide dehydrogenase {Azotobacter vinela | 89.48 | |
| d2gh1a1 | 281 | Methyltransferase BC2162 {Bacillus cereus [TaxId: | 89.36 | |
| d1xhca1 | 167 | NADH oxidase /nitrite reductase {Pyrococcus furios | 89.33 | |
| d1nvmb1 | 157 | Acetaldehyde dehydrogenase (acylating) {Pseudomona | 89.32 | |
| d2gmha1 | 380 | Electron transfer flavoprotein-ubiquinone oxidored | 89.31 | |
| d1vdca2 | 130 | Thioredoxin reductase {Mouse-ear cress (Arabidopsi | 89.3 | |
| d1mo9a1 | 261 | NADH-dependent 2-ketopropyl coenzyme M oxidoreduct | 89.21 | |
| d2nu7a1 | 119 | Succinyl-CoA synthetase, alpha-chain, N-terminal ( | 89.14 | |
| d1l7da1 | 183 | Nicotinamide nucleotide transhydrogenase dI compon | 89.12 | |
| d1vl5a_ | 231 | Hypothetical protein BH2331 {Bacillus halodurans [ | 88.96 | |
| d2bs2a2 | 336 | Fumarate reductase {Wolinella succinogenes [TaxId: | 88.83 | |
| d1yb2a1 | 250 | Hypothetical protein Ta0852 {Thermoplasma acidophi | 88.81 | |
| d2cl5a1 | 214 | Catechol O-methyltransferase, COMT {Rat (Rattus no | 88.76 | |
| d1pjca1 | 168 | L-alanine dehydrogenase {Phormidium lapideum [TaxI | 88.63 | |
| d1ojta1 | 229 | Dihydrolipoamide dehydrogenase {Neisseria meningit | 88.55 | |
| d2esra1 | 152 | Putative methyltransferase SPy1538 {Streptococcus | 88.51 | |
| d2nxca1 | 254 | PrmA-like protein TTHA0656 (TT0836) {Thermus therm | 88.42 | |
| d1trba2 | 126 | Thioredoxin reductase {Escherichia coli [TaxId: 56 | 88.42 | |
| d2b3ta1 | 274 | N5-glutamine methyltransferase, HemK {Escherichia | 88.33 | |
| d2igta1 | 309 | Putative methyltransferase Atu0340 {Agrobacterium | 87.98 | |
| d1nt2a_ | 209 | Fibrillarin homologue {Archaeon Archaeoglobus fulg | 87.79 | |
| d2i6ga1 | 198 | Putative methyltransferase TehB {Salmonella typhim | 87.47 | |
| d2dt5a2 | 126 | Transcriptional repressor Rex, C-terminal domain { | 87.33 | |
| d1tqha_ | 242 | Carboxylesterase Est {Bacillus stearothermophilus | 87.11 | |
| d1h6va1 | 235 | Mammalian thioredoxin reductase {Rat (Rattus norve | 87.06 | |
| d1qo8a2 | 317 | Flavocytochrome c3 (respiratory fumarate reductase | 86.95 | |
| d1dl5a1 | 213 | Protein-L-isoaspartyl O-methyltransferase {Thermot | 86.82 | |
| d1onfa1 | 259 | Glutathione reductase {Plasmodium falciparum [TaxI | 86.65 | |
| d1dusa_ | 194 | Hypothetical protein MJ0882 {Archaeon Methanococcu | 86.14 | |
| d1fl2a1 | 184 | Alkyl hydroperoxide reductase subunit F (AhpF), C- | 86.1 | |
| d1xkla_ | 258 | Salicylic acid-binding protein 2 (SABP2) {Common t | 85.94 | |
| d1euca1 | 130 | Succinyl-CoA synthetase, alpha-chain, N-terminal ( | 85.59 | |
| d1fmta2 | 206 | Methionyl-tRNAfmet formyltransferase {Escherichia | 85.47 | |
| d1k92a1 | 188 | Argininosuccinate synthetase, N-terminal domain {E | 85.34 | |
| d1ps9a2 | 162 | 2,4-dienoyl-CoA reductase, C-terminal domain {Esch | 84.91 | |
| d1kdga1 | 360 | Flavoprotein domain of flavocytochrome cellobiose | 84.82 | |
| d1l3ia_ | 186 | Precorrin-6Y methyltransferase (CbiT) {Archaeon Me | 84.75 | |
| d1imja_ | 208 | Ccg1/TafII250-interacting factor B (Cib) {Human (H | 84.63 | |
| d1p3y1_ | 183 | MrsD {Bacillus sp. hil-y85/54728 [TaxId: 69002]} | 84.22 | |
| d1p5ja_ | 319 | L-serine dehydratase {Human (Homo sapiens) [TaxId: | 84.21 | |
| d1jbqa_ | 355 | Cystathionine beta-synthase {Human (Homo sapiens) | 84.0 | |
| d1vjta1 | 193 | Putative alpha-glucosidase TM0752 {Thermotoga mari | 83.94 | |
| d1i1na_ | 224 | Protein-L-isoaspartyl O-methyltransferase {Human ( | 83.63 | |
| d1j20a1 | 165 | Argininosuccinate synthetase, N-terminal domain {T | 83.59 | |
| d1b7go1 | 178 | Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { | 83.23 | |
| d1m6ia1 | 213 | Apoptosis-inducing factor (AIF) {Human (Homo sapie | 82.89 | |
| d1oi7a1 | 121 | Succinyl-CoA synthetase, alpha-chain, N-terminal ( | 82.88 | |
| d1ri5a_ | 252 | mRNA cap (Guanine N-7) methyltransferase {Fungus ( | 82.83 | |
| d3c70a1 | 256 | Hydroxynitrile lyase {Rubber tree (Hevea brasilien | 82.69 | |
| d2iw1a1 | 370 | Lipopolysaccharide core biosynthesis protein RfaG | 82.69 | |
| d1w4xa2 | 235 | Phenylacetone monooxygenase {Thermobifida fusca [T | 82.55 | |
| d1vkza2 | 90 | Glycinamide ribonucleotide synthetase (GAR-syn), N | 82.36 | |
| d2bhsa1 | 292 | O-acetylserine sulfhydrylase (Cysteine synthase) { | 82.3 | |
| d1g6q1_ | 328 | Arginine methyltransferase, HMT1 {Baker's yeast (S | 82.15 | |
| d1xxla_ | 234 | Hypothetical protein YcgJ {Bacillus subtilis [TaxI | 81.74 | |
| d1neka2 | 330 | Succinate dehydogenase {Escherichia coli [TaxId: 5 | 81.17 | |
| d3bswa1 | 193 | Acetyltransferase PglD {Campylobacter jejuni [TaxI | 81.06 | |
| d1gpea1 | 391 | Glucose oxidase {Penicillium amagasakiense [TaxId: | 80.96 | |
| d1im8a_ | 225 | Hypothetical protein HI0319 (YecO) {Haemophilus in | 80.7 | |
| d1wg8a2 | 182 | TM0872, methyltransferase domain {Thermus thermoph | 80.28 | |
| d1np6a_ | 170 | Molybdopterin-guanine dinucleotide biosynthesis pr | 80.15 | |
| d1nkva_ | 245 | Hypothetical Protein YjhP {Escherichia coli [TaxId | 80.03 | |
| d2fhpa1 | 182 | Putative methylase EF2452 {Enterococcus faecalis [ | 80.03 |
| >d1fmca_ c.2.1.2 (A:) 7-alpha-hydroxysteroid dehydrogenase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: NAD(P)-binding Rossmann-fold domains superfamily: NAD(P)-binding Rossmann-fold domains family: Tyrosine-dependent oxidoreductases domain: 7-alpha-hydroxysteroid dehydrogenase species: Escherichia coli [TaxId: 562]
Probab=99.60 E-value=6.1e-16 Score=78.50 Aligned_cols=63 Identities=13% Similarity=0.104 Sum_probs=51.6
Q ss_pred CCCCCeEEEEecCcchHHHHHHHHHHHCCCEEEEEEeCCCCcchhHHhhhcCCCCceEEEEccC
Q 036468 1 MSGKGKVVCVTGASGFIASWLVKLLLQRSYTVKATVRDLNNHNAEHLLTLDGAEERLHLFKANS 64 (64)
Q Consensus 1 ~~~~~~~~~i~g~~~~ig~~~~~~l~~~~~~v~~~~r~~~~~~~~~~~~~~~~~~~~~~~~~Di 64 (64)
|.+++++++|||++++||+++++.|+++|++|++.+|+.++.+ +..+++...+.++..+++|+
T Consensus 7 m~L~gK~alITGas~GIG~aia~~la~~Ga~V~~~~r~~~~~~-~~~~~l~~~g~~~~~~~~Dv 69 (255)
T d1fmca_ 7 LRLDGKCAIITGAGAGIGKEIAITFATAGASVVVSDINADAAN-HVVDEIQQLGGQAFACRCDI 69 (255)
T ss_dssp GCCTTCEEEETTTTSHHHHHHHHHHHTTTCEEEEEESCHHHHH-HHHHHHHHTTCCEEEEECCT
T ss_pred CCCCCCEEEEeCCCcHHHHHHHHHHHHCCCEEEEEECCHHHHH-HHHHHHHHcCCcEEEEEccC
