Citrus Sinensis ID: 036468


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60----
MSGKGKVVCVTGASGFIASWLVKLLLQRSYTVKATVRDLNNHNAEHLLTLDGAEERLHLFKANS
ccccccEEEEEcccHHHHHHHHHHHHHcccEEEEEEcccccccHHHHHccccccccEEEEEccc
ccccccEEEEcccHHHHHHHHHHHHHHcccEEEEEEEccccccHHHHHHcccccHHEEEEEccc
MSGKGKVVCVTGASGFIASWLVKLLLQRSYTVKATVrdlnnhnaehllTLDGAEERLHLFKANS
MSGKGKVVCVTGASGFIASWLVKLLLQRSYTVKATVRDlnnhnaehlltldgaeeRLHLFKANS
MSGKGKVVCVTGASGFIASWLVKLLLQRSYTVKATVRDLNNHNAEHLLTLDGAEERLHLFKANS
*****KVVCVTGASGFIASWLVKLLLQRSYTVKATVRDLNNHNAEHLLTLDGA***********
*****KV**VTGASGFIASWLVKLLLQRSYTVKATVRDLNNHNAEHLLTLDGAEERLHLFKANS
MSGKGKVVCVTGASGFIASWLVKLLLQRSYTVKATVRDLNNHNAEHLLTLDGAEERLHLFKANS
****GKVVCVTGASGFIASWLVKLLLQRSYTVKATVRDLNNHNAEHLLTLDGAEERLHLFKA**
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSGKGKVVCVTGASGFIASWLVKLLLQRSYTVKATxxxxxxxxxxxxxxxxxxxxxLHLFKANS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query64 2.2.26 [Sep-21-2011]
Q9S9N9 344 Cinnamoyl-CoA reductase 1 no no 0.968 0.180 0.580 7e-14
Q9SAH9 332 Cinnamoyl-CoA reductase 2 no no 0.921 0.177 0.593 9e-14
P51104 360 Dihydroflavonol-4-reducta N/A no 0.953 0.169 0.580 2e-13
Q84KP0 347 Bifunctional dihydroflavo N/A no 0.984 0.181 0.562 5e-12
Q9XES5 348 Bifunctional dihydroflavo N/A no 0.984 0.181 0.562 5e-12
P51110 337 Dihydroflavonol-4-reducta no no 0.984 0.186 0.562 1e-11
Q500U8 326 Tetraketide alpha-pyrone no no 0.937 0.184 0.612 1e-11
P51106 354 Dihydroflavonol-4-reducta N/A no 0.984 0.177 0.562 4e-11
P51102 382 Dihydroflavonol-4-reducta no no 0.984 0.164 0.546 4e-11
P14721 446 Dihydroflavonol-4-reducta N/A no 0.875 0.125 0.578 8e-11
>sp|Q9S9N9|CCR1_ARATH Cinnamoyl-CoA reductase 1 OS=Arabidopsis thaliana GN=CCR1 PE=1 SV=1 Back     alignment and function desciption
 Score = 75.9 bits (185), Expect = 7e-14,   Method: Composition-based stats.
 Identities = 36/62 (58%), Positives = 46/62 (74%)

Query: 2  SGKGKVVCVTGASGFIASWLVKLLLQRSYTVKATVRDLNNHNAEHLLTLDGAEERLHLFK 61
          S  GK VCVTGA G+IASW+VK+LL+R YTVK TVR+ ++    HL  L+G +ERL L K
Sbjct: 7  SPAGKTVCVTGAGGYIASWIVKILLERGYTVKGTVRNPDDPKNTHLRELEGGKERLILCK 66

Query: 62 AN 63
          A+
Sbjct: 67 AD 68




Involved in the latter stages of lignin biosynthesis. Catalyzes one of the last steps of monolignol biosynthesis, the conversion of cinnamoyl-CoAs into their corresponding cinnamaldehydes.
Arabidopsis thaliana (taxid: 3702)
EC: 1EC: .EC: 2EC: .EC: 1EC: .EC: 4EC: 4
>sp|Q9SAH9|CCR2_ARATH Cinnamoyl-CoA reductase 2 OS=Arabidopsis thaliana GN=CCR2 PE=1 SV=1 Back     alignment and function description
>sp|P51104|DFRA_DIACA Dihydroflavonol-4-reductase OS=Dianthus caryophyllus GN=A PE=2 SV=1 Back     alignment and function description
>sp|Q84KP0|DFRA_PYRCO Bifunctional dihydroflavonol 4-reductase/flavanone 4-reductase OS=Pyrus communis GN=DFR PE=1 SV=1 Back     alignment and function description
>sp|Q9XES5|DFRA_MALDO Bifunctional dihydroflavonol 4-reductase/flavanone 4-reductase OS=Malus domestica GN=DFR PE=1 SV=1 Back     alignment and function description
>sp|P51110|DFRA_VITVI Dihydroflavonol-4-reductase OS=Vitis vinifera GN=DFR PE=1 SV=1 Back     alignment and function description
>sp|Q500U8|TKPR1_ARATH Tetraketide alpha-pyrone reductase 1 OS=Arabidopsis thaliana GN=TKPR1 PE=2 SV=1 Back     alignment and function description
>sp|P51106|DFRA_HORVU Dihydroflavonol-4-reductase OS=Hordeum vulgare GN=ANT18 PE=3 SV=1 Back     alignment and function description
>sp|P51102|DFRA_ARATH Dihydroflavonol-4-reductase OS=Arabidopsis thaliana GN=DFRA PE=3 SV=2 Back     alignment and function description
>sp|P14721|DFRA_ANTMA Dihydroflavonol-4-reductase OS=Antirrhinum majus GN=DFRA PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query64
359487083 323 PREDICTED: bifunctional dihydroflavonol 0.984 0.195 0.796 2e-21
359487096 323 PREDICTED: bifunctional dihydroflavonol 0.984 0.195 0.796 3e-21
225465329 323 PREDICTED: bifunctional dihydroflavonol 0.984 0.195 0.796 3e-21
359487115 259 PREDICTED: bifunctional dihydroflavonol 0.984 0.243 0.796 3e-21
224106127 324 cinnamoyl CoA reductase-like protein [Po 0.968 0.191 0.793 3e-20
359486990 323 PREDICTED: LOW QUALITY PROTEIN: bifuncti 0.984 0.195 0.781 4e-20
147777135 1403 hypothetical protein VITISV_030427 [Viti 0.984 0.044 0.781 4e-20
147774817 298 hypothetical protein VITISV_003513 [Viti 0.984 0.211 0.781 4e-20
297736314 326 unnamed protein product [Vitis vinifera] 0.953 0.187 0.790 5e-20
296086570 284 unnamed protein product [Vitis vinifera] 0.984 0.221 0.781 5e-20
>gi|359487083|ref|XP_003633515.1| PREDICTED: bifunctional dihydroflavonol 4-reductase/flavanone 4-reductase-like [Vitis vinifera] gi|296085368|emb|CBI29100.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  106 bits (264), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 51/64 (79%), Positives = 57/64 (89%), Gaps = 1/64 (1%)

Query: 1  MSGKGKVVCVTGASGFIASWLVKLLLQRSYTVKATVRDLNN-HNAEHLLTLDGAEERLHL 59
          MSG+GKVVCVTGASG+IASWLVKLLLQR YTVKATVRD N+    EHLL L+GA+ERLHL
Sbjct: 1  MSGQGKVVCVTGASGYIASWLVKLLLQRGYTVKATVRDPNDPKKTEHLLALEGAKERLHL 60

Query: 60 FKAN 63
          F+AN
Sbjct: 61 FEAN 64




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|359487096|ref|XP_003633516.1| PREDICTED: bifunctional dihydroflavonol 4-reductase/flavanone 4-reductase-like [Vitis vinifera] gi|296085371|emb|CBI29103.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|225465329|ref|XP_002274632.1| PREDICTED: bifunctional dihydroflavonol 4-reductase/flavanone 4-reductase isoform 1 [Vitis vinifera] gi|296085398|emb|CBI29130.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|359487115|ref|XP_003633518.1| PREDICTED: bifunctional dihydroflavonol 4-reductase/flavanone 4-reductase isoform 2 [Vitis vinifera] Back     alignment and taxonomy information
>gi|224106127|ref|XP_002314053.1| cinnamoyl CoA reductase-like protein [Populus trichocarpa] gi|222850461|gb|EEE88008.1| cinnamoyl CoA reductase-like protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|359486990|ref|XP_003633502.1| PREDICTED: LOW QUALITY PROTEIN: bifunctional dihydroflavonol 4-reductase/flavanone 4-reductase-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|147777135|emb|CAN63402.1| hypothetical protein VITISV_030427 [Vitis vinifera] Back     alignment and taxonomy information
>gi|147774817|emb|CAN71364.1| hypothetical protein VITISV_003513 [Vitis vinifera] Back     alignment and taxonomy information
>gi|297736314|emb|CBI24952.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|296086570|emb|CBI32205.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query64
TAIR|locus:2012250 369 AT1G09480 [Arabidopsis thalian 0.984 0.170 0.734 3.1e-19
TAIR|locus:2150315 326 AT5G19440 [Arabidopsis thalian 0.968 0.190 0.698 1.1e-18
TAIR|locus:2033394 319 AT1G66800 [Arabidopsis thalian 0.984 0.197 0.671 4.6e-18
TAIR|locus:2033904 325 AT1G51410 [Arabidopsis thalian 0.968 0.190 0.714 9.5e-18
TAIR|locus:2012265 322 AT1G09490 [Arabidopsis thalian 0.984 0.195 0.703 1.6e-17
TAIR|locus:2012315 322 AT1G09510 [Arabidopsis thalian 0.984 0.195 0.656 2.6e-17
TAIR|locus:2012280 325 AT1G09500 [Arabidopsis thalian 0.984 0.193 0.671 3.7e-17
TAIR|locus:2200427 344 CCR1 "cinnamoyl coa reductase 0.968 0.180 0.580 2.4e-13
TAIR|locus:2025832 332 CCR2 "cinnamoyl coa reductase" 0.921 0.177 0.593 3.6e-13
TAIR|locus:2011741 325 AT1G76470 [Arabidopsis thalian 0.968 0.190 0.603 1.2e-12
TAIR|locus:2012250 AT1G09480 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 232 (86.7 bits), Expect = 3.1e-19, P = 3.1e-19
 Identities = 47/64 (73%), Positives = 54/64 (84%)

Query:     1 MSGKGKVVCVTGASGFIASWLVKLLLQRSYTVKATVRDLNNHN-AEHLLTLDGAEERLHL 59
             M+G GK+VCVTGASG+IASW+VKLLL R YTVKATVRDL +    EHLL LDGA+ERL L
Sbjct:    48 MNGGGKLVCVTGASGYIASWIVKLLLLRGYTVKATVRDLTDRKKTEHLLALDGAKERLKL 107

Query:    60 FKAN 63
             FKA+
Sbjct:   108 FKAD 111




GO:0000166 "nucleotide binding" evidence=IEA
GO:0003824 "catalytic activity" evidence=IEA
GO:0005575 "cellular_component" evidence=ND
GO:0009809 "lignin biosynthetic process" evidence=ISS
GO:0044237 "cellular metabolic process" evidence=IEA
GO:0045551 "cinnamyl-alcohol dehydrogenase activity" evidence=ISS
GO:0050662 "coenzyme binding" evidence=IEA
GO:0004022 "alcohol dehydrogenase (NAD) activity" evidence=ISS
TAIR|locus:2150315 AT5G19440 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2033394 AT1G66800 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2033904 AT1G51410 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2012265 AT1G09490 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2012315 AT1G09510 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2012280 AT1G09500 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2200427 CCR1 "cinnamoyl coa reductase 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2025832 CCR2 "cinnamoyl coa reductase" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2011741 AT1G76470 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
GSVIVG00033897001
SubName- Full=Chromosome undetermined scaffold_71, whole genome shotgun sequence; (323 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query64
PLN02662 322 PLN02662, PLN02662, cinnamyl-alcohol dehydrogenase 3e-37
cd08958 293 cd08958, FR_SDR_e, flavonoid reductase (FR), exten 2e-27
PLN02986 322 PLN02986, PLN02986, cinnamyl-alcohol dehydrogenase 9e-27
PLN02989 325 PLN02989, PLN02989, cinnamyl-alcohol dehydrogenase 7e-22
PLN02650 351 PLN02650, PLN02650, dihydroflavonol-4-reductase 4e-21
PLN02214 342 PLN02214, PLN02214, cinnamoyl-CoA reductase 5e-19
PLN02896 353 PLN02896, PLN02896, cinnamyl-alcohol dehydrogenase 1e-17
cd05193 295 cd05193, AR_like_SDR_e, aldehyde reductase, flavon 1e-16
cd05227 301 cd05227, AR_SDR_e, aldehyde reductase, extended (e 3e-13
PLN02583 297 PLN02583, PLN02583, cinnamoyl-CoA reductase 7e-11
PLN00198 338 PLN00198, PLN00198, anthocyanidin reductase; Provi 3e-10
cd05228 318 cd05228, AR_FR_like_1_SDR_e, uncharacterized subgr 1e-07
cd05271 273 cd05271, NDUFA9_like_SDR_a, NADH dehydrogenase (ub 5e-07
TIGR03466 328 TIGR03466, HpnA, hopanoid-associated sugar epimera 5e-07
cd05257 316 cd05257, Arna_like_SDR_e, Arna decarboxylase_like, 1e-06
cd05243 203 cd05243, SDR_a5, atypical (a) SDRs, subgroup 5 1e-06
TIGR04180 297 TIGR04180, EDH_00030, NAD dependent epimerase/dehy 5e-06
COG0451 314 COG0451, WcaG, Nucleoside-diphosphate-sugar epimer 8e-06
cd08946 200 cd08946, SDR_e, extended (e) SDRs 1e-05
cd05245 293 cd05245, SDR_a2, atypical (a) SDRs, subgroup 2 1e-05
cd05260 316 cd05260, GDP_MD_SDR_e, GDP-mannose 4,6 dehydratase 3e-05
COG1089 345 COG1089, Gmd, GDP-D-mannose dehydratase [Cell enve 5e-05
cd05263 293 cd05263, MupV_like_SDR_e, Pseudomonas fluorescens 5e-05
pfam01370 233 pfam01370, Epimerase, NAD dependent epimerase/dehy 6e-05
COG0702 275 COG0702, COG0702, Predicted nucleoside-diphosphate 9e-05
PLN02657 390 PLN02657, PLN02657, 3,8-divinyl protochlorophyllid 1e-04
cd05280 325 cd05280, MDR_yhdh_yhfp, Yhdh and yhfp-like putativ 1e-04
cd05232 303 cd05232, UDP_G4E_4_SDR_e, UDP-glucose 4 epimerase, 1e-04
cd05230 305 cd05230, UGD_SDR_e, UDP-glucuronate decarboxylase 2e-04
PLN02653 340 PLN02653, PLN02653, GDP-mannose 4,6-dehydratase 3e-04
PRK07201 657 PRK07201, PRK07201, short chain dehydrogenase; Pro 4e-04
cd05262 291 cd05262, SDR_a7, atypical (a) SDRs, subgroup 7 5e-04
pfam05368 232 pfam05368, NmrA, NmrA-like family 5e-04
PLN02695 370 PLN02695, PLN02695, GDP-D-mannose-3',5'-epimerase 5e-04
cd05252 336 cd05252, CDP_GD_SDR_e, CDP-D-glucose 4,6-dehydrata 5e-04
cd08932 223 cd08932, HetN_like_SDR_c, HetN oxidoreductase-like 7e-04
PRK06179 270 PRK06179, PRK06179, short chain dehydrogenase; Pro 0.001
cd05374 248 cd05374, 17beta-HSD-like_SDR_c, 17beta hydroxyster 0.001
pfam13460 182 pfam13460, NAD_binding_10, NADH(P)-binding 0.002
cd05237 287 cd05237, UDP_invert_4-6DH_SDR_e, UDP-Glcnac (UDP-l 0.002
cd05234 305 cd05234, UDP_G4E_2_SDR_e, UDP-glucose 4 epimerase, 0.002
cd08289 326 cd08289, MDR_yhfp_like, Yhfp putative quinone oxid 0.002
PRK08264 238 PRK08264, PRK08264, short chain dehydrogenase; Val 0.003
TIGR01179 328 TIGR01179, galE, UDP-glucose-4-epimerase GalE 0.004
>gnl|CDD|178268 PLN02662, PLN02662, cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
 Score =  125 bits (316), Expect = 3e-37
 Identities = 52/63 (82%), Positives = 56/63 (88%), Gaps = 1/63 (1%)

Query: 2  SGKGKVVCVTGASGFIASWLVKLLLQRSYTVKATVRDLNNHN-AEHLLTLDGAEERLHLF 60
          SG+GKVVCVTGASG+IASWLVKLLLQR YTVKATVRD N+    EHLL LDGA+ERLHLF
Sbjct: 1  SGEGKVVCVTGASGYIASWLVKLLLQRGYTVKATVRDPNDPKKTEHLLALDGAKERLHLF 60