Confidence 3457899999999999999999999999999999999776554 34444544467888999986
|
| >d2ae2a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), II [TaxId: 4076]} | Back information, alignment and structure |
|---|
| >d1h5qa_ c.2.1.2 (A:) Mannitol dehydrogenase {Mushroom (Agaricus bisporus) [TaxId: 5341]} | Back information, alignment and structure |
|---|
| >d1ae1a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), I [TaxId: 4076]} | Back information, alignment and structure |
|---|
| >d2c07a1 c.2.1.2 (A:54-304) beta-keto acyl carrier protein reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1yb1a_ c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase type XI {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xq1a_ c.2.1.2 (A:) Tropinone reductase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1k2wa_ c.2.1.2 (A:) Sorbitol dehydrogenase {Rhodobacter sphaeroides [TaxId: 1063]} | Back information, alignment and structure |
|---|
| >d1zema1 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconobacter oxydans [TaxId: 442]} | Back information, alignment and structure |
|---|
| >d1sbya1 c.2.1.2 (A:1-254) Drosophila alcohol dehydrogenase {Fly (Drosophila lebanonensis) [TaxId: 7225]} | Back information, alignment and structure |
|---|
| >d1cyda_ c.2.1.2 (A:) Carbonyl reductase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1xkqa_ c.2.1.2 (A:) Hypothetical protein R05D8.7 {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1g0oa_ c.2.1.2 (A:) 1,3,8-trihydroxynaphtalene reductase (THNR, naphtol reductase) {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} | Back information, alignment and structure |
|---|
| >d1vl8a_ c.2.1.2 (A:) Gluconate 5-dehydrogenase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1geea_ c.2.1.2 (A:) Glucose dehydrogenase {Bacillus megaterium [TaxId: 1404]} | Back information, alignment and structure |
|---|
| >d1xg5a_ c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC4172) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bdba_ c.2.1.2 (A:) Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Pseudomonas sp., lb400 [TaxId: 306]} | Back information, alignment and structure |
|---|
| >d2rhca1 c.2.1.2 (A:5-261) beta-keto acyl carrier protein reductase {Streptomyces coelicolor [TaxId: 1902]} | Back information, alignment and structure |
|---|
| >d1rpna_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1ja9a_ c.2.1.2 (A:) 1,3,6,8-tetrahydroxynaphthalene reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} | Back information, alignment and structure |
|---|
| >d1spxa_ c.2.1.2 (A:) Glucose dehydrogenase (5l265) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1pr9a_ c.2.1.2 (A:) Carbonyl reductase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xhla_ c.2.1.2 (A:) Hypothetical protein F25D1.5 {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1ulsa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2ew8a1 c.2.1.2 (A:3-249) (s)-1-phenylethanol dehydrogenase {Azoarcus sp. ebn1 [TaxId: 76114]} | Back information, alignment and structure |
|---|
| >d1rkxa_ c.2.1.2 (A:) CDP-glucose-4,6-dehydratase {Yersinia pseudotuberculosis [TaxId: 633]} | Back information, alignment and structure |
|---|
| >d1gega_ c.2.1.2 (A:) meso-2,3-butanediol dehydrogenase {Klebsiella pneumoniae [TaxId: 573]} | Back information, alignment and structure |
|---|
| >d1snya_ c.2.1.2 (A:) Carbonyl reductase sniffer {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d2gdza1 c.2.1.2 (A:3-256) 15-hydroxyprostaglandin dehydrogenase, PGDH {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zk4a1 c.2.1.2 (A:1-251) R-specific alcohol dehydrogenase {Lactobacillus brevis [TaxId: 1580]} | Back information, alignment and structure |
|---|
| >d1w6ua_ c.2.1.2 (A:) 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {Human (Homo sapiens), [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1iy8a_ c.2.1.2 (A:) Levodione reductase {Corynebacterium aquaticum [TaxId: 144185]} | Back information, alignment and structure |
|---|
| >d2bgka1 c.2.1.2 (A:11-278) Rhizome secoisolariciresinol dehydrogenase {Mayapple (Podophyllum peltatum) [TaxId: 35933]} | Back information, alignment and structure |
|---|
| >d1hdca_ c.2.1.2 (A:) 3-alpha,20-beta-hydroxysteroid dehydrogenase {Streptomyces hydrogenans [TaxId: 1905]} | Back information, alignment and structure |
|---|
| >d1nffa_ c.2.1.2 (A:) Putative oxidoreductase Rv2002 {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1q7ba_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2o23a1 c.2.1.2 (A:6-253) Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1yxma1 c.2.1.2 (A:7-303) Peroxisomal trans 2-enoyl CoA reductase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2a4ka1 c.2.1.2 (A:2-242) beta-keto acyl carrier protein reductase {Thermus thermophilus, TTHB020 [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1x1ta1 c.2.1.2 (A:1-260) D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas fragi [TaxId: 296]} | Back information, alignment and structure |
|---|
| >d1xu9a_ c.2.1.2 (A:) 11-beta-hydroxysteroid dehydrogenase 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1orra_ c.2.1.2 (A:) CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 90370]} | Back information, alignment and structure |
|---|
| >d1ydea1 c.2.1.2 (A:4-253) Retinal dehydrogenase/reductase 3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ulua_ c.2.1.2 (A:) Enoyl-ACP reductase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1yo6a1 c.2.1.2 (A:1-250) Putative carbonyl reductase sniffer {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1udca_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1oaaa_ c.2.1.2 (A:) Sepiapterin reductase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wmaa1 c.2.1.2 (A:2-276) Carbonyl reductase/20beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1t2aa_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hxha_ c.2.1.2 (A:) 3beta/17beta hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} | Back information, alignment and structure |
|---|
| >d1ek6a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uzma1 c.2.1.2 (A:9-245) beta-keto acyl carrier protein reductase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1edoa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} | Back information, alignment and structure |
|---|
| >d1y1pa1 c.2.1.2 (A:2-343) Aldehyde reductase II {Sporobolomyces salmonicolor [TaxId: 5005]} | Back information, alignment and structure |
|---|
| >d1n7ha_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1xgka_ c.2.1.2 (A:) Negative transcriptional regulator NmrA {Aspergillus nidulans [TaxId: 162425]} | Back information, alignment and structure |
|---|
| >d2ag5a1 c.2.1.2 (A:1-245) Dehydrogenase/reductase SDR family member 6, DHRS6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1db3a_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1qyda_ c.2.1.2 (A:) Pinoresinol-lariciresinol reductase {Giant arborvitae (Thuja plicata) [TaxId: 3316]} | Back information, alignment and structure |
|---|
| >d2fr1a1 c.2.1.2 (A:1657-1915) Erythromycin synthase, eryAI, 1st ketoreductase module {Saccharopolyspora erythraea [TaxId: 1836]} | Back information, alignment and structure |
|---|
| >d1kewa_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} | Back information, alignment and structure |
|---|
| >d1o5ia_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2bd0a1 c.2.1.2 (A:2-241) Bacterial sepiapterin reductase {Chlorobium tepidum [TaxId: 1097]} | Back information, alignment and structure |
|---|
| >d1luaa1 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]} | Back information, alignment and structure |
|---|
| >d2d1ya1 c.2.1.2 (A:2-249) Hypothetical protein TTHA0369 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1qyca_ c.2.1.2 (A:) Phenylcoumaran benzylic ether reductase {Loblolly pine (Pinus taeda) [TaxId: 3352]} | Back information, alignment and structure |
|---|
| >d1oc2a_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} | Back information, alignment and structure |
|---|
| >d2pd4a1 c.2.1.2 (A:2-275) Enoyl-ACP reductase {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d2c5aa1 c.2.1.2 (A:13-375) GDP-mannose-3', 5'-epimerase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1z45a2 c.2.1.2 (A:11-357) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2blla1 c.2.1.2 (A:316-657) Polymyxin resistance protein ArnA (PrmI) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1i24a_ c.2.1.2 (A:) Sulfolipid biosynthesis protein SQD1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1sb8a_ c.2.1.2 (A:) UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1qsga_ c.2.1.2 (A:) Enoyl-ACP reductase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1jtva_ c.2.1.2 (A:) Human estrogenic 17beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2b69a1 c.2.1.2 (A:4-315) UDP-glucuronate decarboxylase 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gz6a_ c.2.1.2 (A:) (3R)-hydroxyacyl-CoA dehydrogenase domain of estradiol 17 beta-Dehydrogenase 4 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2h7ma1 c.2.1.2 (A:2-269) Enoyl-ACP reductase {Mycobacterium tuberculosis, TB, gene InhA [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1uaya_ c.2.1.2 (A:) Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2q46a1 c.2.1.2 (A:2-253) Hypothetical protein At5g02240 (T7H20_290) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1mxha_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Trypanosoma cruzi [TaxId: 5693]} | Back information, alignment and structure |
|---|
| >d1fjha_ c.2.1.2 (A:) 3-alpha-hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} | Back information, alignment and structure |
|---|
| >d2bkaa1 c.2.1.2 (A:5-236) TAT-interacting protein TIP30 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ooea_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1e7wa_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Leishmania major [TaxId: 5664]} | Back information, alignment and structure |
|---|
| >d1dhra_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1vl0a_ c.2.1.2 (A:) DTDP-4-dehydrorhamnose reductase RfbD {Clostridium acetobutylicum [TaxId: 1488]} | Back information, alignment and structure |
|---|
| >d1r6da_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptomyces venezuelae [TaxId: 54571]} | Back information, alignment and structure |
|---|
| >d1d7oa_ c.2.1.2 (A:) Enoyl-ACP reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} | Back information, alignment and structure |
|---|
| >d1jaya_ c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d2a35a1 c.2.1.2 (A:4-215) Hypothetical protein PA4017 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1gy8a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Trypanosoma brucei [TaxId: 5691]} | Back information, alignment and structure |
|---|
| >d1e6ua_ c.2.1.2 (A:) GDP-4-keto-6-deoxy-d-mannose epimerase/reductase (GDP-fucose synthetase) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1zmta1 c.2.1.2 (A:2-253) Halohydrin dehalogenase HheC {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1eq2a_ c.2.1.2 (A:) ADP-L-glycero-D-mannoheptose 6-epimerase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1n2sa_ c.2.1.2 (A:) dTDP-6-deoxy-L-lyxo-4-hexulose reductase (RmlD) {Salmonella enterica serovar typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} | Back information, alignment and structure |
|---|
| >d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1uh5a_ c.2.1.2 (A:) Enoyl-ACP reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d2pv7a2 c.2.1.6 (A:92-243) Prephenate dehydrogenase TyrA {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1o8ca2 c.2.1.1 (A:116-192) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ks9a2 c.2.1.6 (A:1-167) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1f0ya2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tt7a2 c.2.1.1 (A:128-294) Hypothetical protein YhfP {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1iz0a2 c.2.1.1 (A:99-269) Quinone oxidoreductase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1nyta1 c.2.1.7 (A:102-271) Shikimate 5-dehydrogenase AroE {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1xa0a2 c.2.1.1 (A:119-294) B. subtilis YhfP homologue {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1o89a2 c.2.1.1 (A:116-292) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1yb5a2 c.2.1.1 (A:121-294) Quinone oxidoreductase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} | Back information, alignment and structure |