Query: 61 KAN 63
          KAN
Sbjct: 61 KAN 63


Length = 322

>gnl|CDD|187661 cd08958, FR_SDR_e, flavonoid reductase (FR), extended (e) SDRs Back     alignment and domain information
>gnl|CDD|178567 PLN02986, PLN02986, cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>gnl|CDD|178569 PLN02989, PLN02989, cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>gnl|CDD|178256 PLN02650, PLN02650, dihydroflavonol-4-reductase Back     alignment and domain information
>gnl|CDD|177862 PLN02214, PLN02214, cinnamoyl-CoA reductase Back     alignment and domain information
>gnl|CDD|178484 PLN02896, PLN02896, cinnamyl-alcohol dehydrogenase Back     alignment and domain information
>gnl|CDD|187536 cd05193, AR_like_SDR_e, aldehyde reductase, flavonoid reductase, and related proteins, extended (e) SDRs Back     alignment and domain information
>gnl|CDD|187538 cd05227, AR_SDR_e, aldehyde reductase, extended (e) SDRs Back     alignment and domain information
>gnl|CDD|178195 PLN02583, PLN02583, cinnamoyl-CoA reductase Back     alignment and domain information
>gnl|CDD|215100 PLN00198, PLN00198, anthocyanidin reductase; Provisional Back     alignment and domain information
>gnl|CDD|187539 cd05228, AR_FR_like_1_SDR_e, uncharacterized subgroup of aldehyde reductase and flavonoid reductase related proteins, extended (e) SDRs Back     alignment and domain information
>gnl|CDD|187579 cd05271, NDUFA9_like_SDR_a, NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, subunit 9, 39 kDa, (NDUFA9) -like, atypical (a) SDRs Back     alignment and domain information
>gnl|CDD|163279 TIGR03466, HpnA, hopanoid-associated sugar epimerase Back     alignment and domain information
>gnl|CDD|187567 cd05257, Arna_like_SDR_e, Arna decarboxylase_like, extended (e) SDRs Back     alignment and domain information
>gnl|CDD|187554 cd05243, SDR_a5, atypical (a) SDRs, subgroup 5 Back     alignment and domain information
>gnl|CDD|200431 TIGR04180, EDH_00030, NAD dependent epimerase/dehydratase, LLPSF_EDH_00030 family Back     alignment and domain information
>gnl|CDD|223528 COG0451, WcaG, Nucleoside-diphosphate-sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|212494 cd08946, SDR_e, extended (e) SDRs Back     alignment and domain information
>gnl|CDD|187556 cd05245, SDR_a2, atypical (a) SDRs, subgroup 2 Back     alignment and domain information
>gnl|CDD|187570 cd05260, GDP_MD_SDR_e, GDP-mannose 4,6 dehydratase, extended (e) SDRs Back     alignment and domain information
>gnl|CDD|224014 COG1089, Gmd, GDP-D-mannose dehydratase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|187573 cd05263, MupV_like_SDR_e, Pseudomonas fluorescens MupV-like, extended (e) SDRs Back     alignment and domain information
>gnl|CDD|216461 pfam01370, Epimerase, NAD dependent epimerase/dehydratase family Back     alignment and domain information
>gnl|CDD|223774 COG0702, COG0702, Predicted nucleoside-diphosphate-sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|178263 PLN02657, PLN02657, 3,8-divinyl protochlorophyllide a 8-vinyl reductase Back     alignment and domain information
>gnl|CDD|176183 cd05280, MDR_yhdh_yhfp, Yhdh and yhfp-like putative quinone oxidoreductases Back     alignment and domain information
>gnl|CDD|187543 cd05232, UDP_G4E_4_SDR_e, UDP-glucose 4 epimerase, subgroup 4, extended (e) SDRs Back     alignment and domain information
>gnl|CDD|187541 cd05230, UGD_SDR_e, UDP-glucuronate decarboxylase (UGD) and related proteins, extended (e) SDRs Back     alignment and domain information
>gnl|CDD|178259 PLN02653, PLN02653, GDP-mannose 4,6-dehydratase Back     alignment and domain information
>gnl|CDD|235962 PRK07201, PRK07201, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187572 cd05262, SDR_a7, atypical (a) SDRs, subgroup 7 Back     alignment and domain information
>gnl|CDD|191263 pfam05368, NmrA, NmrA-like family Back     alignment and domain information
>gnl|CDD|178298 PLN02695, PLN02695, GDP-D-mannose-3',5'-epimerase Back     alignment and domain information
>gnl|CDD|187562 cd05252, CDP_GD_SDR_e, CDP-D-glucose 4,6-dehydratase, extended (e) SDRs Back     alignment and domain information
>gnl|CDD|212493 cd08932, HetN_like_SDR_c, HetN oxidoreductase-like, classical (c) SDR Back     alignment and domain information
>gnl|CDD|235725 PRK06179, PRK06179, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187632 cd05374, 17beta-HSD-like_SDR_c, 17beta hydroxysteroid dehydrogenase-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|222146 pfam13460, NAD_binding_10, NADH(P)-binding Back     alignment and domain information
>gnl|CDD|187548 cd05237, UDP_invert_4-6DH_SDR_e, UDP-Glcnac (UDP-linked N-acetylglucosamine) inverting 4,6-dehydratase, extended (e) SDRs Back     alignment and domain information
>gnl|CDD|187545 cd05234, UDP_G4E_2_SDR_e, UDP-glucose 4 epimerase, subgroup 2, extended (e) SDRs Back     alignment and domain information
>gnl|CDD|176249 cd08289, MDR_yhfp_like, Yhfp putative quinone oxidoreductases Back     alignment and domain information
>gnl|CDD|181335 PRK08264, PRK08264, short chain dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|213592 TIGR01179, galE, UDP-glucose-4-epimerase GalE Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 64
KOG1502 327 consensus Flavonol reductase/cinnamoyl-CoA reducta 99.6
PRK07478 254 short chain dehydrogenase; Provisional 99.44
PRK05653 246 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.44
COG0300 265 DltE Short-chain dehydrogenases of various substra 99.44
PRK06194 287 hypothetical protein; Provisional 99.41
PRK05867 253 short chain dehydrogenase; Provisional 99.4
PRK07231 251 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.4
PLN02986 322 cinnamyl-alcohol dehydrogenase family protein 99.4
PRK07890 258 short chain dehydrogenase; Provisional 99.4
PRK09072 263 short chain dehydrogenase; Provisional 99.39
PRK06114 254 short chain dehydrogenase; Provisional 99.39
PRK05866 293 short chain dehydrogenase; Provisional 99.39
PRK05557 248 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.39
PRK07035 252 short chain dehydrogenase; Provisional 99.39
PRK06172 253 short chain dehydrogenase; Provisional 99.39
PRK07523 255 gluconate 5-dehydrogenase; Provisional 99.39
PRK08862 227 short chain dehydrogenase; Provisional 99.39
PRK07453 322 protochlorophyllide oxidoreductase; Validated 99.38
PLN02583 297 cinnamoyl-CoA reductase 99.38
PRK13394 262 3-hydroxybutyrate dehydrogenase; Provisional 99.38
TIGR01832 248 kduD 2-deoxy-D-gluconate 3-dehydrogenase. This mod 99.37
PRK08085 254 gluconate 5-dehydrogenase; Provisional 99.37
PRK12429 258 3-hydroxybutyrate dehydrogenase; Provisional 99.37
PRK08339 263 short chain dehydrogenase; Provisional 99.37
PRK08628 258 short chain dehydrogenase; Provisional 99.36
PRK07576 264 short chain dehydrogenase; Provisional 99.36
PLN02662 322 cinnamyl-alcohol dehydrogenase family protein 99.36
PRK12826 251 3-ketoacyl-(acyl-carrier-protein) reductase; Revie 99.36
PRK07774 250 short chain dehydrogenase; Provisional 99.36
PRK06139 330 short chain dehydrogenase; Provisional 99.36
PLN02650 351 dihydroflavonol-4-reductase 99.36
PRK06138 252 short chain dehydrogenase; Provisional 99.36
PRK05876 275 short chain dehydrogenase; Provisional 99.36
PRK12481 251 2-deoxy-D-gluconate 3-dehydrogenase; Provisional 99.35
PRK12937 245 short chain dehydrogenase; Provisional 99.35
PRK07806 248 short chain dehydrogenase; Provisional 99.35
PLN02989 325 cinnamyl-alcohol dehydrogenase family protein 99.35
PRK07814 263 short chain dehydrogenase; Provisional 99.35
PRK06124 256 gluconate 5-dehydrogenase; Provisional 99.35
PRK08277 278 D-mannonate oxidoreductase; Provisional 99.35
PRK08589 272 short chain dehydrogenase; Validated 99.34
PRK07109 334 short chain dehydrogenase; Provisional 99.34
PRK06935 258 2-deoxy-D-gluconate 3-dehydrogenase; Provisional 99.34
PRK05854 313 short chain dehydrogenase; Provisional 99.34
PRK08278 273 short chain dehydrogenase; Provisional 99.33
PRK07063 260 short chain dehydrogenase; Provisional 99.33
PRK12745 256 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 99.33
TIGR03325 262 BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydro 99.33
PRK07326 237 short chain dehydrogenase; Provisional 99.32
PRK08643 256 acetoin reductase; Validated 99.32
PRK07097 265 gluconate 5-dehydrogenase; Provisional 99.32
PRK07904 253 short chain dehydrogenase; Provisional 99.32
PRK07825 273 short chain dehydrogenase; Provisional 99.32
PRK06701 290 short chain dehydrogenase; Provisional 99.31
PRK08213 259 gluconate 5-dehydrogenase; Provisional 99.31
PLN02214 342 cinnamoyl-CoA reductase 99.31
PRK07454 241 short chain dehydrogenase; Provisional 99.31
PRK06197 306 short chain dehydrogenase; Provisional 99.31
PRK09134 258 short chain dehydrogenase; Provisional 99.31
PRK08265 261 short chain dehydrogenase; Provisional 99.31
PRK06720169 hypothetical protein; Provisional 99.3
PRK07666 239 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.3
PRK07062 265 short chain dehydrogenase; Provisional 99.3
PRK05565 247 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.3
PRK07024 257 short chain dehydrogenase; Provisional 99.3
PRK12823 260 benD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylat 99.3
PRK05786 238 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.3
PRK06914 280 short chain dehydrogenase; Provisional 99.3
PRK07792 306 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.29
PRK08217 253 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.29
PLN02240 352 UDP-glucose 4-epimerase 99.29
PRK12743 256 oxidoreductase; Provisional 99.29
PRK07102 243 short chain dehydrogenase; Provisional 99.29
PRK06113 255 7-alpha-hydroxysteroid dehydrogenase; Validated 99.28
PLN02253 280 xanthoxin dehydrogenase 99.28
PRK06128 300 oxidoreductase; Provisional 99.28
PRK08251 248 short chain dehydrogenase; Provisional 99.28
COG3967 245 DltE Short-chain dehydrogenase involved in D-alani 99.28
PRK08303 305 short chain dehydrogenase; Provisional 99.28
PRK07856 252 short chain dehydrogenase; Provisional 99.27
PLN00198 338 anthocyanidin reductase; Provisional 99.27
TIGR03206 250 benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydr 99.27
PRK06200 263 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrog 99.27
PRK06077 252 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.27
PRK07067 257 sorbitol dehydrogenase; Provisional 99.27
PRK06101 240 short chain dehydrogenase; Provisional 99.27
PRK12939 250 short chain dehydrogenase; Provisional 99.27
TIGR01472 343 gmd GDP-mannose 4,6-dehydratase. Excluded from thi 99.27
TIGR01289 314 LPOR light-dependent protochlorophyllide reductase 99.26
PRK05875 276 short chain dehydrogenase; Provisional 99.26
KOG0725 270 consensus Reductases with broad range of substrate 99.26
PRK07985 294 oxidoreductase; Provisional 99.26
PLN02896 353 cinnamyl-alcohol dehydrogenase 99.26
KOG1205 282 consensus Predicted dehydrogenase [Secondary metab 99.26
PRK05717 255 oxidoreductase; Validated 99.26
PRK06949 258 short chain dehydrogenase; Provisional 99.26
PRK08340 259 glucose-1-dehydrogenase; Provisional 99.26
PRK07370 258 enoyl-(acyl carrier protein) reductase; Validated 99.26
TIGR02622 349 CDP_4_6_dhtase CDP-glucose 4,6-dehydratase. Member 99.26
PRK12825 249 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.25
PRK06947 248 glucose-1-dehydrogenase; Provisional 99.25
PRK09242 257 tropinone reductase; Provisional 99.25
PRK12744 257 short chain dehydrogenase; Provisional 99.25
PRK09135 249 pteridine reductase; Provisional 99.25
PRK07677 252 short chain dehydrogenase; Provisional 99.25
PRK08267 260 short chain dehydrogenase; Provisional 99.25
PRK06179 270 short chain dehydrogenase; Provisional 99.25
PRK08642 253 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.25
PRK05650 270 short chain dehydrogenase; Provisional 99.25
PRK09291 257 short chain dehydrogenase; Provisional 99.25
PRK08936 261 glucose-1-dehydrogenase; Provisional 99.24
PRK09186 256 flagellin modification protein A; Provisional 99.24
PRK08226 263 short chain dehydrogenase; Provisional 99.24
PLN02653 340 GDP-mannose 4,6-dehydratase 99.24
TIGR01963 255 PHB_DH 3-hydroxybutyrate dehydrogenase. This model 99.24
PRK08993 253 2-deoxy-D-gluconate 3-dehydrogenase; Validated 99.24
COG4221 246 Short-chain alcohol dehydrogenase of unknown speci 99.23
PRK06924 251 short chain dehydrogenase; Provisional 99.23
PRK12828 239 short chain dehydrogenase; Provisional 99.23
PRK07791 286 short chain dehydrogenase; Provisional 99.23
PRK06125 259 short chain dehydrogenase; Provisional 99.23
KOG1201 300 consensus Hydroxysteroid 17-beta dehydrogenase 11 99.23
PRK08264 238 short chain dehydrogenase; Validated 99.23
PRK07775 274 short chain dehydrogenase; Provisional 99.22
PRK06196 315 oxidoreductase; Provisional 99.22
PRK07533 258 enoyl-(acyl carrier protein) reductase; Provisiona 99.22
PRK12827 249 short chain dehydrogenase; Provisional 99.22
PRK06171 266 sorbitol-6-phosphate 2-dehydrogenase; Provisional 99.22
PRK15181 348 Vi polysaccharide biosynthesis protein TviC; Provi 99.21
PRK08416 260 7-alpha-hydroxysteroid dehydrogenase; Provisional 99.21
PLN02427 386 UDP-apiose/xylose synthase 99.21
PRK06180 277 short chain dehydrogenase; Provisional 99.2
PRK06181 263 short chain dehydrogenase; Provisional 99.2
PRK08063 250 enoyl-(acyl carrier protein) reductase; Provisiona 99.2
PRK08594 257 enoyl-(acyl carrier protein) reductase; Provisiona 99.2
PLN02657 390 3,8-divinyl protochlorophyllide a 8-vinyl reductas 99.2
KOG1208 314 consensus Dehydrogenases with different specificit 99.2
PRK07201 657 short chain dehydrogenase; Provisional 99.2
PF00106 167 adh_short: short chain dehydrogenase alcohol dehyd 99.19
PRK05872 296 short chain dehydrogenase; Provisional 99.19
PRK06500 249 short chain dehydrogenase; Provisional 99.19
PLN02780 320 ketoreductase/ oxidoreductase 99.19
PRK12748 256 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 99.19
PRK12747 252 short chain dehydrogenase; Provisional 99.18
PRK06398 258 aldose dehydrogenase; Validated 99.18
PRK12384 259 sorbitol-6-phosphate dehydrogenase; Provisional 99.18
PRK12935 247 acetoacetyl-CoA reductase; Provisional 99.18
PRK12746 254 short chain dehydrogenase; Provisional 99.18
PRK06198 260 short chain dehydrogenase; Provisional 99.18
PRK12938 246 acetyacetyl-CoA reductase; Provisional 99.17
PRK06123 248 short chain dehydrogenase; Provisional 99.17
PRK12824 245 acetoacetyl-CoA reductase; Provisional 99.17
TIGR02415 254 23BDH acetoin reductases. One member of this famil 99.17
PRK07074 257 short chain dehydrogenase; Provisional 99.17
PRK06079 252 enoyl-(acyl carrier protein) reductase; Provisiona 99.17
CHL00194 317 ycf39 Ycf39; Provisional 99.17
PRK05855 582 short chain dehydrogenase; Validated 99.17
PRK06841 255 short chain dehydrogenase; Provisional 99.16
PRK10538 248 malonic semialdehyde reductase; Provisional 99.16
PRK08415 274 enoyl-(acyl carrier protein) reductase; Provisiona 99.16
PRK06550 235 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.16
PRK08703 239 short chain dehydrogenase; Provisional 99.16
KOG1371 343 consensus UDP-glucose 4-epimerase/UDP-sulfoquinovo 99.16
PRK05993 277 short chain dehydrogenase; Provisional 99.15
PRK07023 243 short chain dehydrogenase; Provisional 99.15
PLN00141 251 Tic62-NAD(P)-related group II protein; Provisional 99.15
PLN02686 367 cinnamoyl-CoA reductase 99.15
PRK05599 246 hypothetical protein; Provisional 99.15
PRK06505 271 enoyl-(acyl carrier protein) reductase; Provisiona 99.14
PLN02206 442 UDP-glucuronate decarboxylase 99.14
PRK12936 245 3-ketoacyl-(acyl-carrier-protein) reductase NodG; 99.14
COG1087 329 GalE UDP-glucose 4-epimerase [Cell envelope biogen 99.14
PRK06523 260 short chain dehydrogenase; Provisional 99.14
PRK06182 273 short chain dehydrogenase; Validated 99.14
PLN03209 576 translocon at the inner envelope of chloroplast su 99.13
PRK06483 236 dihydromonapterin reductase; Provisional 99.13
PRK07984 262 enoyl-(acyl carrier protein) reductase; Provisiona 99.13
TIGR01831 239 fabG_rel 3-oxoacyl-(acyl-carrier-protein) reductas 99.13
PRK08945 247 putative oxoacyl-(acyl carrier protein) reductase; 99.13
PRK06463 255 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.13
PRK06940 275 short chain dehydrogenase; Provisional 99.13
PRK06057 255 short chain dehydrogenase; Provisional 99.13
PRK06482 276 short chain dehydrogenase; Provisional 99.12
PRK12829 264 short chain dehydrogenase; Provisional 99.12
PRK08220 252 2,3-dihydroxybenzoate-2,3-dehydrogenase; Validated 99.12
PRK08263 275 short chain dehydrogenase; Provisional 99.12
KOG4169 261 consensus 15-hydroxyprostaglandin dehydrogenase an 99.11
TIGR03589 324 PseB UDP-N-acetylglucosamine 4,6-dehydratase. This 99.11
PF13460 183 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X 99.1
PRK09730 247 putative NAD(P)-binding oxidoreductase; Provisiona 99.1
PLN02166 436 dTDP-glucose 4,6-dehydratase 99.1
PRK08177 225 short chain dehydrogenase; Provisional 99.1
PRK06484 520 short chain dehydrogenase; Validated 99.09
TIGR01829 242 AcAcCoA_reduct acetoacetyl-CoA reductase. (R)-3-hy 99.08
PLN02572 442 UDP-sulfoquinovose synthase 99.08
PRK07424 406 bifunctional sterol desaturase/short chain dehydro 99.08
PRK07831 262 short chain dehydrogenase; Provisional 99.08
PRK08690 261 enoyl-(acyl carrier protein) reductase; Provisiona 99.08
TIGR01500 256 sepiapter_red sepiapterin reductase. This model de 99.08
PRK08219 227 short chain dehydrogenase; Provisional 99.07
PRK08159 272 enoyl-(acyl carrier protein) reductase; Provisiona 99.06
PRK05884 223 short chain dehydrogenase; Provisional 99.05
PRK07889 256 enoyl-(acyl carrier protein) reductase; Provisiona 99.05
TIGR01830 239 3oxo_ACP_reduc 3-oxoacyl-(acyl-carrier-protein) re 99.04
PRK10675 338 UDP-galactose-4-epimerase; Provisional 99.04
PRK06603 260 enoyl-(acyl carrier protein) reductase; Provisiona 99.04
PRK08017 256 oxidoreductase; Provisional 99.04
PRK11908 347 NAD-dependent epimerase/dehydratase family protein 99.03
KOG1014 312 consensus 17 beta-hydroxysteroid dehydrogenase typ 99.03
TIGR02685 267 pter_reduc_Leis pteridine reductase. Pteridine red 99.03
PRK08125 660 bifunctional UDP-glucuronic acid decarboxylase/UDP 99.03
PRK05693 274 short chain dehydrogenase; Provisional 99.03
PLN00015 308 protochlorophyllide reductase 99.02
PRK07060 245 short chain dehydrogenase; Provisional 99.02
PRK07832 272 short chain dehydrogenase; Provisional 99.01
smart00822 180 PKS_KR This enzymatic domain is part of bacterial 99.01
PRK06484 520 short chain dehydrogenase; Validated 99.0
PRK10217 355 dTDP-glucose 4,6-dehydratase; Provisional 98.99
COG0451 314 WcaG Nucleoside-diphosphate-sugar epimerases [Cell 98.99
TIGR02632 676 RhaD_aldol-ADH rhamnulose-1-phosphate aldolase/alc 98.99
PF08659 181 KR: KR domain; InterPro: IPR013968 This domain is 98.98
PLN02695 370 GDP-D-mannose-3',5'-epimerase 98.97
PRK08324 681 short chain dehydrogenase; Validated 98.96
TIGR03466 328 HpnA hopanoid-associated sugar epimerase. The sequ 98.96
PLN02260 668 probable rhamnose biosynthetic enzyme 98.96
PF01370 236 Epimerase: NAD dependent epimerase/dehydratase fam 98.96
KOG1611 249 consensus Predicted short chain-type dehydrogenase 98.95
PRK12859 256 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 98.95
PRK07041 230 short chain dehydrogenase; Provisional 98.95
PRK06953 222 short chain dehydrogenase; Provisional 98.95
PRK12742 237 oxidoreductase; Provisional 98.93
PRK12320 699 hypothetical protein; Provisional 98.93
PRK07069 251 short chain dehydrogenase; Validated 98.92
COG1028 251 FabG Dehydrogenases with different specificities ( 98.91
TIGR01746 367 Thioester-redct thioester reductase domain. It has 98.91
KOG1429 350 consensus dTDP-glucose 4-6-dehydratase/UDP-glucuro 98.9
COG1088 340 RfbB dTDP-D-glucose 4,6-dehydratase [Cell envelope 98.89
PRK12367 245 short chain dehydrogenase; Provisional 98.89
PRK06997 260 enoyl-(acyl carrier protein) reductase; Provisiona 98.89
PF01073 280 3Beta_HSD: 3-beta hydroxysteroid dehydrogenase/iso 98.89
PRK09009 235 C factor cell-cell signaling protein; Provisional 98.89
PRK07201 657 short chain dehydrogenase; Provisional 98.88
COG1086 588 Predicted nucleoside-diphosphate sugar epimerases 98.88
PLN02730 303 enoyl-[acyl-carrier-protein] reductase 98.87
TIGR01181 317 dTDP_gluc_dehyt dTDP-glucose 4,6-dehydratase. This 98.87
TIGR03649 285 ergot_EASG ergot alkaloid biosynthesis protein, AF 98.87
PRK07577 234 short chain dehydrogenase; Provisional 98.87
PRK08309 177 short chain dehydrogenase; Provisional 98.85
KOG1200 256 consensus Mitochondrial/plastidial beta-ketoacyl-A 98.85
PRK10084 352 dTDP-glucose 4,6 dehydratase; Provisional 98.84
TIGR01777 292 yfcH conserved hypothetical protein TIGR01777. Thi 98.82
TIGR01179 328 galE UDP-glucose-4-epimerase. This enzyme intercon 98.82
COG0702 275 Predicted nucleoside-diphosphate-sugar epimerases 98.8
PRK08261 450 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 98.75
PLN02996 491 fatty acyl-CoA reductase 98.74
KOG1430 361 consensus C-3 sterol dehydrogenase/3-beta-hydroxys 98.73
PF07993 249 NAD_binding_4: Male sterility protein; InterPro: I 98.73
PRK05865 854 hypothetical protein; Provisional 98.72
PLN00016 378 RNA-binding protein; Provisional 98.71
PF02719 293 Polysacc_synt_2: Polysaccharide biosynthesis prote 98.71
PLN02778 298 3,5-epimerase/4-reductase 98.7
PLN02503 605 fatty acyl-CoA reductase 2 98.69
PRK09987 299 dTDP-4-dehydrorhamnose reductase; Provisional 98.66
PRK11150 308 rfaD ADP-L-glycero-D-mannoheptose-6-epimerase; Pro 98.65
COG1090 297 Predicted nucleoside-diphosphate sugar epimerase [ 98.63
KOG1478 341 consensus 3-keto sterol reductase [Lipid transport 98.62
TIGR01214 287 rmlD dTDP-4-dehydrorhamnose reductase. This enzyme 98.6
COG2910 211 Putative NADH-flavin reductase [General function p 98.6
PF05368 233 NmrA: NmrA-like family; InterPro: IPR008030 NmrA i 98.55
PRK13656 398 trans-2-enoyl-CoA reductase; Provisional 98.53
PRK07578 199 short chain dehydrogenase; Provisional 98.52
PRK06300 299 enoyl-(acyl carrier protein) reductase; Provisiona 98.52
KOG1207 245 consensus Diacetyl reductase/L-xylulose reductase 98.52
KOG1210 331 consensus Predicted 3-ketosphinganine reductase [S 98.48
PF04321 286 RmlD_sub_bind: RmlD substrate binding domain; Inte 98.47
KOG1610 322 consensus Corticosteroid 11-beta-dehydrogenase and 98.47
KOG1199 260 consensus Short-chain alcohol dehydrogenase/3-hydr 98.45
KOG1209 289 consensus 1-Acyl dihydroxyacetone phosphate reduct 98.44
COG3320 382 Putative dehydrogenase domain of multifunctional n 98.44
TIGR02197 314 heptose_epim ADP-L-glycero-D-manno-heptose-6-epime 98.44
PRK12548 289 shikimate 5-dehydrogenase; Provisional 98.41
TIGR02813 2582 omega_3_PfaA polyketide-type polyunsaturated fatty 98.41
cd01078 194 NAD_bind_H4MPT_DH NADP binding domain of methylene 98.39
COG1089 345 Gmd GDP-D-mannose dehydratase [Cell envelope bioge 98.33
COG1748 389 LYS9 Saccharopine dehydrogenase and related protei 98.32
PRK09620 229 hypothetical protein; Provisional 98.31
TIGR03443 1389 alpha_am_amid L-aminoadipate-semialdehyde dehydrog 98.3
PF13561 241 adh_short_C2: Enoyl-(Acyl carrier protein) reducta 98.26
PRK14106 450 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 98.25
PRK05579 399 bifunctional phosphopantothenoylcysteine decarboxy 98.21
PRK02472 447 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 98.13
PLN02725 306 GDP-4-keto-6-deoxymannose-3,5-epimerase-4-reductas 98.11
PF01488135 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; 98.1
PLN02260 668 probable rhamnose biosynthetic enzyme 98.09
PRK14982 340 acyl-ACP reductase; Provisional 98.03
PRK06849 389 hypothetical protein; Provisional 97.93
KOG1203 411 consensus Predicted dehydrogenase [Carbohydrate tr 97.92
KOG1221 467 consensus Acyl-CoA reductase [Lipid transport and 97.89
TIGR01915 219 npdG NADPH-dependent F420 reductase. This model re 97.87
KOG2865 391 consensus NADH:ubiquinone oxidoreductase, NDUFA9/3 97.84
PF03435 386 Saccharop_dh: Saccharopine dehydrogenase ; InterPr 97.8
PRK00258278 aroE shikimate 5-dehydrogenase; Reviewed 97.77
cd01336 325 MDH_cytoplasmic_cytosolic Cytoplasmic and cytosoli 97.76
COG0569 225 TrkA K+ transport systems, NAD-binding component [ 97.72
PRK06732 229 phosphopantothenate--cysteine ligase; Validated 97.71
PLN02520529 bifunctional 3-dehydroquinate dehydratase/shikimat 97.68
TIGR00715 256 precor6x_red precorrin-6x reductase. This enzyme w 97.67
COG1091 281 RfbD dTDP-4-dehydrorhamnose reductase [Cell envelo 97.67
TIGR00507270 aroE shikimate 5-dehydrogenase. This model finds p 97.64
cd01075 200 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of l 97.64
PRK09496 453 trkA potassium transporter peripheral membrane com 97.64
PRK08655 437 prephenate dehydrogenase; Provisional 97.63
TIGR00521 390 coaBC_dfp phosphopantothenoylcysteine decarboxylas 97.61
KOG0747 331 consensus Putative NAD+-dependent epimerases [Carb 97.61
PRK09496 453 trkA potassium transporter peripheral membrane com 97.59
PRK07819 286 3-hydroxybutyryl-CoA dehydrogenase; Validated 97.53
cd01065155 NAD_bind_Shikimate_DH NAD(P) binding domain of Shi 97.53
PF01118121 Semialdhyde_dh: Semialdehyde dehydrogenase, NAD bi 97.51
TIGR02114 227 coaB_strep phosphopantothenate--cysteine ligase, s 97.5
PRK06249 313 2-dehydropantoate 2-reductase; Provisional 97.5
PF02737 180 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD bind 97.48
PRK14874 334 aspartate-semialdehyde dehydrogenase; Provisional 97.46
KOG1372 376 consensus GDP-mannose 4,6 dehydratase [Carbohydrat 97.46
PRK11199 374 tyrA bifunctional chorismate mutase/prephenate deh 97.43
COG0623 259 FabI Enoyl-[acyl-carrier-protein] 97.42
COG2085 211 Predicted dinucleotide-binding enzymes [General fu 97.41
PRK06129 308 3-hydroxyacyl-CoA dehydrogenase; Validated 97.35
PRK04308 445 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 97.32
PRK08664 349 aspartate-semialdehyde dehydrogenase; Reviewed 97.31
cd01080168 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of 97.28
PLN02968 381 Probable N-acetyl-gamma-glutamyl-phosphate reducta 97.26
PRK06444 197 prephenate dehydrogenase; Provisional 97.26
PRK06718 202 precorrin-2 dehydrogenase; Reviewed 97.25
PF00056141 Ldh_1_N: lactate/malate dehydrogenase, NAD binding 97.24
PRK09310477 aroDE bifunctional 3-dehydroquinate dehydratase/sh 97.24
TIGR02853287 spore_dpaA dipicolinic acid synthetase, A subunit. 97.19
PF1224278 Eno-Rase_NADH_b: NAD(P)H binding domain of trans-2 97.17
PRK00066 315 ldh L-lactate dehydrogenase; Reviewed 97.16
TIGR01470 205 cysG_Nterm siroheme synthase, N-terminal domain. T 97.13
KOG2733 423 consensus Uncharacterized membrane protein [Functi 97.13
PF13241103 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_ 97.12
PRK00436 343 argC N-acetyl-gamma-glutamyl-phosphate reductase; 97.11
PF01113124 DapB_N: Dihydrodipicolinate reductase, N-terminus; 97.11
PRK05671 336 aspartate-semialdehyde dehydrogenase; Reviewed 97.09
PRK14188296 bifunctional 5,10-methylene-tetrahydrofolate dehyd 97.08
PRK06522 304 2-dehydropantoate 2-reductase; Reviewed 97.06
PRK04148134 hypothetical protein; Provisional 97.06
KOG4039 238 consensus Serine/threonine kinase TIP30/CC3 [Signa 97.03
cd08259 332 Zn_ADH5 Alcohol dehydrogenases of the MDR family. 96.99
cd05212140 NAD_bind_m-THF_DH_Cyclohyd_like NAD(P) binding dom 96.99
PRK12549284 shikimate 5-dehydrogenase; Reviewed 96.98
PRK05086 312 malate dehydrogenase; Provisional 96.97
PRK14175286 bifunctional 5,10-methylene-tetrahydrofolate dehyd 96.97
PRK07530 292 3-hydroxybutyryl-CoA dehydrogenase; Validated 96.96
cd08295 338 double_bond_reductase_like Arabidopsis alkenal dou 96.96
PRK14192283 bifunctional 5,10-methylene-tetrahydrofolate dehyd 96.95
PRK01438 480 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 96.95
PF03446 163 NAD_binding_2: NAD binding domain of 6-phosphogluc 96.93
PLN00106 323 malate dehydrogenase 96.93
COG0240 329 GpsA Glycerol-3-phosphate dehydrogenase [Energy pr 96.93
KOG1431 315 consensus GDP-L-fucose synthetase [Carbohydrate tr 96.92
cd08294 329 leukotriene_B4_DH_like 13-PGR is a bifunctional en 96.9
TIGR02354 200 thiF_fam2 thiamine biosynthesis protein ThiF, fami 96.89
cd05294 309 LDH-like_MDH_nadp A lactate dehydrogenases-like st 96.89
PRK14194301 bifunctional 5,10-methylene-tetrahydrofolate dehyd 96.89
COG5322 351 Predicted dehydrogenase [General function predicti 96.87
PRK09260 288 3-hydroxybutyryl-CoA dehydrogenase; Validated 96.87
PF02254116 TrkA_N: TrkA-N domain; InterPro: IPR003148 The reg 96.86
PRK14619 308 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 96.85
PRK07688 339 thiamine/molybdopterin biosynthesis ThiF/MoeB-like 96.85
PRK05690 245 molybdopterin biosynthesis protein MoeB; Provision 96.83
PTZ00325 321 malate dehydrogenase; Provisional 96.8
TIGR02825 325 B4_12hDH leukotriene B4 12-hydroxydehydrogenase/15 96.8
PRK00094 325 gpsA NAD(P)H-dependent glycerol-3-phosphate dehydr 96.78
cd05276 323 p53_inducible_oxidoreductase PIG3 p53-inducible qu 96.77
PRK08306296 dipicolinate synthase subunit A; Reviewed 96.77
PF02826178 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehy 96.77
PRK12475 338 thiamine/molybdopterin biosynthesis MoeB-like prot 96.77
cd0519186 NAD_bind_amino_acid_DH NAD(P) binding domain of am 96.76
cd05291 306 HicDH_like L-2-hydroxyisocapronate dehydrogenases 96.74
PRK07417 279 arogenate dehydrogenase; Reviewed 96.73
cd08253 325 zeta_crystallin Zeta-crystallin with NADP-dependen 96.72
PRK14027283 quinate/shikimate dehydrogenase; Provisional 96.71
PRK14618 328 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 96.7
PRK11064 415 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Pro 96.69
cd08293 345 PTGR2 Prostaglandin reductase. Prostaglandins and 96.69
PRK08293 287 3-hydroxybutyryl-CoA dehydrogenase; Validated 96.69
PF03721 185 UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogen 96.69
PLN02545 295 3-hydroxybutyryl-CoA dehydrogenase 96.67
TIGR01809282 Shik-DH-AROM shikimate-5-dehydrogenase, fungal ARO 96.67
PLN03154 348 putative allyl alcohol dehydrogenase; Provisional 96.66
COG0287 279 TyrA Prephenate dehydrogenase [Amino acid transpor 96.66
PF02882160 THF_DHG_CYH_C: Tetrahydrofolate dehydrogenase/cycl 96.65
KOG1198 347 consensus Zinc-binding oxidoreductase [Energy prod 96.63
COG0604 326 Qor NADPH:quinone reductase and related Zn-depende 96.59
PRK08268 507 3-hydroxy-acyl-CoA dehydrogenase; Validated 96.59
PLN02383 344 aspartate semialdehyde dehydrogenase 96.57
PRK06719157 precorrin-2 dehydrogenase; Validated 96.56
cd00704 323 MDH Malate dehydrogenase. Malate dehydrogenase (MD 96.55
PRK02006 498 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 96.55
cd01483143 E1_enzyme_family Superfamily of activating enzymes 96.54
PRK05442 326 malate dehydrogenase; Provisional 96.53
cd01338 322 MDH_choloroplast_like Chloroplast-like malate dehy 96.49
PRK06130 311 3-hydroxybutyryl-CoA dehydrogenase; Validated 96.49
cd08266 342 Zn_ADH_like1 Alcohol dehydrogenases of the MDR fam 96.49
cd08268 328 MDR2 Medium chain dehydrogenases/reductase (MDR)/z 96.49
TIGR01850 346 argC N-acetyl-gamma-glutamyl-phosphate reductase, 96.48
PRK14620 326 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 96.48
COG0169283 AroE Shikimate 5-dehydrogenase [Amino acid transpo 96.47
PRK06035 291 3-hydroxyacyl-CoA dehydrogenase; Validated 96.47
TIGR01035 417 hemA glutamyl-tRNA reductase. This enzyme, togethe 96.46
PF01210157 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate 96.45
TIGR02356 202 adenyl_thiF thiazole biosynthesis adenylyltransfer 96.44
TIGR01296 339 asd_B aspartate-semialdehyde dehydrogenase (peptid 96.43
PRK07531 495 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioe 96.41
cd01485 198 E1-1_like Ubiquitin activating enzyme (E1), repeat 96.4
PLN02256 304 arogenate dehydrogenase 96.4
PRK07066 321 3-hydroxybutyryl-CoA dehydrogenase; Validated 96.39
PRK13243 333 glyoxylate reductase; Reviewed 96.39
cd01337 310 MDH_glyoxysomal_mitochondrial Glyoxysomal and mito 96.38
PRK05808 282 3-hydroxybutyryl-CoA dehydrogenase; Validated 96.37
PRK00141 473 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 96.37
PRK10669558 putative cation:proton antiport protein; Provision 96.37
PF12076 164 Wax2_C: WAX2 C-terminal domain; InterPro: IPR02194 96.36
PRK06223 307 malate dehydrogenase; Reviewed 96.35
PRK05476 425 S-adenosyl-L-homocysteine hydrolase; Provisional 96.34
PRK08229 341 2-dehydropantoate 2-reductase; Provisional 96.34
cd05311 226 NAD_bind_2_malic_enz NAD(P) binding domain of mali 96.32
PRK12749 288 quinate/shikimate dehydrogenase; Reviewed 96.32
TIGR02279 503 PaaC-3OHAcCoADH 3-hydroxyacyl-CoA dehydrogenase Pa 96.31
cd00757 228 ThiF_MoeB_HesA_family ThiF_MoeB_HesA. Family of E1 96.3
PRK13940 414 glutamyl-tRNA reductase; Provisional 96.29
TIGR02824 325 quinone_pig3 putative NAD(P)H quinone oxidoreducta 96.28
PRK10792285 bifunctional 5,10-methylene-tetrahydrofolate dehyd 96.28
PRK12550272 shikimate 5-dehydrogenase; Reviewed 96.28
cd08289 326 MDR_yhfp_like Yhfp putative quinone oxidoreductase 96.26
KOG0409 327 consensus Predicted dehydrogenase [General functio 96.25
PTZ00117 319 malate dehydrogenase; Provisional 96.25
PRK07502 307 cyclohexadienyl dehydrogenase; Validated 96.25
TIGR00978 341 asd_EA aspartate-semialdehyde dehydrogenase (non-p 96.22
PF04127 185 DFP: DNA / pantothenate metabolism flavoprotein; I 96.22
PRK11559 296 garR tartronate semialdehyde reductase; Provisiona 96.2
PRK08644 212 thiamine biosynthesis protein ThiF; Provisional 96.2
COG1064 339 AdhP Zn-dependent alcohol dehydrogenases [General 96.2
PRK05597 355 molybdopterin biosynthesis protein MoeB; Validated 96.19
KOG4022 236 consensus Dihydropteridine reductase DHPR/QDPR [Am 96.19
cd08250 329 Mgc45594_like Mgc45594 gene product and other MDR 96.19
cd05292 308 LDH_2 A subgroup of L-lactate dehydrogenases. L-la 96.18
PRK14179284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 96.18
cd00650 263 LDH_MDH_like NAD-dependent, lactate dehydrogenase- 96.17
TIGR03201 349 dearomat_had 6-hydroxycyclohex-1-ene-1-carbonyl-Co 96.17
PTZ00345 365 glycerol-3-phosphate dehydrogenase; Provisional 96.16
TIGR01758 324 MDH_euk_cyt malate dehydrogenase, NAD-dependent. T 96.14
cd01487 174 E1_ThiF_like E1_ThiF_like. Member of superfamily o 96.13
PRK12409 410 D-amino acid dehydrogenase small subunit; Provisio 96.12
PF0380796 F420_oxidored: NADP oxidoreductase coenzyme F420-d 96.12
PRK13236 296 nitrogenase reductase; Reviewed 96.11
PF00899135 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-a 96.1
TIGR01759 323 MalateDH-SF1 malate dehydrogenase. This model repr 96.1
PRK11880 267 pyrroline-5-carboxylate reductase; Reviewed 96.08
COG0665 387 DadA Glycine/D-amino acid oxidases (deaminating) [ 96.07
PRK12480 330 D-lactate dehydrogenase; Provisional 96.06
cd05288 329 PGDH Prostaglandin dehydrogenases. Prostaglandins 96.06
PRK09880 343 L-idonate 5-dehydrogenase; Provisional 96.04
PRK14189285 bifunctional 5,10-methylene-tetrahydrofolate dehyd 96.03
COG0039 313 Mdh Malate/lactate dehydrogenases [Energy producti 96.03
COG0190283 FolD 5,10-methylene-tetrahydrofolate dehydrogenase 96.03
PRK07236 386 hypothetical protein; Provisional 96.03
cd01079197 NAD_bind_m-THF_DH NAD binding domain of methylene- 96.02
PRK13982 475 bifunctional SbtC-like/phosphopantothenoylcysteine 96.02
cd05188271 MDR Medium chain reductase/dehydrogenase (MDR)/zin 96.02
PRK00045 423 hemA glutamyl-tRNA reductase; Reviewed 96.01
PRK13886 241 conjugal transfer protein TraL; Provisional 96.0
PLN00203 519 glutamyl-tRNA reductase 95.99
PLN02712 667 arogenate dehydrogenase 95.99
PRK14177284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 95.99
PRK14176287 bifunctional 5,10-methylene-tetrahydrofolate dehyd 95.98
PRK07494 388 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio 95.98
PRK08818 370 prephenate dehydrogenase; Provisional 95.97
cd08270 305 MDR4 Medium chain dehydrogenases/reductase (MDR)/z 95.97
TIGR01772 312 MDH_euk_gproteo malate dehydrogenase, NAD-dependen 95.96
TIGR00872 298 gnd_rel 6-phosphogluconate dehydrogenase (decarbox 95.95
TIGR03026 411 NDP-sugDHase nucleotide sugar dehydrogenase. All o 95.94
PRK08163 396 salicylate hydroxylase; Provisional 95.93
PRK14191285 bifunctional 5,10-methylene-tetrahydrofolate dehyd 95.92
cd08241 323 QOR1 Quinone oxidoreductase (QOR). QOR catalyzes t 95.92
PRK06728 347 aspartate-semialdehyde dehydrogenase; Provisional 95.91
PTZ00082 321 L-lactate dehydrogenase; Provisional 95.9
cd01492 197 Aos1_SUMO Ubiquitin activating enzyme (E1) subunit 95.9
TIGR00518 370 alaDH alanine dehydrogenase. The family of known L 95.9
cd08244 324 MDR_enoyl_red Possible enoyl reductase. Member ide 95.88
cd08292 324 ETR_like_2 2-enoyl thioester reductase (ETR) like 95.88
TIGR02822 329 adh_fam_2 zinc-binding alcohol dehydrogenase famil 95.88
PRK12767 326 carbamoyl phosphate synthase-like protein; Provisi 95.88
KOG1204 253 consensus Predicted dehydrogenase [Secondary metab 95.87
PRK03659 601 glutathione-regulated potassium-efflux system prot 95.86
PF00208 244 ELFV_dehydrog: Glutamate/Leucine/Phenylalanine/Val 95.85
PF0007080 Pyr_redox: Pyridine nucleotide-disulphide oxidored 95.84
cd08243 320 quinone_oxidoreductase_like_1 Quinone oxidoreducta 95.84
cd05213311 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain 95.84
>KOG1502 consensus Flavonol reductase/cinnamoyl-CoA reductase [Defense mechanisms] Back     alignment and domain information
Probab=99.60  E-value=1e-14  Score=77.88  Aligned_cols=61  Identities=66%  Similarity=1.061  Sum_probs=53.3