|---|
| >d1v3va2 c.2.1.1 (A:113-294) Leukotriene b4 12-hydroxydehydrogenase/prostaglandin 15-keto reductase {Guinea pig (Cavia porcellus) [TaxId: 10141]} | Back information, alignment and structure |
|---|
| >d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} | Back information, alignment and structure |
|---|
| >d1id1a_ c.2.1.9 (A:) Rck domain from putative potassium channel Kch {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1pqwa_ c.2.1.1 (A:) Putative enoyl reductase domain of polyketide synthase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1qora2 c.2.1.1 (A:113-291) Quinone oxidoreductase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1wdka3 c.2.1.6 (A:311-496) Fatty oxidation complex alpha subunit, middle domain {Pseudomonas fragi [TaxId: 296]} | Back information, alignment and structure |
|---|
| >d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]} | Back information, alignment and structure |
|---|
| >d1p77a1 c.2.1.7 (A:102-272) Shikimate 5-dehydrogenase AroE {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1txga2 c.2.1.6 (A:1-180) Glycerol-3- phosphate dehydrogenase {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1pzga1 c.2.1.5 (A:14-163) Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5811]} | Back information, alignment and structure |
|---|
| >d1pjqa1 c.2.1.11 (A:1-113) Siroheme synthase CysG, domain 1 {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1ez4a1 c.2.1.5 (A:16-162) Lactate dehydrogenase {Lactobacillus pentosus [TaxId: 1589]} | Back information, alignment and structure |
|---|
| >d1n1ea2 c.2.1.6 (A:9-197) Glycerol-3- phosphate dehydrogenase {Trypanosome (Leishmania mexicana) [TaxId: 5665]} | Back information, alignment and structure |
|---|
| >d1kyqa1 c.2.1.11 (A:1-150) Bifunctional dehydrogenase/ferrochelatase Met8p, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1hyea1 c.2.1.5 (A:1-145) MJ0490, lactate/malate dehydrogenase {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1vi2a1 c.2.1.7 (A:107-288) Putative shikimate dehydrogenase YdiB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2cvoa1 c.2.1.3 (A:68-218,A:384-415) Putative semialdehyde dehydrogenase {Rice (Oryza sativa) [TaxId: 4530]} | Back information, alignment and structure |
|---|
| >d2g17a1 c.2.1.3 (A:1-153,A:309-334) N-acetyl-gamma-glutamyl-phosphate reductase ArgC {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1gpja2 c.2.1.7 (A:144-302) Glutamyl tRNA-reductase middle domain {Archaeon Methanopyrus kandleri [TaxId: 2320]} | Back information, alignment and structure |
|---|
| >d2pgda2 c.2.1.6 (A:1-176) 6-phosphogluconate dehydrogenase {Sheep (Ovis orientalis aries) [TaxId: 9940]} | Back information, alignment and structure |
|---|
| >d1npya1 c.2.1.7 (A:103-269) Shikimate 5-dehydrogenase-like protein HI0607 {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1llua2 c.2.1.1 (A:144-309) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1vpda2 c.2.1.6 (A:3-163) Hydroxyisobutyrate dehydrogenase {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d3cuma2 c.2.1.6 (A:1-162) Hydroxyisobutyrate dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1vm6a3 c.2.1.3 (A:1-96,A:183-214) Dihydrodipicolinate reductase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1guza1 c.2.1.5 (A:1-142) Malate dehydrogenase {Chlorobium vibrioforme [TaxId: 1098]} | Back information, alignment and structure |
|---|
| >d1uufa2 c.2.1.1 (A:145-312) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1t4ba1 c.2.1.3 (A:1-133,A:355-367) Aspartate beta-semialdehyde dehydrogenase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} | Back information, alignment and structure |
|---|
| >d2hjsa1 c.2.1.3 (A:3-129,A:320-336) Usg-1 protein homolog PA3116 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1mv8a2 c.2.1.6 (A:1-202) GDP-mannose 6-dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1c1da1 c.2.1.7 (A:149-349) Phenylalanine dehydrogenase {Rhodococcus sp., M4 [TaxId: 1831]} | Back information, alignment and structure |
|---|
| >d1pgja2 c.2.1.6 (A:1-178) 6-phosphogluconate dehydrogenase {Trypanosoma brucei [TaxId: 5691]} | Back information, alignment and structure |
|---|
| >d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1vkna1 c.2.1.3 (A:1-144,A:308-339) N-acetyl-gamma-glutamyl-phosphate reductase ArgC {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1yqga2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Neisseria meningitidis, serogroup B [TaxId: 487]} | Back information, alignment and structure |
|---|
| >d1djqa2 c.3.1.1 (A:490-645) Trimethylamine dehydrogenase, C-terminal domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} | Back information, alignment and structure |
|---|
| >d1ldna1 c.2.1.5 (A:15-162) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1i36a2 c.2.1.6 (A:1-152) Conserved hypothetical protein MTH1747 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1r0ka2 c.2.1.3 (A:3-126,A:265-290) 1-deoxy-D-xylulose-5-phosphate reductoisomerase {Zymomonas mobilis [TaxId: 542]} | Back information, alignment and structure |
|---|
| >d1gu7a2 c.2.1.1 (A:161-349) 2,4-dienoyl-CoA reductase {Yeast (Candida tropicalis) [TaxId: 5482]} | Back information, alignment and structure |
|---|
| >d1mb4a1 c.2.1.3 (A:1-132,A:355-369) Aspartate beta-semialdehyde dehydrogenase {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d1ihua2 c.37.1.10 (A:308-586) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} | Back information, alignment and structure |
|---|
| >d7mdha1 c.2.1.5 (A:23-197) Malate dehydrogenase {Sorghum (Sorghum vulgare), chloroplast [TaxId: 4558]} | Back information, alignment and structure |
|---|
| >d1y7ta1 c.2.1.5 (A:0-153) Malate dehydrogenase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1y6ja1 c.2.1.5 (A:7-148) Lactate dehydrogenase {Clostridium thermocellum [TaxId: 1515]} | Back information, alignment and structure |
|---|
| >d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1mlda1 c.2.1.5 (A:1-144) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d2gz1a1 c.2.1.3 (A:2-127,A:330-357) Aspartate beta-semialdehyde dehydrogenase {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d2g5ca2 c.2.1.6 (A:30-200) Prephenate dehydrogenase TyrA {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1jvba2 c.2.1.1 (A:144-313) Alcohol dehydrogenase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} | Back information, alignment and structure |
|---|
| >d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1dxla2 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} | Back information, alignment and structure |
|---|
| >d1ps9a3 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA reductase, middle domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} | Back information, alignment and structure |
|---|
| >d1cp2a_ c.37.1.10 (A:) Nitrogenase iron protein {Clostridium pasteurianum [TaxId: 1501]} | Back information, alignment and structure |
|---|
| >d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2jhfa2 c.2.1.1 (A:164-339) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]} | Back information, alignment and structure |
|---|
| >d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1vj1a2 c.2.1.1 (A:125-311) Putative zinc-binding alcohol dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} | Back information, alignment and structure |
|---|
| >d1d1ta2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d2cmda1 c.2.1.5 (A:1-145) Malate dehydrogenase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1hyha1 c.2.1.5 (A:21-166) L-2-hydroxyisocapronate dehydrogenase, L-HICDH {Lactobacillus confusus [TaxId: 1583]} | Back information, alignment and structure |
|---|
| >d1j6ua1 c.5.1.1 (A:0-88) UDP-N-acetylmuramate-alanine ligase MurC {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1rjwa2 c.2.1.1 (A:138-305) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1p3da1 c.5.1.1 (A:11-106) UDP-N-acetylmuramate-alanine ligase MurC {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d2ldxa1 c.2.1.5 (A:1-159) Lactate dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1q0qa2 c.2.1.3 (A:1-125,A:275-300) 1-deoxy-D-xylulose-5-phosphate reductoisomerase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d5mdha1 c.2.1.5 (A:1-154) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1a5za1 c.2.1.5 (A:22-163) Lactate dehydrogenase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1u7za_ c.72.3.1 (A:) Coenzyme A biosynthesis bifunctional protein CoaBC, phosphopantothenoylcysteine synthase domain (CoaB) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} | Back information, alignment and structure |
|---|
| >d1ojta2 c.3.1.5 (A:276-400) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} | Back information, alignment and structure |
|---|
| >d2bi7a1 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mutase, N-terminal domain {Klebsiella pneumoniae [TaxId: 573]} | Back information, alignment and structure |
|---|
| >d1kjqa2 c.30.1.1 (A:2-112) Glycinamide ribonucleotide transformylase PurT, N-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} | Back information, alignment and structure |
|---|
| >d1gtea4 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1uxja1 c.2.1.5 (A:2-143) Malate dehydrogenase {Chloroflexus aurantiacus [TaxId: 1108]} | Back information, alignment and structure |
|---|
| >d1ojua1 c.2.1.5 (A:22-163) Malate dehydrogenase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1g3qa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1p0fa2 c.2.1.1 (A:1164-1337) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]} | Back information, alignment and structure |
|---|
| >d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} | Back information, alignment and structure |
|---|
| >d1o6za1 c.2.1.5 (A:22-162) Malate dehydrogenase {Archaeon Haloarcula marismortui [TaxId: 2238]} | Back information, alignment and structure |
|---|
| >d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d2ahra2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d1li4a1 c.2.1.4 (A:190-352) S-adenosylhomocystein hydrolase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dlja2 c.2.1.6 (A:1-196) UDP-glucose dehydrogenase (UDPGDH) {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d1byia_ c.37.1.10 (A:) Dethiobiotin synthetase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1llda1 c.2.1.5 (A:7-149) Lactate dehydrogenase {Bifidobacterium longum, strain am101-2 [TaxId: 216816]} | Back information, alignment and structure |
|---|
| >d1jw9b_ c.111.1.1 (B:) Molybdenum cofactor biosynthesis protein MoeB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} | Back information, alignment and structure |
|---|
| >d1a4ia1 c.2.1.7 (A:127-296) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1t2da1 c.2.1.5 (A:1-150) Lactate dehydrogenase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1f0ka_ c.87.1.2 (A:) Peptidoglycan biosynthesis glycosyltransferase MurG {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1b0aa1 c.2.1.7 (A:123-288) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1p9oa_ c.72.3.1 (A:) Phosphopantothenoylcysteine synthetase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nvta1 c.2.1.7 (A:111-287) Shikimate 5-dehydrogenase AroE {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1qp8a1 c.2.1.4 (A:83-263) Putative formate dehydrogenase {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} | Back information, alignment and structure |
|---|
| >d1yl7a1 c.2.1.3 (A:2-105,A:215-245) Dihydrodipicolinate reductase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1edza1 c.2.1.7 (A:149-319) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1mo9a2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} | Back information, alignment and structure |
|---|
| >d1v9la1 c.2.1.7 (A:180-421) Glutamate dehydrogenase {Pyrobaculum islandicum [TaxId: 2277]} | Back information, alignment and structure |
|---|