Q ss_pred             CCeEEEEecCcchHHHHHHHHHHHCCCEEEEEEeCCCCcch-hHHhhhcCCCCceEEEEccC
Q 036468            4 KGKVVCVTGASGFIASWLVKLLLQRSYTVKATVRDLNNHNA-EHLLTLDGAEERLHLFKANS   64 (64)
Q Consensus         4 ~~~~~~i~g~~~~ig~~~~~~l~~~~~~v~~~~r~~~~~~~-~~~~~~~~~~~~~~~~~~Di   64 (64)
                      .++.|+||||+|+||++++++|+++||.|....|++++.+. .++.++.....++..+..|+
T Consensus         5 ~~~~VcVTGAsGfIgswivk~LL~rGY~V~gtVR~~~~~k~~~~L~~l~~a~~~l~l~~aDL   66 (327)
T KOG1502|consen    5 EGKKVCVTGASGFIGSWIVKLLLSRGYTVRGTVRDPEDEKKTEHLRKLEGAKERLKLFKADL   66 (327)
T ss_pred             CCcEEEEeCCchHHHHHHHHHHHhCCCEEEEEEcCcchhhhHHHHHhcccCcccceEEeccc
Confidence            46789999999999999999999999999999999988554 46888877677788998886



>PRK07478 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05653 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated Back     alignment and domain information
>COG0300 DltE Short-chain dehydrogenases of various substrate specificities [General function prediction only] Back     alignment and domain information
>PRK06194 hypothetical protein; Provisional Back     alignment and domain information
>PRK05867 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07231 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PLN02986 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>PRK07890 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09072 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06114 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05866 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05557 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated Back     alignment and domain information
>PRK07035 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06172 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07523 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK08862 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07453 protochlorophyllide oxidoreductase; Validated Back     alignment and domain information
>PLN02583 cinnamoyl-CoA reductase Back     alignment and domain information
>PRK13394 3-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>TIGR01832 kduD 2-deoxy-D-gluconate 3-dehydrogenase Back     alignment and domain information
>PRK08085 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK12429 3-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>PRK08339 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08628 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07576 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN02662 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>PRK12826 3-ketoacyl-(acyl-carrier-protein) reductase; Reviewed Back     alignment and domain information
>PRK07774 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06139 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN02650 dihydroflavonol-4-reductase Back     alignment and domain information
>PRK06138 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05876 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12481 2-deoxy-D-gluconate 3-dehydrogenase; Provisional Back     alignment and domain information
>PRK12937 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07806 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN02989 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>PRK07814 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06124 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK08277 D-mannonate oxidoreductase; Provisional Back     alignment and domain information
>PRK08589 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK07109 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06935 2-deoxy-D-gluconate 3-dehydrogenase; Provisional Back     alignment and domain information
>PRK05854 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08278 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07063 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12745 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>TIGR03325 BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase Back     alignment and domain information
>PRK07326 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08643 acetoin reductase; Validated Back     alignment and domain information
>PRK07097 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK07904 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07825 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06701 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08213 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PLN02214 cinnamoyl-CoA reductase Back     alignment and domain information
>PRK07454 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06197 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09134 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08265 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06720 hypothetical protein; Provisional Back     alignment and domain information
>PRK07666 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK07062 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05565 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK07024 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12823 benD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylate dehydrogenase; Provisional Back     alignment and domain information
>PRK05786 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK06914 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07792 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK08217 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PLN02240 UDP-glucose 4-epimerase Back     alignment and domain information
>PRK12743 oxidoreductase; Provisional Back     alignment and domain information
>PRK07102 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06113 7-alpha-hydroxysteroid dehydrogenase; Validated Back     alignment and domain information
>PLN02253 xanthoxin dehydrogenase Back     alignment and domain information
>PRK06128 oxidoreductase; Provisional Back     alignment and domain information
>PRK08251 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG3967 DltE Short-chain dehydrogenase involved in D-alanine esterification of lipoteichoic acid and wall teichoic acid (D-alanine transfer protein) [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK08303 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07856 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN00198 anthocyanidin reductase; Provisional Back     alignment and domain information
>TIGR03206 benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydrogenase Back     alignment and domain information
>PRK06200 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrogenase; Provisional Back     alignment and domain information
>PRK06077 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK07067 sorbitol dehydrogenase; Provisional Back     alignment and domain information
>PRK06101 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12939 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR01472 gmd GDP-mannose 4,6-dehydratase Back     alignment and domain information
>TIGR01289 LPOR light-dependent protochlorophyllide reductase Back     alignment and domain information
>PRK05875 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG0725 consensus Reductases with broad range of substrate specificities [General function prediction only] Back     alignment and domain information
>PRK07985 oxidoreductase; Provisional Back     alignment and domain information
>PLN02896 cinnamyl-alcohol dehydrogenase Back     alignment and domain information
>KOG1205 consensus Predicted dehydrogenase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK05717 oxidoreductase; Validated Back     alignment and domain information
>PRK06949 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08340 glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>PRK07370 enoyl-(acyl carrier protein) reductase; Validated Back     alignment and domain information
>TIGR02622 CDP_4_6_dhtase CDP-glucose 4,6-dehydratase Back     alignment and domain information
>PRK12825 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK06947 glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>PRK09242 tropinone reductase; Provisional Back     alignment and domain information
>PRK12744 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09135 pteridine reductase; Provisional Back     alignment and domain information
>PRK07677 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08267 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06179 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08642 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK05650 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09291 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08936 glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>PRK09186 flagellin modification protein A; Provisional Back     alignment and domain information
>PRK08226 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN02653 GDP-mannose 4,6-dehydratase Back     alignment and domain information
>TIGR01963 PHB_DH 3-hydroxybutyrate dehydrogenase Back     alignment and domain information
>PRK08993 2-deoxy-D-gluconate 3-dehydrogenase; Validated Back     alignment and domain information
>COG4221 Short-chain alcohol dehydrogenase of unknown specificity [General function prediction only] Back     alignment and domain information
>PRK06924 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12828 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07791 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06125 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG1201 consensus Hydroxysteroid 17-beta dehydrogenase 11 [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK08264 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK07775 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06196 oxidoreductase; Provisional Back     alignment and domain information
>PRK07533 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK12827 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06171 sorbitol-6-phosphate 2-dehydrogenase; Provisional Back     alignment and domain information
>PRK15181 Vi polysaccharide biosynthesis protein TviC; Provisional Back     alignment and domain information
>PRK08416 7-alpha-hydroxysteroid dehydrogenase; Provisional Back     alignment and domain information
>PLN02427 UDP-apiose/xylose synthase Back     alignment and domain information
>PRK06180 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06181 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08063 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK08594 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PLN02657 3,8-divinyl protochlorophyllide a 8-vinyl reductase Back     alignment and domain information
>KOG1208 consensus Dehydrogenases with different specificities (related to short-chain alcohol dehydrogenases) [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK07201 short chain dehydrogenase; Provisional Back     alignment and domain information
>PF00106 adh_short: short chain dehydrogenase alcohol dehydrogenase superfamily signature glucose/ribitol dehydrogenase family signature; InterPro: IPR002198 The short-chain dehydrogenases/reductases family (SDR) [] is a very large family of enzymes, most of which are known to be NAD- or NADP-dependent oxidoreductases Back     alignment and domain information
>PRK05872 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06500 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN02780 ketoreductase/ oxidoreductase Back     alignment and domain information
>PRK12748 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK12747 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06398 aldose dehydrogenase; Validated Back     alignment and domain information
>PRK12384 sorbitol-6-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK12935 acetoacetyl-CoA reductase; Provisional Back     alignment and domain information
>PRK12746 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06198 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12938 acetyacetyl-CoA reductase; Provisional Back     alignment and domain information
>PRK06123 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12824 acetoacetyl-CoA reductase; Provisional Back     alignment and domain information
>TIGR02415 23BDH acetoin reductases Back     alignment and domain information
>PRK07074 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06079 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>CHL00194 ycf39 Ycf39; Provisional Back     alignment and domain information
>PRK05855 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK06841 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK10538 malonic semialdehyde reductase; Provisional Back     alignment and domain information
>PRK08415 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK06550 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK08703 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG1371 consensus UDP-glucose 4-epimerase/UDP-sulfoquinovose synthase [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>PRK05993 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07023 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN00141 Tic62-NAD(P)-related group II protein; Provisional Back     alignment and domain information
>PLN02686 cinnamoyl-CoA reductase Back     alignment and domain information
>PRK05599 hypothetical protein; Provisional Back     alignment and domain information
>PRK06505 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PLN02206 UDP-glucuronate decarboxylase Back     alignment and domain information
>PRK12936 3-ketoacyl-(acyl-carrier-protein) reductase NodG; Reviewed Back     alignment and domain information
>COG1087 GalE UDP-glucose 4-epimerase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK06523 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06182 short chain dehydrogenase; Validated Back     alignment and domain information
>PLN03209 translocon at the inner envelope of chloroplast subunit 62; Provisional Back     alignment and domain information
>PRK06483 dihydromonapterin reductase; Provisional Back     alignment and domain information
>PRK07984 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>TIGR01831 fabG_rel 3-oxoacyl-(acyl-carrier-protein) reductase, putative Back     alignment and domain information
>PRK08945 putative oxoacyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK06463 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK06940 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06057 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06482 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12829 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08220 2,3-dihydroxybenzoate-2,3-dehydrogenase; Validated Back     alignment and domain information
>PRK08263 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG4169 consensus 15-hydroxyprostaglandin dehydrogenase and related dehydrogenases [Lipid transport and metabolism; General function prediction only] Back     alignment and domain information
>TIGR03589 PseB UDP-N-acetylglucosamine 4,6-dehydratase Back     alignment and domain information
>PF13460 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X_A 3GPI_A 3QVO_A 2Q46_B 1YBM_B 1XQ6_B 2Q4B_B 3EW7_A 3IUS_B Back     alignment and domain information
>PRK09730 putative NAD(P)-binding oxidoreductase; Provisional Back     alignment and domain information
>PLN02166 dTDP-glucose 4,6-dehydratase Back     alignment and domain information
>PRK08177 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06484 short chain dehydrogenase; Validated Back     alignment and domain information
>TIGR01829 AcAcCoA_reduct acetoacetyl-CoA reductase Back     alignment and domain information
>PLN02572 UDP-sulfoquinovose synthase Back     alignment and domain information
>PRK07424 bifunctional sterol desaturase/short chain dehydrogenase; Validated Back     alignment and domain information
>PRK07831 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08690 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>TIGR01500 sepiapter_red sepiapterin reductase Back     alignment and domain information
>PRK08219 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08159 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK05884 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07889 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>TIGR01830 3oxo_ACP_reduc 3-oxoacyl-(acyl-carrier-protein) reductase Back     alignment and domain information
>PRK10675 UDP-galactose-4-epimerase; Provisional Back     alignment and domain information
>PRK06603 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK08017 oxidoreductase; Provisional Back     alignment and domain information
>PRK11908 NAD-dependent epimerase/dehydratase family protein; Provisional Back     alignment and domain information
>KOG1014 consensus 17 beta-hydroxysteroid dehydrogenase type 3, HSD17B3 [Lipid transport and metabolism] Back     alignment and domain information
>TIGR02685 pter_reduc_Leis pteridine reductase Back     alignment and domain information
>PRK08125 bifunctional UDP-glucuronic acid decarboxylase/UDP-4-amino-4-deoxy-L-arabinose formyltransferase; Validated Back     alignment and domain information
>PRK05693 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN00015 protochlorophyllide reductase Back     alignment and domain information
>PRK07060 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07832 short chain dehydrogenase; Provisional Back     alignment and domain information
>smart00822 PKS_KR This enzymatic domain is part of bacterial polyketide synthases and catalyses the first step in the reductive modification of the beta-carbonyl centres in the growing polyketide chain Back     alignment and domain information
>PRK06484 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK10217 dTDP-glucose 4,6-dehydratase; Provisional Back     alignment and domain information
>COG0451 WcaG Nucleoside-diphosphate-sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR02632 RhaD_aldol-ADH rhamnulose-1-phosphate aldolase/alcohol dehydrogenase Back     alignment and domain information
>PF08659 KR: KR domain; InterPro: IPR013968 This domain is found in bacterial polyketide synthases that catalyse the first step in the reductive modification of the beta-carbonyl centres in the growing polyketide chain Back     alignment and domain information
>PLN02695 GDP-D-mannose-3',5'-epimerase Back     alignment and domain information
>PRK08324 short chain dehydrogenase; Validated Back     alignment and domain information
>TIGR03466 HpnA hopanoid-associated sugar epimerase Back     alignment and domain information
>PLN02260 probable rhamnose biosynthetic enzyme Back     alignment and domain information
>PF01370 Epimerase: NAD dependent epimerase/dehydratase family; InterPro: IPR001509 This family of proteins utilise NAD as a cofactor Back     alignment and domain information
>KOG1611 consensus Predicted short chain-type dehydrogenase [General function prediction only] Back     alignment and domain information
>PRK12859 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK07041 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06953 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12742 oxidoreductase; Provisional Back     alignment and domain information
>PRK12320 hypothetical protein; Provisional Back     alignment and domain information
>PRK07069 short chain dehydrogenase; Validated Back     alignment and domain information
>COG1028 FabG Dehydrogenases with different specificities (related to short-chain alcohol dehydrogenases) [Secondary metabolites biosynthesis, transport, and catabolism / General function prediction only] Back     alignment and domain information
>TIGR01746 Thioester-redct thioester reductase domain Back     alignment and domain information
>KOG1429 consensus dTDP-glucose 4-6-dehydratase/UDP-glucuronic acid decarboxylase [Carbohydrate transport and metabolism; Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>COG1088 RfbB dTDP-D-glucose 4,6-dehydratase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK12367 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06997 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PF01073 3Beta_HSD: 3-beta hydroxysteroid dehydrogenase/isomerase family; InterPro: IPR002225 The enzyme 3 beta-hydroxysteroid dehydrogenase/5-ene-4-ene isomerase (3 beta-HSD) catalyses the oxidation and isomerisation of 5-ene-3 beta-hydroxypregnene and 5-ene-hydroxyandrostene steroid precursors into the corresponding 4-ene-ketosteroids necessary for the formation of all classes of steroid hormones Back     alignment and domain information
>PRK09009 C factor cell-cell signaling protein; Provisional Back     alignment and domain information
>PRK07201 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG1086 Predicted nucleoside-diphosphate sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>PLN02730 enoyl-[acyl-carrier-protein] reductase Back     alignment and domain information
>TIGR01181 dTDP_gluc_dehyt dTDP-glucose 4,6-dehydratase Back     alignment and domain information
>TIGR03649 ergot_EASG ergot alkaloid biosynthesis protein, AFUA_2G17970 family Back     alignment and domain information
>PRK07577 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08309 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG1200 consensus Mitochondrial/plastidial beta-ketoacyl-ACP reductase [Lipid transport and metabolism] Back     alignment and domain information
>PRK10084 dTDP-glucose 4,6 dehydratase; Provisional Back     alignment and domain information
>TIGR01777 yfcH conserved hypothetical protein TIGR01777 Back     alignment and domain information
>TIGR01179 galE UDP-glucose-4-epimerase Back     alignment and domain information
>COG0702 Predicted nucleoside-diphosphate-sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK08261 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PLN02996 fatty acyl-CoA reductase Back     alignment and domain information
>KOG1430 consensus C-3 sterol dehydrogenase/3-beta-hydroxysteroid dehydrogenase and related dehydrogenases [Lipid transport and metabolism; Amino acid transport and metabolism] Back     alignment and domain information
>PF07993 NAD_binding_4: Male sterility protein; InterPro: IPR013120 This family represents the C-terminal NAD-binding region of the male sterility protein from Arabidopsis and Drosophila Back     alignment and domain information
>PRK05865 hypothetical protein; Provisional Back     alignment and domain information
>PLN00016 RNA-binding protein; Provisional Back     alignment and domain information
>PF02719 Polysacc_synt_2: Polysaccharide biosynthesis protein; InterPro: IPR003869 This domain is found in diverse bacterial polysaccharide biosynthesis proteins including the CapD protein from Staphylococcus aureus [], the WalL protein, mannosyl-transferase [], and several putative epimerases Back     alignment and domain information
>PLN02778 3,5-epimerase/4-reductase Back     alignment and domain information
>PLN02503 fatty acyl-CoA reductase 2 Back     alignment and domain information
>PRK09987 dTDP-4-dehydrorhamnose reductase; Provisional Back     alignment and domain information
>PRK11150 rfaD ADP-L-glycero-D-mannoheptose-6-epimerase; Provisional Back     alignment and domain information
>COG1090 Predicted nucleoside-diphosphate sugar epimerase [General function prediction only] Back     alignment and domain information
>KOG1478 consensus 3-keto sterol reductase [Lipid transport and metabolism] Back     alignment and domain information
>TIGR01214 rmlD dTDP-4-dehydrorhamnose reductase Back     alignment and domain information
>COG2910 Putative NADH-flavin reductase [General function prediction only] Back     alignment and domain information
>PF05368 NmrA: NmrA-like family; InterPro: IPR008030 NmrA is a negative transcriptional regulator involved in the post-translational modification of the transcription factor AreA Back     alignment and domain information
>PRK13656 trans-2-enoyl-CoA reductase; Provisional Back     alignment and domain information
>PRK07578 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06300 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>KOG1207 consensus Diacetyl reductase/L-xylulose reductase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>KOG1210 consensus Predicted 3-ketosphinganine reductase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PF04321 RmlD_sub_bind: RmlD substrate binding domain; InterPro: IPR005913 dTDP-4-dehydrorhamnose reductase (1 Back     alignment and domain information
>KOG1610 consensus Corticosteroid 11-beta-dehydrogenase and related short chain-type dehydrogenases [Secondary metabolites biosynthesis, transport and catabolism; General function prediction only] Back     alignment and domain information
>KOG1199 consensus Short-chain alcohol dehydrogenase/3-hydroxyacyl-CoA dehydrogenase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>KOG1209 consensus 1-Acyl dihydroxyacetone phosphate reductase and related dehydrogenases [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>COG3320 Putative dehydrogenase domain of multifunctional non-ribosomal peptide synthetases and related enzymes [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>TIGR02197 heptose_epim ADP-L-glycero-D-manno-heptose-6-epimerase Back     alignment and domain information
>PRK12548 shikimate 5-dehydrogenase; Provisional Back     alignment and domain information