| >d1hyqa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1k0ia1 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1a9xa3 c.30.1.1 (A:1-127) Carbamoyl phosphate synthetase (CPS), large subunit PreATP-grasp domains {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1e3ia2 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1hwxa1 c.2.1.7 (A:209-501) Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1leha1 c.2.1.7 (A:135-364) Leucine dehydrogenase {Bacillus sphaericus [TaxId: 1421]} | Back information, alignment and structure |
|---|
| >d1i0za1 c.2.1.5 (A:1-160) Lactate dehydrogenase {Human (Homo sapiens), heart isoform (H chain) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fzwa2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bgva1 c.2.1.7 (A:195-449) Glutamate dehydrogenase {Clostridium symbiosum [TaxId: 1512]} | Back information, alignment and structure |
|---|
| >d1djqa3 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} | Back information, alignment and structure |
|---|
| >d1pj5a2 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine oxidase {Arthrobacter globiformis [TaxId: 1665]} | Back information, alignment and structure |
|---|
| >d1f8fa2 c.2.1.1 (A:163-336) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} | Back information, alignment and structure |
|---|
| >d1diha1 c.2.1.3 (A:2-130,A:241-273) Dihydrodipicolinate reductase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2afhe1 c.37.1.10 (E:1-289) Nitrogenase iron protein {Azotobacter vinelandii [TaxId: 354]} | Back information, alignment and structure |
|---|
| >d1dxya1 c.2.1.4 (A:101-299) D-2-hydroxyisocaproate dehydrogenase {Lactobacillus casei [TaxId: 1582]} | Back information, alignment and structure |
|---|
| >d2fy8a1 c.2.1.9 (A:116-244) Potassium channel-related protein MthK {Archaeon Methanothermobacter thermautotrophicus [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1a9xa4 c.30.1.1 (A:556-676) Carbamoyl phosphate synthetase (CPS), large subunit PreATP-grasp domains {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1kola2 c.2.1.1 (A:161-355) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d1j4aa1 c.2.1.4 (A:104-300) D-lactate dehydrogenase {Lactobacillus helveticus [TaxId: 1587]} | Back information, alignment and structure |
|---|
| >d1h2ba2 c.2.1.1 (A:155-326) Alcohol dehydrogenase {Archaeon Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d1mx3a1 c.2.1.4 (A:126-318) Transcription corepressor CtbP {Human (Homo sapiens), Ctbp1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2gf3a1 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]} | Back information, alignment and structure |
|---|
| >d1yovb1 c.111.1.2 (B:12-437) UBA3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3c96a1 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d2gv8a1 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d2d59a1 c.2.1.8 (A:4-142) Hypothetical protein PH1109 {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1cdoa2 c.2.1.1 (A:165-339) Alcohol dehydrogenase {Cod (Gadus callarias) [TaxId: 8053]} | Back information, alignment and structure |
|---|
| >d1ihua1 c.37.1.10 (A:1-296) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ygya1 c.2.1.4 (A:99-282) Phosphoglycerate dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2f5va1 c.3.1.2 (A:43-354,A:553-619) Pyranose 2-oxidase {White-rot fungus (Peniophora sp. SG) [TaxId: 204723]} | Back information, alignment and structure |
|---|
| >d1fcda1 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]} | Back information, alignment and structure |
|---|
| >d1i8ta1 c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mutase, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} | Back information, alignment and structure |
|---|
| >d2bisa1 c.87.1.8 (A:1-437) Glycogen synthase 1, GlgA {Pyrococcus abyssi [TaxId: 29292]} | Back information, alignment and structure |
|---|
| >d2gqfa1 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein HI0933 {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1aoga2 c.3.1.5 (A:170-286) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} | Back information, alignment and structure |
|---|
| >d1y81a1 c.2.1.8 (A:6-121) Hypothetical protein PF0725 {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1m6ya2 c.66.1.23 (A:2-114,A:216-294) TM0872, methyltransferase domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1gesa1 c.3.1.5 (A:3-146,A:263-335) Glutathione reductase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1rp0a1 c.3.1.6 (A:7-284) Thiazole biosynthetic enzyme Thi4 {Thale cress(Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d2naca1 c.2.1.4 (A:148-335) Formate dehydrogenase {Pseudomonas sp., strain 101 [TaxId: 306]} | Back information, alignment and structure |
|---|
| >d1sc6a1 c.2.1.4 (A:108-295) Phosphoglycerate dehydrogenase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1y8ca_ c.66.1.43 (A:) Putative methyltransferase CAC2371 {Clostridium acetobutylicum [TaxId: 1488]} | Back information, alignment and structure |
|---|
| >d1q1ra1 c.3.1.5 (A:2-114,A:248-319) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d2v5za1 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1d7ya1 c.3.1.5 (A:5-115,A:237-308) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} | Back information, alignment and structure |
|---|
| >d1nhpa1 c.3.1.5 (A:1-119,A:243-321) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d1cjca2 c.4.1.1 (A:6-106,A:332-460) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1pjza_ c.66.1.36 (A:) Thiopurine S-methyltransferase {Pseudomonas syringae [TaxId: 317]} | Back information, alignment and structure |
|---|
| >d1vdca1 c.3.1.5 (A:1-117,A:244-316) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d2i0za1 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]} | Back information, alignment and structure |
|---|
| >d1gtma1 c.2.1.7 (A:181-419) Glutamate dehydrogenase {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1gdha1 c.2.1.4 (A:101-291) D-glycerate dehydrogenase {Hyphomicrobium methylovorum [TaxId: 84]} | Back information, alignment and structure |
|---|