>TIGR02813 omega_3_PfaA polyketide-type polyunsaturated fatty acid synthase PfaA Back     alignment and domain information
>cd01078 NAD_bind_H4MPT_DH NADP binding domain of methylene tetrahydromethanopterin dehydrogenase Back     alignment and domain information
>COG1089 Gmd GDP-D-mannose dehydratase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>COG1748 LYS9 Saccharopine dehydrogenase and related proteins [Amino acid transport and metabolism] Back     alignment and domain information
>PRK09620 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03443 alpha_am_amid L-aminoadipate-semialdehyde dehydrogenase Back     alignment and domain information
>PF13561 adh_short_C2: Enoyl-(Acyl carrier protein) reductase; PDB: 2UV8_B 3HMJ_A 2VKZ_C 1O5I_A 2P91_C 2OP0_A 2OL4_B 1NHW_A 1NNU_B 2O2Y_B Back     alignment and domain information
>PRK14106 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK05579 bifunctional phosphopantothenoylcysteine decarboxylase/phosphopantothenate synthase; Validated Back     alignment and domain information
>PRK02472 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PLN02725 GDP-4-keto-6-deoxymannose-3,5-epimerase-4-reductase Back     alignment and domain information
>PF01488 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; InterPro: IPR006151 This entry represents a domain found in shikimate and quinate dehydrogenases, as well as glutamyl-tRNA reductases Back     alignment and domain information
>PLN02260 probable rhamnose biosynthetic enzyme Back     alignment and domain information
>PRK14982 acyl-ACP reductase; Provisional Back     alignment and domain information
>PRK06849 hypothetical protein; Provisional Back     alignment and domain information
>KOG1203 consensus Predicted dehydrogenase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG1221 consensus Acyl-CoA reductase [Lipid transport and metabolism] Back     alignment and domain information
>TIGR01915 npdG NADPH-dependent F420 reductase Back     alignment and domain information
>KOG2865 consensus NADH:ubiquinone oxidoreductase, NDUFA9/39kDa subunit [Energy production and conversion] Back     alignment and domain information
>PF03435 Saccharop_dh: Saccharopine dehydrogenase ; InterPro: IPR005097 This entry represents saccharopine dehydrogenase and homospermidine synthase Back     alignment and domain information
>PRK00258 aroE shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>cd01336 MDH_cytoplasmic_cytosolic Cytoplasmic and cytosolic Malate dehydrogenases Back     alignment and domain information
>COG0569 TrkA K+ transport systems, NAD-binding component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK06732 phosphopantothenate--cysteine ligase; Validated Back     alignment and domain information
>PLN02520 bifunctional 3-dehydroquinate dehydratase/shikimate dehydrogenase Back     alignment and domain information
>TIGR00715 precor6x_red precorrin-6x reductase Back     alignment and domain information
>COG1091 RfbD dTDP-4-dehydrorhamnose reductase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>TIGR00507 aroE shikimate 5-dehydrogenase Back     alignment and domain information
>cd01075 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase Back     alignment and domain information
>PRK09496 trkA potassium transporter peripheral membrane component; Reviewed Back     alignment and domain information
>PRK08655 prephenate dehydrogenase; Provisional Back     alignment and domain information
>TIGR00521 coaBC_dfp phosphopantothenoylcysteine decarboxylase/phosphopantothenate--cysteine ligase, prokaryotic Back     alignment and domain information
>KOG0747 consensus Putative NAD+-dependent epimerases [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK09496 trkA potassium transporter peripheral membrane component; Reviewed Back     alignment and domain information
>PRK07819 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>cd01065 NAD_bind_Shikimate_DH NAD(P) binding domain of Shikimate dehydrogenase Back     alignment and domain information
>PF01118 Semialdhyde_dh: Semialdehyde dehydrogenase, NAD binding domain; InterPro: IPR000534 The semialdehyde dehydrogenase family is found in N-acetyl-glutamine semialdehyde dehydrogenase (AgrC), which is involved in arginine biosynthesis, and aspartate-semialdehyde dehydrogenase [], an enzyme involved in the biosynthesis of various amino acids from aspartate Back     alignment and domain information
>TIGR02114 coaB_strep phosphopantothenate--cysteine ligase, streptococcal Back     alignment and domain information
>PRK06249 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>PF02737 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain; InterPro: IPR006176 3-hydroxyacyl-CoA dehydrogenase (1 Back     alignment and domain information
>PRK14874 aspartate-semialdehyde dehydrogenase; Provisional Back     alignment and domain information
>KOG1372 consensus GDP-mannose 4,6 dehydratase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK11199 tyrA bifunctional chorismate mutase/prephenate dehydrogenase; Provisional Back     alignment and domain information
>COG0623 FabI Enoyl-[acyl-carrier-protein] Back     alignment and domain information
>COG2085 Predicted dinucleotide-binding enzymes [General function prediction only] Back     alignment and domain information
>PRK06129 3-hydroxyacyl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK04308 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK08664 aspartate-semialdehyde dehydrogenase; Reviewed Back     alignment and domain information
>cd01080 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of methylene-tetrahydrofolate dehydrogenase/cyclohydrolase Back     alignment and domain information
>PLN02968 Probable N-acetyl-gamma-glutamyl-phosphate reductase Back     alignment and domain information
>PRK06444 prephenate dehydrogenase; Provisional Back     alignment and domain information
>PRK06718 precorrin-2 dehydrogenase; Reviewed Back     alignment and domain information
>PF00056 Ldh_1_N: lactate/malate dehydrogenase, NAD binding domain Prosite entry for lactate dehydrogenase Prosite entry for malate dehydrogenase; InterPro: IPR001236 L-lactate dehydrogenases are metabolic enzymes which catalyse the conversion of L-lactate to pyruvate, the last step in anaerobic glycolysis [] Back     alignment and domain information
>PRK09310 aroDE bifunctional 3-dehydroquinate dehydratase/shikimate dehydrogenase protein; Reviewed Back     alignment and domain information
>TIGR02853 spore_dpaA dipicolinic acid synthetase, A subunit Back     alignment and domain information
>PF12242 Eno-Rase_NADH_b: NAD(P)H binding domain of trans-2-enoyl-CoA reductase; PDB: 3ZU5_A 3ZU3_A 3ZU4_A 3ZU2_A 3S8M_A Back     alignment and domain information
>PRK00066 ldh L-lactate dehydrogenase; Reviewed Back     alignment and domain information
>TIGR01470 cysG_Nterm siroheme synthase, N-terminal domain Back     alignment and domain information
>KOG2733 consensus Uncharacterized membrane protein [Function unknown] Back     alignment and domain information
>PF13241 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_B 1PJT_A 1PJS_A 1PJQ_A 1KYQ_B Back     alignment and domain information
>PRK00436 argC N-acetyl-gamma-glutamyl-phosphate reductase; Validated Back     alignment and domain information
>PF01113 DapB_N: Dihydrodipicolinate reductase, N-terminus; InterPro: IPR000846 Dihydrodipicolinate reductase catalyzes the second step in the biosynthesis of diaminopimelic acid and lysine, the NAD or NADP-dependent reduction of 2,3-dihydrodipicolinate into 2,3,4,5-tetrahydrodipicolinate [, , ] Back     alignment and domain information
>PRK05671 aspartate-semialdehyde dehydrogenase; Reviewed Back     alignment and domain information
>PRK14188 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK06522 2-dehydropantoate 2-reductase; Reviewed Back     alignment and domain information
>PRK04148 hypothetical protein; Provisional Back     alignment and domain information
>KOG4039 consensus Serine/threonine kinase TIP30/CC3 [Signal transduction mechanisms] Back     alignment and domain information
>cd08259 Zn_ADH5 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>cd05212 NAD_bind_m-THF_DH_Cyclohyd_like NAD(P) binding domain of methylene-tetrahydrofolate dehydrogenase and methylene-tetrahydrofolate dehydrogenase/cyclohydrolase Back     alignment and domain information
>PRK12549 shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>PRK05086 malate dehydrogenase; Provisional Back     alignment and domain information
>PRK14175 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK07530 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>cd08295 double_bond_reductase_like Arabidopsis alkenal double bond reductase and leukotriene B4 12-hydroxydehydrogenase Back     alignment and domain information
>PRK14192 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK01438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PF03446 NAD_binding_2: NAD binding domain of 6-phosphogluconate dehydrogenase; InterPro: IPR006115 6-Phosphogluconate dehydrogenase (1 Back     alignment and domain information
>PLN00106 malate dehydrogenase Back     alignment and domain information
>COG0240 GpsA Glycerol-3-phosphate dehydrogenase [Energy production and conversion] Back     alignment and domain information
>KOG1431 consensus GDP-L-fucose synthetase [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd08294 leukotriene_B4_DH_like 13-PGR is a bifunctional enzyme with delta-13 15-prostaglandin reductase and leukotriene B4 12 hydroxydehydrogenase activity Back     alignment and domain information
>TIGR02354 thiF_fam2 thiamine biosynthesis protein ThiF, family 2 Back     alignment and domain information
>cd05294 LDH-like_MDH_nadp A lactate dehydrogenases-like structure with malate dehydrogenase enzymatic activity Back     alignment and domain information
>PRK14194 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>COG5322 Predicted dehydrogenase [General function prediction only] Back     alignment and domain information
>PRK09260 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PF02254 TrkA_N: TrkA-N domain; InterPro: IPR003148 The regulator of K+ conductance (RCK) domain is found in many ligand-gated K+ channels, most often attached to the intracellular carboxy terminus Back     alignment and domain information
>PRK14619 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK07688 thiamine/molybdopterin biosynthesis ThiF/MoeB-like protein; Validated Back     alignment and domain information
>PRK05690 molybdopterin biosynthesis protein MoeB; Provisional Back     alignment and domain information
>PTZ00325 malate dehydrogenase; Provisional Back     alignment and domain information
>TIGR02825 B4_12hDH leukotriene B4 12-hydroxydehydrogenase/15-oxo-prostaglandin 13-reductase Back     alignment and domain information
>PRK00094 gpsA NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Validated Back     alignment and domain information
>cd05276 p53_inducible_oxidoreductase PIG3 p53-inducible quinone oxidoreductase Back     alignment and domain information
>PRK08306 dipicolinate synthase subunit A; Reviewed Back     alignment and domain information
>PF02826 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain; InterPro: IPR006140 A number of NAD-dependent 2-hydroxyacid dehydrogenases which seem to be specific for the D-isomer of their substrate have been shown to be functionally and structurally related Back     alignment and domain information
>PRK12475 thiamine/molybdopterin biosynthesis MoeB-like protein; Provisional Back     alignment and domain information
>cd05191 NAD_bind_amino_acid_DH NAD(P) binding domain of amino acid dehydrogenase-like proteins Back     alignment and domain information
>cd05291 HicDH_like L-2-hydroxyisocapronate dehydrogenases and some bacterial L-lactate dehydrogenases Back     alignment and domain information
>PRK07417 arogenate dehydrogenase; Reviewed Back     alignment and domain information
>cd08253 zeta_crystallin Zeta-crystallin with NADP-dependent quinone reductase activity (QOR) Back     alignment and domain information
>PRK14027 quinate/shikimate dehydrogenase; Provisional Back     alignment and domain information
>PRK14618 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK11064 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Provisional Back     alignment and domain information
>cd08293 PTGR2 Prostaglandin reductase Back     alignment and domain information
>PRK08293 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PF03721 UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogenase family, NAD binding domain; InterPro: IPR001732 The UDP-glucose/GDP-mannose dehydrogenases are a small group of enzymes which possesses the ability to catalyse the NAD-dependent 2-fold oxidation of an alcohol to an acid without the release of an aldehyde intermediate [, ] Back     alignment and domain information
>PLN02545 3-hydroxybutyryl-CoA dehydrogenase Back     alignment and domain information
>TIGR01809 Shik-DH-AROM shikimate-5-dehydrogenase, fungal AROM-type Back     alignment and domain information
>PLN03154 putative allyl alcohol dehydrogenase; Provisional Back     alignment and domain information
>COG0287 TyrA Prephenate dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PF02882 THF_DHG_CYH_C: Tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding domain; InterPro: IPR020631 Enzymes that participate in the transfer of one-carbon units require the coenzyme tetrahydrofolate (THF) Back     alignment and domain information
>KOG1198 consensus Zinc-binding oxidoreductase [Energy production and conversion; General function prediction only] Back     alignment and domain information
>COG0604 Qor NADPH:quinone reductase and related Zn-dependent oxidoreductases [Energy production and conversion / General function prediction only] Back     alignment and domain information
>PRK08268 3-hydroxy-acyl-CoA dehydrogenase; Validated Back     alignment and domain information
>PLN02383 aspartate semialdehyde dehydrogenase Back     alignment and domain information
>PRK06719 precorrin-2 dehydrogenase; Validated Back     alignment and domain information
>cd00704 MDH Malate dehydrogenase Back     alignment and domain information
>PRK02006 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>cd01483 E1_enzyme_family Superfamily of activating enzymes (E1) of the ubiquitin-like proteins Back     alignment and domain information
>PRK05442 malate dehydrogenase; Provisional Back     alignment and domain information
>cd01338 MDH_choloroplast_like Chloroplast-like malate dehydrogenases Back     alignment and domain information
>PRK06130 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>cd08266 Zn_ADH_like1 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>cd08268 MDR2 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>TIGR01850 argC N-acetyl-gamma-glutamyl-phosphate reductase, common form Back     alignment and domain information
>PRK14620 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>COG0169 AroE Shikimate 5-dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK06035 3-hydroxyacyl-CoA dehydrogenase; Validated Back     alignment and domain information
>TIGR01035 hemA glutamyl-tRNA reductase Back     alignment and domain information
>PF01210 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus; InterPro: IPR011128 NAD-dependent glycerol-3-phosphate dehydrogenase (GPDH) catalyses the interconversion of dihydroxyacetone phosphate and L-glycerol-3-phosphate Back     alignment and domain information
>TIGR02356 adenyl_thiF thiazole biosynthesis adenylyltransferase ThiF, E Back     alignment and domain information
>TIGR01296 asd_B aspartate-semialdehyde dehydrogenase (peptidoglycan organisms) Back     alignment and domain information
>PRK07531 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioesterase; Validated Back     alignment and domain information
>cd01485 E1-1_like Ubiquitin activating enzyme (E1), repeat 1-like Back     alignment and domain information
>PLN02256 arogenate dehydrogenase Back     alignment and domain information
>PRK07066 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK13243 glyoxylate reductase; Reviewed Back     alignment and domain information
>cd01337 MDH_glyoxysomal_mitochondrial Glyoxysomal and mitochondrial malate dehydrogenases Back     alignment and domain information
>PRK05808 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK00141 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK10669 putative cation:proton antiport protein; Provisional Back     alignment and domain information
>PF12076 Wax2_C: WAX2 C-terminal domain; InterPro: IPR021940 This presumed domain is functionally uncharacterised Back     alignment and domain information
>PRK06223 malate dehydrogenase; Reviewed Back     alignment and domain information
>PRK05476 S-adenosyl-L-homocysteine hydrolase; Provisional Back     alignment and domain information
>PRK08229 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>cd05311 NAD_bind_2_malic_enz NAD(P) binding domain of malic enzyme (ME), subgroup 2 Back     alignment and domain information
>PRK12749 quinate/shikimate dehydrogenase; Reviewed Back     alignment and domain information
>TIGR02279 PaaC-3OHAcCoADH 3-hydroxyacyl-CoA dehydrogenase PaaC Back     alignment and domain information
>cd00757 ThiF_MoeB_HesA_family ThiF_MoeB_HesA Back     alignment and domain information
>PRK13940 glutamyl-tRNA reductase; Provisional Back     alignment and domain information
>TIGR02824 quinone_pig3 putative NAD(P)H quinone oxidoreductase, PIG3 family Back     alignment and domain information
>PRK10792 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK12550 shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>cd08289 MDR_yhfp_like Yhfp putative quinone oxidoreductases Back     alignment and domain information
>KOG0409 consensus Predicted dehydrogenase [General function prediction only] Back     alignment and domain information
>PTZ00117 malate dehydrogenase; Provisional Back     alignment and domain information
>PRK07502 cyclohexadienyl dehydrogenase; Validated Back     alignment and domain information
>TIGR00978 asd_EA aspartate-semialdehyde dehydrogenase (non-peptidoglycan organisms) Back     alignment and domain information
>PF04127 DFP: DNA / pantothenate metabolism flavoprotein; InterPro: IPR007085 This entry represents the C-terminal domain found in DNA/pantothenate metabolism flavoproteins, which affects synthesis of DNA and pantothenate metabolism Back     alignment and domain information
>PRK11559 garR tartronate semialdehyde reductase; Provisional Back     alignment and domain information
>PRK08644 thiamine biosynthesis protein ThiF; Provisional Back     alignment and domain information
>COG1064 AdhP Zn-dependent alcohol dehydrogenases [General function prediction only] Back     alignment and domain information
>PRK05597 molybdopterin biosynthesis protein MoeB; Validated Back     alignment and domain information
>KOG4022 consensus Dihydropteridine reductase DHPR/QDPR [Amino acid transport and metabolism] Back     alignment and domain information
>cd08250 Mgc45594_like Mgc45594 gene product and other MDR family members Back     alignment and domain information
>cd05292 LDH_2 A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>PRK14179 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>cd00650 LDH_MDH_like NAD-dependent, lactate dehydrogenase-like, 2-hydroxycarboxylate dehydrogenase family Back     alignment and domain information
>TIGR03201 dearomat_had 6-hydroxycyclohex-1-ene-1-carbonyl-CoA dehydrogenase Back     alignment and domain information
>PTZ00345 glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>TIGR01758 MDH_euk_cyt malate dehydrogenase, NAD-dependent Back     alignment and domain information
>cd01487 E1_ThiF_like E1_ThiF_like Back     alignment and domain information
>PRK12409 D-amino acid dehydrogenase small subunit; Provisional Back     alignment and domain information
>PF03807 F420_oxidored: NADP oxidoreductase coenzyme F420-dependent; InterPro: IPR004455 The function of F420-dependent NADP reductase is the transfer of electrons from reduced coenzyme F420 into an electron transport chain Back     alignment and domain information
>PRK13236 nitrogenase reductase; Reviewed Back     alignment and domain information
>PF00899 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-activating enzyme (E1 enzyme) [, ] activates ubiquitin by first adenylating with ATP its C-terminal glycine residue and thereafter linking this residue to the side chain of a cysteine residue in E1, yielding an ubiquitin-E1 thiolester and free AMP Back     alignment and domain information
>TIGR01759 MalateDH-SF1 malate dehydrogenase Back     alignment and domain information
>PRK11880 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>COG0665 DadA Glycine/D-amino acid oxidases (deaminating) [Amino acid transport and metabolism] Back     alignment and domain information
>PRK12480 D-lactate dehydrogenase; Provisional Back     alignment and domain information
>cd05288 PGDH Prostaglandin dehydrogenases Back     alignment and domain information
>PRK09880 L-idonate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK14189 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>COG0039 Mdh Malate/lactate dehydrogenases [Energy production and conversion] Back     alignment and domain information
>COG0190 FolD 5,10-methylene-tetrahydrofolate dehydrogenase/Methenyl tetrahydrofolate cyclohydrolase [Coenzyme metabolism] Back     alignment and domain information
>PRK07236 hypothetical protein; Provisional Back     alignment and domain information
>cd01079 NAD_bind_m-THF_DH NAD binding domain of methylene-tetrahydrofolate dehydrogenase Back     alignment and domain information
>PRK13982 bifunctional SbtC-like/phosphopantothenoylcysteine decarboxylase/phosphopantothenate synthase; Provisional Back     alignment and domain information
>cd05188 MDR Medium chain reductase/dehydrogenase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>PRK00045 hemA glutamyl-tRNA reductase; Reviewed Back     alignment and domain information
>PRK13886 conjugal transfer protein TraL; Provisional Back     alignment and domain information
>PLN00203 glutamyl-tRNA reductase Back     alignment and domain information
>PLN02712 arogenate dehydrogenase Back     alignment and domain information
>PRK14177 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14176 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK07494 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional Back     alignment and domain information
>PRK08818 prephenate dehydrogenase; Provisional Back     alignment and domain information
>cd08270 MDR4 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>TIGR01772 MDH_euk_gproteo malate dehydrogenase, NAD-dependent Back     alignment and domain information
>TIGR00872 gnd_rel 6-phosphogluconate dehydrogenase (decarboxylating) Back     alignment and domain information
>TIGR03026 NDP-sugDHase nucleotide sugar dehydrogenase Back     alignment and domain information
>PRK08163 salicylate hydroxylase; Provisional Back     alignment and domain information
>PRK14191 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>cd08241 QOR1 Quinone oxidoreductase (QOR) Back     alignment and domain information
>PRK06728 aspartate-semialdehyde dehydrogenase; Provisional Back     alignment and domain information
>PTZ00082 L-lactate dehydrogenase; Provisional Back     alignment and domain information
>cd01492 Aos1_SUMO Ubiquitin activating enzyme (E1) subunit Aos1 Back     alignment and domain information
>TIGR00518 alaDH alanine dehydrogenase Back     alignment and domain information
>cd08244 MDR_enoyl_red Possible enoyl reductase Back     alignment and domain information
>cd08292 ETR_like_2 2-enoyl thioester reductase (ETR) like proteins, child 2 Back     alignment and domain information
>TIGR02822 adh_fam_2 zinc-binding alcohol dehydrogenase family protein Back     alignment and domain information
>PRK12767 carbamoyl phosphate synthase-like protein; Provisional Back     alignment and domain information
>KOG1204 consensus Predicted dehydrogenase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK03659 glutathione-regulated potassium-efflux system protein KefB; Provisional Back     alignment and domain information
>PF00208 ELFV_dehydrog: Glutamate/Leucine/Phenylalanine/Valine dehydrogenase; InterPro: IPR006096 Glutamate, leucine, phenylalanine and valine dehydrogenases are structurally and functionally related Back     alignment and domain information
>PF00070 Pyr_redox: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR001327 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] Back     alignment and domain information
>cd08243 quinone_oxidoreductase_like_1 Quinone oxidoreductase (QOR) Back     alignment and domain information
>cd05213 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain of glutamyl-tRNA reductase Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query64
2c29_D 337 Structure Of Dihydroflavonol Reductase From Vitis V 7e-14
2p4h_X 322 Crystal Structure Of Vestitone Reductase From Alfal 5e-09
2rh8_A 338 Structure Of Apo Anthocyanidin Reductase From Vitis 2e-08
1ujm_A 342 Crystal Structure Of Aldehyde Reductase 2 From Spor 7e-04
1y1p_A 342 X-Ray Structure Of Aldehyde Reductase With Nadph Le 8e-04
>pdb|2C29|D Chain D, Structure Of Dihydroflavonol Reductase From Vitis Vinifera At 1.8 A. Length = 337 Back     alignment and structure

Iteration: 1

Score = 72.0 bits (175), Expect = 7e-14, Method: Composition-based stats. Identities = 37/64 (57%), Positives = 44/64 (68%), Gaps = 1/64 (1%) Query: 1 MSGKGKVVCVTGASGFIASWLVKLLLQRSYTVKATVRDLNN-HNAEHLLTLDGAEERLHL 59 M + + VCVTGASGFI SWLV LL+R YTV+ATVRD N +HLL L AE L L Sbjct: 1 MGSQSETVCVTGASGFIGSWLVMRLLERGYTVRATVRDPTNVKKVKHLLDLPKAETHLTL 60 Query: 60 FKAN 63 +KA+ Sbjct: 61 WKAD 64
>pdb|2P4H|X Chain X, Crystal Structure Of Vestitone Reductase From Alfalfa (Medicago Sativa L.) Length = 322 Back     alignment and structure
>pdb|2RH8|A Chain A, Structure Of Apo Anthocyanidin Reductase From Vitis Vinifera Length = 338 Back     alignment and structure
>pdb|1UJM|A Chain A, Crystal Structure Of Aldehyde Reductase 2 From Sporobolomyces Salmonicolor Aku4429 Length = 342 Back     alignment and structure
>pdb|1Y1P|A Chain A, X-Ray Structure Of Aldehyde Reductase With Nadph Length = 342 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query64
2c29_D 337 Dihydroflavonol 4-reductase; flavonoids, short deh 1e-32
2p4h_X 322 Vestitone reductase; NADPH-dependent reductase, is 3e-27
2rh8_A 338 Anthocyanidin reductase; flavonoids, rossmann fold 5e-27
1y1p_A 342 ARII, aldehyde reductase II; rossmann fold, short 3e-24
3dhn_A 227 NAD-dependent epimerase/dehydratase; reductase, PF 1e-16
2x4g_A 342 Nucleoside-diphosphate-sugar epimerase; isomerase; 1e-11
1xgk_A 352 Nitrogen metabolite repression regulator NMRA; ros 2e-11
3dqp_A 219 Oxidoreductase YLBE; alpha-beta protein., structur 9e-09
3ew7_A 221 LMO0794 protein; Q8Y8U8_lismo, putative NAD-depend 7e-08
2c5a_A 379 GDP-mannose-3', 5'-epimerase; short chain dehydrat 7e-08
3e8x_A 236 Putative NAD-dependent epimerase/dehydratase; stru 1e-07
3slg_A 372 PBGP3 protein; structural genomics, seattle struct 2e-07
3vps_A 321 TUNA, NAD-dependent epimerase/dehydratase; tunicam 4e-07
1hdo_A 206 Biliverdin IX beta reductase; foetal metabolism, H 5e-07
2a35_A 215 Hypothetical protein PA4017; alpha-beta-alpha sand 6e-07
3u9l_A 324 3-oxoacyl-[acyl-carrier-protein] reductase; struct 6e-07
3h2s_A 224 Putative NADH-flavin reductase; Q03B84, NESG, LCR1 1e-06
3r6d_A 221 NAD-dependent epimerase/dehydratase; structural ge 2e-06
1xq6_A 253 Unknown protein; structural genomics, protein stru 2e-06
2wm3_A 299 NMRA-like family domain containing protein 1; unkn 2e-06
1sb8_A 352 WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCN 4e-06
3ruf_A 351 WBGU; rossmann fold, UDP-hexose 4-epimerase, isome 5e-06
2bll_A 345 Protein YFBG; decarboxylase, short chain dehydroge 8e-06
3m2p_A 311 UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J 8e-06
3rft_A 267 Uronate dehydrogenase; apoenzyme, rossmann fold, N 1e-05
3ajr_A 317 NDP-sugar epimerase; L-threonine dehydrogenase, L- 2e-05
3qvo_A 236 NMRA family protein; structural genomics, PSI-biol 2e-05
3m1a_A 281 Putative dehydrogenase; short, PSI, MCSG, structur 2e-05
3oh8_A 516 Nucleoside-diphosphate sugar epimerase (SULA FAMI; 3e-05
2q1w_A 333 Putative nucleotide sugar epimerase/ dehydratase; 3e-05
1qyd_A 313 Pinoresinol-lariciresinol reductase; NADPH-depende 5e-05
3ay3_A 267 NAD-dependent epimerase/dehydratase; glucuronic ac 5e-05
1rkx_A 357 CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 5e-05
2v6g_A 364 Progesterone 5-beta-reductase; tyrosine-dependent 7e-05
2pff_A 1688 Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl 8e-05
2bka_A 242 CC3, TAT-interacting protein TIP30; NADPH, PEG600, 1e-04
2b69_A 343 UDP-glucuronate decarboxylase 1; UDP-glucoronic ac 2e-04
1qyc_A 308 Phenylcoumaran benzylic ether reductase PT1; NADPH 2e-04
2x6t_A 357 ADP-L-glycero-D-manno-heptose-6-epimerase; isomera 3e-04
1z7e_A 660 Protein aRNA; rossmann fold, OB-like fold, hydrola 3e-04
1sby_A 254 Alcohol dehydrogenase; ternary complex, NAD, trifl 5e-04
3sxp_A 362 ADP-L-glycero-D-mannoheptose-6-epimerase; rossman 5e-04
3st7_A 369 Capsular polysaccharide synthesis enzyme CAP5F; ro 5e-04
2pk3_A 321 GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, shor 5e-04
2yy7_A 312 L-threonine dehydrogenase; thermolabIle, flavobact 6e-04
>2c29_D Dihydroflavonol 4-reductase; flavonoids, short dehydrogenase reductase, NADPH, dihydroquercetin, rossmann fold, oxidoreductase; HET: NAP DQH; 1.81A {Vitis vinifera} PDB: 2iod_A* 2nnl_D* 3bxx_A* 3c1t_A* Length = 337 Back     alignment and structure
 Score =  113 bits (284), Expect = 1e-32
 Identities = 37/64 (57%), Positives = 44/64 (68%), Gaps = 1/64 (1%)