| >d1v8ba1 c.2.1.4 (A:235-397) S-adenosylhomocystein hydrolase {Plasmodium falciparum, isolate 3D7 [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1dxla1 c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} | Back information, alignment and structure |
|---|
| >d1yova1 c.111.1.2 (A:6-534) Amyloid beta precursor protein-binding protein 1, APPBP1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wzna1 c.66.1.43 (A:1-251) Hypothetical methyltransferase PH1305 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1pn0a1 c.3.1.2 (A:1-240,A:342-461) Phenol hydroxylase {Soil-living yeast (Trichosporon cutaneum) [TaxId: 5554]} | Back information, alignment and structure |
|---|
| >d3grsa1 c.3.1.5 (A:18-165,A:291-363) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1n4wa1 c.3.1.2 (A:9-318,A:451-507) Cholesterol oxidase of GMC family {Streptomyces sp. [TaxId: 1931]} | Back information, alignment and structure |
|---|
| >d1b26a1 c.2.1.7 (A:179-412) Glutamate dehydrogenase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2fyta1 c.66.1.6 (A:238-548) Protein arginine N-methyltransferase 3, PRMT3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kifa1 c.4.1.2 (A:1-194,A:288-339) D-aminoacid oxidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d2blna2 c.65.1.1 (A:1-203) Polymyxin resistance protein ArnA, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1w4xa1 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} | Back information, alignment and structure |
|---|
| >d1y0pa2 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} | Back information, alignment and structure |
|---|
| >d1ve3a1 c.66.1.43 (A:2-227) Hypothetical protein PH0226 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d2cvza2 c.2.1.6 (A:2-157) Hydroxyisobutyrate dehydrogenase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1f06a1 c.2.1.3 (A:1-118,A:269-320) Diaminopimelic acid dehydrogenase (DAPDH) {Corynebacterium glutamicum [TaxId: 1718]} | Back information, alignment and structure |
|---|
| >d1rzua_ c.87.1.8 (A:) Glycogen synthase 1, GlgA {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1pn3a_ c.87.1.5 (A:) TDP-epi-vancosaminyltransferase GtfA {Amycolatopsis orientalis [TaxId: 31958]} | Back information, alignment and structure |
|---|
| >d2i76a2 c.2.1.6 (A:2-154) Hypothetical protein TM1727 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2csua1 c.2.1.8 (A:1-129) Acetate-CoA ligase alpha chain, AcdA, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1lqta2 c.4.1.1 (A:2-108,A:325-456) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2bw0a2 c.65.1.1 (A:1-203) 10-formyltetrahydrofolate dehydrogenase domain 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1oria_ c.66.1.6 (A:) Protein arginine N-methyltransferase 1, PRMT1 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1trba1 c.3.1.5 (A:1-118,A:245-316) Thioredoxin reductase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d3etja2 c.30.1.1 (A:1-78) N5-carboxyaminoimidazole ribonucleotide synthetase PurK (AIRC), N-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1v59a1 c.3.1.5 (A:1-160,A:283-355) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2gv8a2 c.3.1.5 (A:181-287) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1d4ca2 c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella putrefaciens [TaxId: 24]} | Back information, alignment and structure |
|---|
| >d1iuka_ c.2.1.8 (A:) Hypothetical protein TT1466 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1iira_ c.87.1.5 (A:) UDP-glucosyltransferase GtfB {Amycolatopsis orientalis [TaxId: 31958]} | Back information, alignment and structure |
|---|
| >d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2bzga1 c.66.1.36 (A:17-245) Thiopurine S-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pvva2 c.78.1.1 (A:151-313) Ornithine transcarbamoylase {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1fl2a2 c.3.1.5 (A:326-451) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1rrva_ c.87.1.5 (A:) TDP-vancosaminyltransferase GftD {Amycolatopsis orientalis [TaxId: 31958]} | Back information, alignment and structure |
|---|
| >d1m6ia2 c.3.1.5 (A:264-400) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3coxa1 c.3.1.2 (A:5-318,A:451-506) Cholesterol oxidase of GMC family {Brevibacterium sterolicum [TaxId: 1702]} | Back information, alignment and structure |
|---|
| >d1ebda1 c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1feca2 c.3.1.5 (A:170-286) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} | Back information, alignment and structure |
|---|
| >d1iowa1 c.30.1.2 (A:1-96) D-Ala-D-Ala ligase, N-domain {Escherichia coli, gene ddlB [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1jg1a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1lvla1 c.3.1.5 (A:1-150,A:266-335) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d3lada1 c.3.1.5 (A:1-158,A:278-348) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} | Back information, alignment and structure |
|---|
| >d2gh1a1 c.66.1.49 (A:13-293) Methyltransferase BC2162 {Bacillus cereus [TaxId: 1396]} | Back information, alignment and structure |
|---|
| >d1xhca1 c.3.1.5 (A:1-103,A:226-289) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1nvmb1 c.2.1.3 (B:1-131,B:287-312) Acetaldehyde dehydrogenase (acylating) {Pseudomonas sp. [TaxId: 306]} | Back information, alignment and structure |
|---|
| >d2gmha1 c.3.1.2 (A:4-236,A:336-482) Electron transfer flavoprotein-ubiquinone oxidoreductase, EFT-QO {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1vdca2 c.3.1.5 (A:118-243) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1mo9a1 c.3.1.5 (A:2-192,A:314-383) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} | Back information, alignment and structure |
|---|
| >d2nu7a1 c.2.1.8 (A:2-120) Succinyl-CoA synthetase, alpha-chain, N-terminal (CoA-binding) domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1l7da1 c.2.1.4 (A:144-326) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]} | Back information, alignment and structure |
|---|
| >d1vl5a_ c.66.1.41 (A:) Hypothetical protein BH2331 {Bacillus halodurans [TaxId: 86665]} | Back information, alignment and structure |
|---|