Query: 1  MSGKGKVVCVTGASGFIASWLVKLLLQRSYTVKATVRDLNNHNA-EHLLTLDGAEERLHL 59
          M  + + VCVTGASGFI SWLV  LL+R YTV+ATVRD  N    +HLL L  AE  L L
Sbjct: 1  MGSQSETVCVTGASGFIGSWLVMRLLERGYTVRATVRDPTNVKKVKHLLDLPKAETHLTL 60

Query: 60 FKAN 63
          +KA+
Sbjct: 61 WKAD 64


>2p4h_X Vestitone reductase; NADPH-dependent reductase, isoflavonoid, plant protein; 1.40A {Medicago sativa} Length = 322 Back     alignment and structure
>2rh8_A Anthocyanidin reductase; flavonoids, rossmann fold, short chain dehydrogenase/reductase, oxidoreductase; 2.22A {Vitis vinifera} PDB: 3hfs_A Length = 338 Back     alignment and structure
>1y1p_A ARII, aldehyde reductase II; rossmann fold, short chain dehydrogenase reductase, oxidoreductase; HET: NMN AMP; 1.60A {Sporidiobolus salmonicolor} SCOP: c.2.1.2 PDB: 1ujm_A* 1zze_A Length = 342 Back     alignment and structure
>3dhn_A NAD-dependent epimerase/dehydratase; reductase, PF01370, Q89Z24_bactn, NESG, BTR310, structural genomics, PSI-2; 2.00A {Bacteroides thetaiotaomicron} Length = 227 Back     alignment and structure
>2x4g_A Nucleoside-diphosphate-sugar epimerase; isomerase; 2.65A {Pseudomonas aeruginosa} Length = 342 Back     alignment and structure
>1xgk_A Nitrogen metabolite repression regulator NMRA; rossmann fold, transcriptional regulation, short chain dehyd reductase, NADP binding; 1.40A {Emericella nidulans} SCOP: c.2.1.2 PDB: 1k6x_A* 1k6j_A 1k6i_A* 1ti7_A* 2vus_A 2vut_A* 2vuu_A* Length = 352 Back     alignment and structure
>3dqp_A Oxidoreductase YLBE; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 1.40A {Lactococcus lactis subsp} Length = 219 Back     alignment and structure
>3ew7_A LMO0794 protein; Q8Y8U8_lismo, putative NAD-dependent epimerase/dehydratase, LMR162, NESG, structural genomics, PSI-2; 2.73A {Listeria monocytogenes} Length = 221 Back     alignment and structure
>2c5a_A GDP-mannose-3', 5'-epimerase; short chain dehydratase/reductase, GDP-gulose, GDP-galactose, keto intermediate, vitamin C, SDR; HET: GDC NAD BTB; 1.4A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2c59_A* 2c54_A* 2c5e_A* Length = 379 Back     alignment and structure
>3e8x_A Putative NAD-dependent epimerase/dehydratase; structural genomics, APC7755, NADP, P protein structure initiative; HET: MSE NAP; 2.10A {Bacillus halodurans} Length = 236 Back     alignment and structure
>3slg_A PBGP3 protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid, melioidosis, glanders; 2.10A {Burkholderia pseudomallei} Length = 372 Back     alignment and structure
>3vps_A TUNA, NAD-dependent epimerase/dehydratase; tunicamycins, biosynthesis, EXO-glycal, rossman transferase; HET: UD1 NAD; 1.90A {Streptomyces chartreusis} Length = 321 Back     alignment and structure
>1hdo_A Biliverdin IX beta reductase; foetal metabolism, HAEM degradation, flavin reductase, diaphorase, green HAEM binding protein; HET: NAP; 1.15A {Homo sapiens} SCOP: c.2.1.2 PDB: 1he2_A* 1he3_A* 1he4_A* 1he5_A* Length = 206 Back     alignment and structure
>2a35_A Hypothetical protein PA4017; alpha-beta-alpha sandwich, structura genomics, PSI, protein structure initiative; 1.50A {Pseudomonas aeruginosa} SCOP: c.2.1.2 Length = 215 Back     alignment and structure
>3u9l_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.10A {Sinorhizobium meliloti} Length = 324 Back     alignment and structure
>3h2s_A Putative NADH-flavin reductase; Q03B84, NESG, LCR19, structural genomics, PSI-2, protein structure initiative; HET: NDP; 1.78A {Lactobacillus casei atcc 334} Length = 224 Back     alignment and structure
>3r6d_A NAD-dependent epimerase/dehydratase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, veillo parvula; HET: MLZ; 1.25A {Veillonella parvula dsm 2008} PDB: 3r14_A* Length = 221 Back     alignment and structure
>1xq6_A Unknown protein; structural genomics, protein structure initiative, CESG, AT5G02240, NADP, center for eukaryotic structural genomics; HET: NAP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1ybm_A* 2q46_A* 2q4b_A* Length = 253 Back     alignment and structure
>2wm3_A NMRA-like family domain containing protein 1; unknown function; HET: NAP NFL; 1.85A {Homo sapiens} PDB: 2wmd_A* 2exx_A* 3dxf_A 3e5m_A Length = 299 Back     alignment and structure
>1sb8_A WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCNAC, SDR, G SYK, UDP, N-acetylglucosamine, N- acetylgalactosamine, UDP-GLC, isomerase; HET: NAD UD2; 2.10A {Pseudomonas aeruginosa} SCOP: c.2.1.2 PDB: 1sb9_A* Length = 352 Back     alignment and structure
>3ruf_A WBGU; rossmann fold, UDP-hexose 4-epimerase, isomerase; HET: NAD UDP; 2.00A {Plesiomonas shigelloides} PDB: 3ru9_A* 3rud_A* 3rue_A* 3rua_A* 3ruh_A* 3ruc_A* 3ru7_A* 3lu1_A* Length = 351 Back     alignment and structure
>2bll_A Protein YFBG; decarboxylase, short chain dehydrogenase, L-ARA4N biosynthes methyltransferase, transferase; 2.3A {Escherichia coli} SCOP: c.2.1.2 PDB: 1u9j_A 1z73_A 1z75_A 1z7b_A 1z74_A Length = 345 Back     alignment and structure
>3m2p_A UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J, isomerase, structural genomics, PSI-2, protein structure initiative; HET: UDP; 2.95A {Bacillus cereus} Length = 311 Back     alignment and structure
>3rft_A Uronate dehydrogenase; apoenzyme, rossmann fold, NAD binding, oxidoreductase; 1.90A {Agrobacterium tumefaciens} PDB: 3rfv_A* 3rfx_A* Length = 267 Back     alignment and structure
>3ajr_A NDP-sugar epimerase; L-threonine dehydrogenase, L-3- hydroxynorvaline, oxidoreductase; HET: NAD; 1.77A {Thermoplasma volcanium} PDB: 3a9w_A* 3a4v_A* 3a1n_A* Length = 317 Back     alignment and structure
>3qvo_A NMRA family protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MNB; 2.30A {Shigella flexneri 2A} Length = 236 Back     alignment and structure
>3m1a_A Putative dehydrogenase; short, PSI, MCSG, structural genomics, midwest center for structural genomics, protein structure initiative; 2.00A {Streptomyces avermitilis} Length = 281 Back     alignment and structure
>3oh8_A Nucleoside-diphosphate sugar epimerase (SULA FAMI; DUF1731_C, northeast structural genomics consortium, NESG, C PSI-biology; 2.00A {Corynebacterium glutamicum} Length = 516 Back     alignment and structure
>2q1w_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, sugar binding protein; HET: NAD; 2.19A {Bordetella bronchiseptica} Length = 333 Back     alignment and structure
>1qyd_A Pinoresinol-lariciresinol reductase; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.50A {Thuja plicata} SCOP: c.2.1.2 Length = 313 Back     alignment and structure
>3ay3_A NAD-dependent epimerase/dehydratase; glucuronic acid dehydrogeanse, oxidoreductase; 2.10A {Chromohalobacter salexigens} Length = 267 Back     alignment and structure
>1rkx_A CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 1.80A {Yersinia pseudotuberculosis} SCOP: c.2.1.2 PDB: 1wvg_A* Length = 357 Back     alignment and structure
>2v6g_A Progesterone 5-beta-reductase; tyrosine-dependent oxidoreductase, oxidoreductase, SDR, cardenolides, cardiac glycosides; HET: NAP; 2.3A {Digitalis lanata} PDB: 2v6f_A* Length = 364 Back     alignment and structure
>2pff_A Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl-carrier-PR; fatty acid synthase, acyl-carrier-protein, beta-ketoacyl RED beta-ketoacyl synthase, dehydratase; 4.00A {Saccharomyces cerevisiae} Length = 1688 Back     alignment and structure
>2bka_A CC3, TAT-interacting protein TIP30; NADPH, PEG600, transcription; HET: NDP PE8; 1.7A {Homo sapiens} SCOP: c.2.1.2 PDB: 2fmu_A Length = 242 Back     alignment and structure
>2b69_A UDP-glucuronate decarboxylase 1; UDP-glucoronic acid decarboxylase, structural genomics, STRU genomics consortium, SGC, lyase; HET: MSE NAD UDP; 1.21A {Homo sapiens} SCOP: c.2.1.2 PDB: 4ef7_A* Length = 343 Back     alignment and structure
>1qyc_A Phenylcoumaran benzylic ether reductase PT1; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.20A {Pinus taeda} SCOP: c.2.1.2 Length = 308 Back     alignment and structure
>2x6t_A ADP-L-glycero-D-manno-heptose-6-epimerase; isomerase, carbohydrate metabolism, stress response; HET: NAP ADP BMA; 2.36A {Escherichia coli} PDB: 2x86_A* Length = 357 Back     alignment and structure
>1z7e_A Protein aRNA; rossmann fold, OB-like fold, hydrolase; HET: ATP UGA; 3.00A {Escherichia coli} SCOP: b.46.1.1 c.2.1.2 c.65.1.1 Length = 660 Back     alignment and structure
>1sby_A Alcohol dehydrogenase; ternary complex, NAD, trifluoroethanol, oxidoreductase; HET: NAD; 1.10A {Scaptodrosophila lebanonensis} SCOP: c.2.1.2 PDB: 1b14_A* 1b15_A* 1a4u_A* 1b2l_A* 1b16_A* 3rj5_A* 3rj9_A* 1mg5_A* Length = 254 Back     alignment and structure
>3sxp_A ADP-L-glycero-D-mannoheptose-6-epimerase; rossman fold, NAD binding, isomerase; HET: NAD; 2.55A {Helicobacter pylori} Length = 362 Back     alignment and structure
>3st7_A Capsular polysaccharide synthesis enzyme CAP5F; rossmann fold, cupid domain, short-chain dehydrogenase/reduc NADPH; 2.45A {Staphylococcus aureus} PDB: 2zkl_A 3vhr_A Length = 369 Back     alignment and structure
>2pk3_A GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, short-chain dehydrogenase/reductase, rossmann fold, oxidoreductase; HET: A2R GDD; 1.82A {Aneurinibacillus thermoaerophilus} Length = 321 Back     alignment and structure
>2yy7_A L-threonine dehydrogenase; thermolabIle, flavobacterium FRIG KUC-1, oxidoreductase; HET: PE8 NAD MES; 2.06A {Flavobacterium frigidimaris} Length = 312 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query64
4fn4_A 254 Short chain dehydrogenase; NADH-binding, rossmann 99.59
3h7a_A 252 Short chain dehydrogenase; oxidoreductase, PSI-2, 99.58
4gkb_A 258 3-oxoacyl-[acyl-carrier protein] reductase; putati 99.55
3lyl_A 247 3-oxoacyl-(acyl-carrier-protein) reductase; alpha 99.54
3r1i_A 276 Short-chain type dehydrogenase/reductase; structur 99.53
4g81_D 255 Putative hexonate dehydrogenase; enzyme function i 99.53
3qiv_A 253 Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR 99.53
3rih_A 293 Short chain dehydrogenase or reductase; structural 99.52
4imr_A 275 3-oxoacyl-(acyl-carrier-protein) reductase; oxidor 99.52
3v8b_A 283 Putative dehydrogenase, possibly 3-oxoacyl-[acyl- 99.52
2ae2_A 260 Protein (tropinone reductase-II); oxidoreductase, 99.51
3svt_A 281 Short-chain type dehydrogenase/reductase; ssgcid, 99.51
3pk0_A 262 Short-chain dehydrogenase/reductase SDR; ssgcid, s 99.51
4iin_A 271 3-ketoacyl-acyl carrier protein reductase (FABG); 99.5
3gaf_A 256 7-alpha-hydroxysteroid dehydrogenase; seattle stru 99.5
4hp8_A 247 2-deoxy-D-gluconate 3-dehydrogenase; enzyme functi 99.5
3awd_A 260 GOX2181, putative polyol dehydrogenase; oxidoreduc 99.5
3sc4_A 285 Short chain dehydrogenase (A0QTM2 homolog); ssgcid 99.49
3edm_A 259 Short chain dehydrogenase; structural genomics, ox 99.49
2hq1_A 247 Glucose/ribitol dehydrogenase; CTH-1438, structura 99.49
3tfo_A 264 Putative 3-oxoacyl-(acyl-carrier-protein) reducta; 99.49
3m1a_A 281 Putative dehydrogenase; short, PSI, MCSG, structur 99.48
1ae1_A 273 Tropinone reductase-I; oxidoreductase, tropane alk 99.48
3imf_A 257 Short chain dehydrogenase; structural genomics, in 99.48
3tpc_A 257 Short chain alcohol dehydrogenase-related dehydro; 99.48
3ged_A 247 Short-chain dehydrogenase/reductase SDR; SCOR, ros 99.48
3ai3_A 263 NADPH-sorbose reductase; rossmann-fold, NADPH-depe 99.48
4fs3_A 256 Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; 99.48
3sju_A 279 Keto reductase; short-chain dehydrogenase, oxidore 99.48
3ksu_A 262 3-oxoacyl-acyl carrier protein reductase; structur 99.48
3rkr_A 262 Short chain oxidoreductase; rossmann fold; HET: NA 99.48
3tjr_A 301 Short chain dehydrogenase; structural genomics, se 99.47
4ibo_A 271 Gluconate dehydrogenase; enzyme function initiativ 99.47
3e03_A 274 Short chain dehydrogenase; structural genomics, PS 99.47
3uf0_A 273 Short-chain dehydrogenase/reductase SDR; gluconate 99.47
2c29_D 337 Dihydroflavonol 4-reductase; flavonoids, short deh 99.47
2o23_A 265 HADH2 protein; HSD17B10, schad, ERAB, type II HADH 99.47
4egf_A 266 L-xylulose reductase; structural genomics, ssgcid, 99.47
3ijr_A 291 Oxidoreductase, short chain dehydrogenase/reducta; 99.47
2rhc_B 277 Actinorhodin polyketide ketoreductase; oxidoreduct 99.47
3nyw_A 250 Putative oxidoreductase; fatty acid synthesis,3-ox 99.47
1yb1_A 272 17-beta-hydroxysteroid dehydrogenase type XI; shor 99.47
1fmc_A 255 7 alpha-hydroxysteroid dehydrogenase; short-chain 99.46
3v2g_A 271 3-oxoacyl-[acyl-carrier-protein] reductase; struct 99.46
4dmm_A 269 3-oxoacyl-[acyl-carrier-protein] reductase; rossma 99.46
1xq1_A 266 Putative tropinone reducatse; structural genomics, 99.46
3cxt_A 291 Dehydrogenase with different specificities; rossma 99.46
3ucx_A 264 Short chain dehydrogenase; ssgcid, seattle structu 99.46
3ioy_A 319 Short-chain dehydrogenase/reductase SDR; structura 99.46
4fgs_A 273 Probable dehydrogenase protein; PSI-biology, nysgr 99.46
3i4f_A 264 3-oxoacyl-[acyl-carrier protein] reductase; struct 99.46
3u5t_A 267 3-oxoacyl-[acyl-carrier-protein] reductase; struct 99.45
2b4q_A 276 Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier 99.45
1xhl_A 297 Short-chain dehydrogenase/reductase family member 99.45
1sby_A 254 Alcohol dehydrogenase; ternary complex, NAD, trifl 99.45
3afn_B 258 Carbonyl reductase; alpha/beta/alpha, rossmann-fol 99.45
1zem_A 262 Xylitol dehydrogenase; rossmann fold, dinucleotide 99.45
3rd5_A 291 Mypaa.01249.C; ssgcid, structural genomics, seattl 99.45
3tox_A 280 Short chain dehydrogenase; structural genomics, PS 99.45
1g0o_A 283 Trihydroxynaphthalene reductase; protein-NADPH-act 99.45
3tzq_B 271 Short-chain type dehydrogenase/reductase; ssgcid, 99.44
2jah_A 247 Clavulanic acid dehydrogenase; short-chain dehydro 99.44
3osu_A 246 3-oxoacyl-[acyl-carrier-protein] reductase; struct 99.44
1ja9_A 274 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; p 99.44
2zat_A 260 Dehydrogenase/reductase SDR family member 4; alpha 99.44
3n74_A 261 3-ketoacyl-(acyl-carrier-protein) reductase; seatt 99.44
3o26_A 311 Salutaridine reductase; short chain dehydrogenase/ 99.44
1xkq_A 280 Short-chain reductase family member (5D234); parra 99.44
3zv4_A 281 CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; ox 99.44
2z1n_A 260 Dehydrogenase; reductase, SDR, oxidoreductase; 1.8 99.44