| >d2bs2a2 c.3.1.4 (A:1-250,A:372-457) Fumarate reductase {Wolinella succinogenes [TaxId: 844]} | Back information, alignment and structure |
|---|
| >d1yb2a1 c.66.1.13 (A:6-255) Hypothetical protein Ta0852 {Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d2cl5a1 c.66.1.1 (A:3-216) Catechol O-methyltransferase, COMT {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1pjca1 c.2.1.4 (A:136-303) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]} | Back information, alignment and structure |
|---|
| >d1ojta1 c.3.1.5 (A:117-275,A:401-470) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} | Back information, alignment and structure |
|---|
| >d2esra1 c.66.1.46 (A:28-179) Putative methyltransferase SPy1538 {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d2nxca1 c.66.1.39 (A:1-254) PrmA-like protein TTHA0656 (TT0836) {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1trba2 c.3.1.5 (A:119-244) Thioredoxin reductase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2b3ta1 c.66.1.30 (A:2-275) N5-glutamine methyltransferase, HemK {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2igta1 c.66.1.51 (A:1-309) Putative methyltransferase Atu0340 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1nt2a_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d2i6ga1 c.66.1.44 (A:1-198) Putative methyltransferase TehB {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d2dt5a2 c.2.1.12 (A:78-203) Transcriptional repressor Rex, C-terminal domain {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d1tqha_ c.69.1.29 (A:) Carboxylesterase Est {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1h6va1 c.3.1.5 (A:10-170,A:293-366) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1qo8a2 c.3.1.4 (A:103-359,A:506-565) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} | Back information, alignment and structure |
|---|
| >d1dl5a1 c.66.1.7 (A:1-213) Protein-L-isoaspartyl O-methyltransferase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1onfa1 c.3.1.5 (A:1-153,A:271-376) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1dusa_ c.66.1.4 (A:) Hypothetical protein MJ0882 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1fl2a1 c.3.1.5 (A:212-325,A:452-521) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1xkla_ c.69.1.20 (A:) Salicylic acid-binding protein 2 (SABP2) {Common tobacco (Nicotiana tabacum) [TaxId: 4097]} | Back information, alignment and structure |
|---|
| >d1euca1 c.2.1.8 (A:1-130) Succinyl-CoA synthetase, alpha-chain, N-terminal (CoA-binding) domain {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1fmta2 c.65.1.1 (A:1-206) Methionyl-tRNAfmet formyltransferase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1k92a1 c.26.2.1 (A:1-188) Argininosuccinate synthetase, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ps9a2 c.3.1.1 (A:466-627) 2,4-dienoyl-CoA reductase, C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1kdga1 c.3.1.2 (A:215-512,A:694-755) Flavoprotein domain of flavocytochrome cellobiose dehydrogenase (CDH), FAD-binding domain {Fungus (Phanerochaete chrysosporium) [TaxId: 5306]} | Back information, alignment and structure |
|---|
| >d1l3ia_ c.66.1.22 (A:) Precorrin-6Y methyltransferase (CbiT) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1imja_ c.69.1.23 (A:) Ccg1/TafII250-interacting factor B (Cib) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p3y1_ c.34.1.1 (1:) MrsD {Bacillus sp. hil-y85/54728 [TaxId: 69002]} | Back information, alignment and structure |
|---|
| >d1p5ja_ c.79.1.1 (A:) L-serine dehydratase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jbqa_ c.79.1.1 (A:) Cystathionine beta-synthase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1i1na_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1j20a1 c.26.2.1 (A:1-165) Argininosuccinate synthetase, N-terminal domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1b7go1 c.2.1.3 (O:1-138,O:301-340) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1m6ia1 c.3.1.5 (A:128-263,A:401-477) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1oi7a1 c.2.1.8 (A:1-121) Succinyl-CoA synthetase, alpha-chain, N-terminal (CoA-binding) domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1ri5a_ c.66.1.34 (A:) mRNA cap (Guanine N-7) methyltransferase {Fungus (Encephalitozoon cuniculi) [TaxId: 6035]} | Back information, alignment and structure |
|---|
| >d3c70a1 c.69.1.20 (A:2-257) Hydroxynitrile lyase {Rubber tree (Hevea brasiliensis) [TaxId: 3981]} | Back information, alignment and structure |
|---|
| >d2iw1a1 c.87.1.8 (A:2-371) Lipopolysaccharide core biosynthesis protein RfaG {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1w4xa2 c.3.1.5 (A:155-389) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} | Back information, alignment and structure |
|---|
| >d1vkza2 c.30.1.1 (A:4-93) Glycinamide ribonucleotide synthetase (GAR-syn), N-domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2bhsa1 c.79.1.1 (A:2-293) O-acetylserine sulfhydrylase (Cysteine synthase) {Escherichia coli, isoform B (CysM) [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1g6q1_ c.66.1.6 (1:) Arginine methyltransferase, HMT1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1xxla_ c.66.1.41 (A:) Hypothetical protein YcgJ {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1neka2 c.3.1.4 (A:1-235,A:356-450) Succinate dehydogenase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d3bswa1 b.81.1.8 (A:3-195) Acetyltransferase PglD {Campylobacter jejuni [TaxId: 197]} | Back information, alignment and structure |
|---|
| >d1gpea1 c.3.1.2 (A:1-328,A:525-587) Glucose oxidase {Penicillium amagasakiense [TaxId: 63559]} | Back information, alignment and structure |
|---|
| >d1im8a_ c.66.1.14 (A:) Hypothetical protein HI0319 (YecO) {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1wg8a2 c.66.1.23 (A:5-108,A:207-284) TM0872, methyltransferase domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1nkva_ c.66.1.21 (A:) Hypothetical Protein YjhP {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2fhpa1 c.66.1.46 (A:1-182) Putative methylase EF2452 {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|