3ppi_A 281 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, de 99.44
3ctm_A 279 Carbonyl reductase; alcohol dehydrogenase, short-c 99.44
3enk_A 341 UDP-glucose 4-epimerase; seattle structural genomi 99.43
4dqx_A 277 Probable oxidoreductase protein; structural genomi 99.43
1h5q_A 265 NADP-dependent mannitol dehydrogenase; oxidoreduct 99.43
3v2h_A 281 D-beta-hydroxybutyrate dehydrogenase; structural g 99.43
1iy8_A 267 Levodione reductase; oxidoreductase; HET: NAD; 1.6 99.43
3lf2_A 265 Short chain oxidoreductase Q9HYA2; SDR, SCOR, ross 99.43
3s55_A 281 Putative short-chain dehydrogenase/reductase; stru 99.43
3ruf_A 351 WBGU; rossmann fold, UDP-hexose 4-epimerase, isome 99.43
4da9_A 280 Short-chain dehydrogenase/reductase; structural ge 99.42
2qq5_A 260 DHRS1, dehydrogenase/reductase SDR family member 1 99.42
3is3_A 270 17BETA-hydroxysteroid dehydrogenase; short chain d 99.42
1w6u_A 302 2,4-dienoyl-COA reductase, mitochondrial precursor 99.42
2c07_A 285 3-oxoacyl-(acyl-carrier protein) reductase; oxidor 99.42
3pxx_A 287 Carveol dehydrogenase; structural genomics, seattl 99.42
3ftp_A 270 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid 99.42
3t4x_A 267 Oxidoreductase, short chain dehydrogenase/reducta; 99.42
2rh8_A 338 Anthocyanidin reductase; flavonoids, rossmann fold 99.42
3pgx_A 280 Carveol dehydrogenase; structural genomics, seattl 99.42
2uvd_A 246 3-oxoacyl-(acyl-carrier-protein) reductase; beta-k 99.42
3oid_A 258 Enoyl-[acyl-carrier-protein] reductase [NADPH]; fa 99.42
3l77_A 235 Short-chain alcohol dehydrogenase; oxidoreductase; 99.41
1geg_A 256 Acetoin reductase; SDR family, oxidoreductase; HET 99.41
3u9l_A 324 3-oxoacyl-[acyl-carrier-protein] reductase; struct 99.41
1spx_A 278 Short-chain reductase family member (5L265); paral 99.41
1wma_A 276 Carbonyl reductase [NADPH] 1; oxidoreductase; HET: 99.41
3sx2_A 278 Putative 3-ketoacyl-(acyl-carrier-protein) reduct; 99.41
3gem_A 260 Short chain dehydrogenase; structural genomics, AP 99.41
2pd6_A 264 Estradiol 17-beta-dehydrogenase 8; short-chain deh 99.41
2q2v_A 255 Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidore 99.41
3e8x_A 236 Putative NAD-dependent epimerase/dehydratase; stru 99.41
2wsb_A 254 Galactitol dehydrogenase; oxidoreductase, SDR, ros 99.41
3kvo_A 346 Hydroxysteroid dehydrogenase-like protein 2; HSDL2 99.41
3r3s_A 294 Oxidoreductase; structural genomics, csgid, center 99.4
2pnf_A 248 3-oxoacyl-[acyl-carrier-protein] reductase; short 99.4
3a28_C 258 L-2.3-butanediol dehydrogenase; chiral substrate r 99.4
1vl8_A 267 Gluconate 5-dehydrogenase; TM0441, structural geno 99.4
2x9g_A 288 PTR1, pteridine reductase; short chain dehydrogena 99.4
4egb_A 346 DTDP-glucose 4,6-dehydratase; rhamnose pathway, ce 99.4
1sny_A 267 Sniffer CG10964-PA; alpha and beta protein, rossma 99.4
4e6p_A 259 Probable sorbitol dehydrogenase (L-iditol 2-dehyd; 99.4
3uve_A 286 Carveol dehydrogenase ((+)-trans-carveol dehydrog; 99.4
3ak4_A 263 NADH-dependent quinuclidinone reductase; SDR, (R)- 99.39
3op4_A 248 3-oxoacyl-[acyl-carrier protein] reductase; 3-keto 99.39
3un1_A 260 Probable oxidoreductase; structural genomics, PSI- 99.39
3l6e_A 235 Oxidoreductase, short-chain dehydrogenase/reducta; 99.39
3f1l_A 252 Uncharacterized oxidoreductase YCIK; E. coli, NADP 99.39
2cfc_A 250 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidor 99.39
3grp_A 266 3-oxoacyl-(acyl carrierprotein) reductase; structu 99.39
2ew8_A 249 (S)-1-phenylethanol dehydrogenase; transferase; 2. 99.39
2gdz_A 267 NAD+-dependent 15-hydroxyprostaglandin dehydrogen; 99.39
3ezl_A 256 Acetoacetyl-COA reductase; ssgcid, acetyacetyl-COA 99.39
1yo6_A 250 Putative carbonyl reductase sniffer; tyrosine-depe 99.39
4iiu_A 267 3-oxoacyl-[acyl-carrier protein] reductase; struct 99.39
1e7w_A 291 Pteridine reductase; dihydrofolate reductase, shor 99.39
2z1m_A 345 GDP-D-mannose dehydratase; short-chain dehydrogena 99.39
2bgk_A 278 Rhizome secoisolariciresinol dehydrogenase; oxidor 99.39
3dii_A 247 Short-chain dehydrogenase/reductase SDR; SCOR, ros 99.38
3t7c_A 299 Carveol dehydrogenase; structural genomics, seattl 99.38
4dry_A 281 3-oxoacyl-[acyl-carrier-protein] reductase; struct 99.38
1yxm_A 303 Pecra, peroxisomal trans 2-enoyl COA reductase; pe 99.38
3tsc_A 277 Putative oxidoreductase; structural genomics, seat 99.38
2ehd_A 234 Oxidoreductase, oxidoreductase, short-chain dehydr 99.38
3gk3_A 269 Acetoacetyl-COA reductase; acetoacetyl-CO reductas 99.38
1uls_A 245 Putative 3-oxoacyl-acyl carrier protein reductase; 99.38
1zk4_A 251 R-specific alcohol dehydrogenase; short chain redu 99.38
3rwb_A 247 TPLDH, pyridoxal 4-dehydrogenase; short chain dehy 99.38
1gee_A 261 Glucose 1-dehydrogenase; short-chain dehydrogenase 99.37
3gvc_A 277 Oxidoreductase, probable short-chain type dehydrog 99.37
2qhx_A 328 Pteridine reductase 1; oxidoreductase, short-chain 99.37
1x1t_A 260 D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, S 99.37
3o38_A 266 Short chain dehydrogenase; tuberculosis, ortholog 99.37
3sxp_A 362 ADP-L-glycero-D-mannoheptose-6-epimerase; rossman 99.37
4eso_A 255 Putative oxidoreductase; NADP, structural genomics 99.36
4fc7_A 277 Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossman 99.36
3qlj_A 322 Short chain dehydrogenase; structural genomics, se 99.36
2d1y_A 256 Hypothetical protein TT0321; strucrtural genomics, 99.36
1mxh_A 276 Pteridine reductase 2; SDR topology, protein-subst 99.36
1xu9_A 286 Corticosteroid 11-beta-dehydrogenase, isozyme 1; h 99.36
2a4k_A 263 3-oxoacyl-[acyl carrier protein] reductase; reduct 99.36
3icc_A 255 Putative 3-oxoacyl-(acyl carrier protein) reducta; 99.36
3k31_A 296 Enoyl-(acyl-carrier-protein) reductase; ssgcid, NI 99.36
3i1j_A 247 Oxidoreductase, short chain dehydrogenase/reducta; 99.35
3dqp_A 219 Oxidoreductase YLBE; alpha-beta protein., structur 99.35
2bd0_A 244 Sepiapterin reductase; oxidoreductase; HET: NAP BI 99.35
3oig_A 266 Enoyl-[acyl-carrier-protein] reductase [NADH]; fat 99.35
1hdc_A 254 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxi 99.35
1rpn_A 335 GDP-mannose 4,6-dehydratase; short-chain dehydroge 99.35
4h15_A 261 Short chain alcohol dehydrogenase-related dehydro; 99.35
3d3w_A 244 L-xylulose reductase; uronate cycle, short-chain d 99.35
1cyd_A 244 Carbonyl reductase; short-chain dehydrogenase, oxi 99.35
3qvo_A 236 NMRA family protein; structural genomics, PSI-biol 99.35
3ew7_A 221 LMO0794 protein; Q8Y8U8_lismo, putative NAD-depend 99.34
3tl3_A 257 Short-chain type dehydrogenase/reductase; ssgcid, 99.34
1rkx_A 357 CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 99.34
1oaa_A 259 Sepiapterin reductase; tetrahydrobiopterin, oxidor 99.34
3oec_A 317 Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; 99.34
1hxh_A 253 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-b 99.34
4b79_A 242 PA4098, probable short-chain dehydrogenase; oxidor 99.34
3r6d_A 221 NAD-dependent epimerase/dehydratase; structural ge 99.33
2ag5_A 246 DHRS6, dehydrogenase/reductase (SDR family) member 99.33
2pzm_A 330 Putative nucleotide sugar epimerase/ dehydratase; 99.33
2pd4_A 275 Enoyl-[acyl-carrier-protein] reductase [NADH]; ant 99.33
3slg_A 372 PBGP3 protein; structural genomics, seattle struct 99.33
4e3z_A 272 Putative oxidoreductase protein; PSI-biology, stru 99.33
1nff_A 260 Putative oxidoreductase RV2002; directed evolution 99.33
4dyv_A 272 Short-chain dehydrogenase/reductase SDR; structura 99.33
1xg5_A 279 ARPG836; short chain dehydrogenase, human, SGC, st 99.33
2p4h_X 322 Vestitone reductase; NADPH-dependent reductase, is 99.33
3rft_A 267 Uronate dehydrogenase; apoenzyme, rossmann fold, N 99.32
1orr_A 347 CDP-tyvelose-2-epimerase; rossmann fold, short-cha 99.32
3dhn_A 227 NAD-dependent epimerase/dehydratase; reductase, PF 99.31
3guy_A 230 Short-chain dehydrogenase/reductase SDR; structura 99.31
1qsg_A 265 Enoyl-[acyl-carrier-protein] reductase; enoyl redu 99.31
2q1w_A 333 Putative nucleotide sugar epimerase/ dehydratase; 99.31
3ek2_A 271 Enoyl-(acyl-carrier-protein) reductase (NADH); ssg 99.31
2nwq_A 272 Probable short-chain dehydrogenase; oxidoreductase 99.31
2hun_A 336 336AA long hypothetical DTDP-glucose 4,6-dehydrat; 99.31
2fwm_X 250 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; e 99.31
1t2a_A 375 GDP-mannose 4,6 dehydratase; structural genomics c 99.31
2dtx_A 264 Glucose 1-dehydrogenase related protein; rossmann 99.3
1ek6_A 348 UDP-galactose 4-epimerase; short-chain dehydrogena 99.3
3h2s_A 224 Putative NADH-flavin reductase; Q03B84, NESG, LCR1 99.3
3f9i_A 249 3-oxoacyl-[acyl-carrier-protein] reductase; 3-keto 99.3
3p19_A 266 BFPVVD8, putative blue fluorescent protein; rossma 99.3
1yde_A 270 Retinal dehydrogenase/reductase 3; oxidoreductase, 99.3
3nrc_A 280 Enoyl-[acyl-carrier-protein] reductase (NADH); ros 99.3
2nm0_A 253 Probable 3-oxacyl-(acyl-carrier-protein) reductas; 99.29
1oc2_A 348 DTDP-glucose 4,6-dehydratase; lyase, NADH, rhamnos 99.29
4b4o_A 298 Epimerase family protein SDR39U1; isomerase; HET: 99.29
2b69_A 343 UDP-glucuronate decarboxylase 1; UDP-glucoronic ac 99.29
3gdg_A 267 Probable NADP-dependent mannitol dehydrogenase; ro 99.29
1xgk_A 352 Nitrogen metabolite repression regulator NMRA; ros 99.28
2c5a_A 379 GDP-mannose-3', 5'-epimerase; short chain dehydrat 99.28
2p91_A 285 Enoyl-[acyl-carrier-protein] reductase [NADH]; NAD 99.28
1sb8_A 352 WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCN 99.27
2wyu_A 261 Enoyl-[acyl carrier protein] reductase; oxidoreduc 99.27
3e9n_A 245 Putative short-chain dehydrogenase/reductase; stru 99.27
3grk_A 293 Enoyl-(acyl-carrier-protein) reductase (NADH); ssg 99.27
1edo_A 244 Beta-keto acyl carrier protein reductase; nucleoti 99.27
1hdo_A 206 Biliverdin IX beta reductase; foetal metabolism, H 99.26
3m2p_A 311 UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J 99.26
2hrz_A 342 AGR_C_4963P, nucleoside-diphosphate-sugar epimeras 99.26
4id9_A 347 Short-chain dehydrogenase/reductase; putative dehy 99.26
4dqv_A 478 Probable peptide synthetase NRP (peptide synthase; 99.25
2bka_A 242 CC3, TAT-interacting protein TIP30; NADPH, PEG600, 99.25
2ph3_A 245 3-oxoacyl-[acyl carrier protein] reductase; TTHA04 99.25
1n7h_A 381 GDP-D-mannose-4,6-dehydratase; rossmann fold, SDR, 99.25
1db3_A 372 GDP-mannose 4,6-dehydratase; NADP, GDP-fucose, lya 99.25
2a35_A 215 Hypothetical protein PA4017; alpha-beta-alpha sand 99.25
2q1s_A 377 Putative nucleotide sugar epimerase/ dehydratase; 99.24
2x4g_A 342 Nucleoside-diphosphate-sugar epimerase; isomerase; 99.24
1kew_A 361 RMLB;, DTDP-D-glucose 4,6-dehydratase; rossmann fo 99.24
3rku_A 287 Oxidoreductase YMR226C; substrate fingerprint, sho 99.24
1r6d_A 337 TDP-glucose-4,6-dehydratase; rossmann fold, short- 99.24
3vtz_A 269 Glucose 1-dehydrogenase; rossmann fold, oxidoreduc 99.24
3i6i_A 346 Putative leucoanthocyanidin reductase 1; rossmann 99.23
3ko8_A 312 NAD-dependent epimerase/dehydratase; isomerase, UD 99.23
3asu_A 248 Short-chain dehydrogenase/reductase SDR; SDR famil 99.23
2r6j_A 318 Eugenol synthase 1; phenylpropene, PIP reductase, 99.23
1y1p_A 342 ARII, aldehyde reductase II; rossmann fold, short 99.23
2gn4_A 344 FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann 99.21
1xq6_A 253 Unknown protein; structural genomics, protein stru 99.2
4f6c_A 427 AUSA reductase domain protein; thioester reductase 99.2
1z45_A 699 GAL10 bifunctional protein; epimerase, mutarotase, 99.2
2h7i_A 269 Enoyl-[acyl-carrier-protein] reductase [NADH]; oxi 99.2
1udb_A 338 Epimerase, UDP-galactose-4-epimerase; isomerase; H 99.19
2wm3_A 299 NMRA-like family domain containing protein 1; unkn 99.19
3mje_A 496 AMPHB; rossmann fold, oxidoreductase; HET: NDP; 1. 99.19
3ius_A 286 Uncharacterized conserved protein; APC63810, silic 99.19
2bll_A 345 Protein YFBG; decarboxylase, short chain dehydroge 99.19
2pk3_A 321 GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, shor 99.18
1jtv_A 327 17 beta-hydroxysteroid dehydrogenase type 1; stero 99.18
1gy8_A 397 UDP-galactose 4-epimerase; oxidoreductase; HET: NA 99.18
2c20_A 330 UDP-glucose 4-epimerase; carbohydrate metabolism, 99.17
1o5i_A 249 3-oxoacyl-(acyl carrier protein) reductase; TM1169 99.17
1uay_A 242 Type II 3-hydroxyacyl-COA dehydrogenase; beta oxid 99.16
2ekp_A 239 2-deoxy-D-gluconate 3-dehydrogenase; structural ge 99.15
3nzo_A 399 UDP-N-acetylglucosamine 4,6-dehydratase; structura 99.15
1ooe_A 236 Dihydropteridine reductase; structural genomics, P 99.15
3orf_A 251 Dihydropteridine reductase; alpha-beta-alpha sandw 99.15
2z5l_A 511 Tylkr1, tylactone synthase starter module and modu 99.15
1uzm_A 247 3-oxoacyl-[acyl-carrier protein] reductase; beta-k 99.15
1qyc_A 308 Phenylcoumaran benzylic ether reductase PT1; NADPH 99.15
1dhr_A 241 Dihydropteridine reductase; oxidoreductase(acting 99.14
2v6g_A 364 Progesterone 5-beta-reductase; tyrosine-dependent 99.14
3uxy_A 266 Short-chain dehydrogenase/reductase SDR; structura 99.14
3e48_A 289 Putative nucleoside-diphosphate-sugar epimerase; a 99.13
3kzv_A 254 Uncharacterized oxidoreductase YIR035C; cytoplasmi 99.13
3gpi_A 286 NAD-dependent epimerase/dehydratase; structural ge 99.13
4e4y_A 244 Short chain dehydrogenase family protein; structur 99.12
2gas_A 307 Isoflavone reductase; NADPH-dependent reductase, o 99.12
1qyd_A 313 Pinoresinol-lariciresinol reductase; NADPH-depende 99.12
3c1o_A 321 Eugenol synthase; phenylpropene, PIP reductase, sh 99.11
3uce_A 223 Dehydrogenase; rossmann fold, oxidoreductase; HET: 99.11
2fr1_A 486 Erythromycin synthase, eryai; short chain dehydrog 99.11
1i24_A 404 Sulfolipid biosynthesis protein SQD1; SDR, short-c 99.11
2yy7_A 312 L-threonine dehydrogenase; thermolabIle, flavobact 99.11
3s8m_A 422 Enoyl-ACP reductase; rossmann fold, oxidoreductase 99.1
2p5y_A 311 UDP-glucose 4-epimerase; TTHA0591, structural geno 99.1
3vps_A 321 TUNA, NAD-dependent epimerase/dehydratase; tunicam 99.09
1z7e_A 660 Protein aRNA; rossmann fold, OB-like fold, hydrola 99.09
2dkn_A 255 3-alpha-hydroxysteroid dehydrogenase; oxidoreducta 99.09
2jl1_A 287 Triphenylmethane reductase; oxidoreductase, biorem 99.09
3ay3_A 267 NAD-dependent epimerase/dehydratase; glucuronic ac 99.08
1fjh_A 257 3alpha-hydroxysteroid dehydrogenase/carbonyl reduc 99.07
2ydy_A 315 Methionine adenosyltransferase 2 subunit beta; oxi 99.07
4f6l_B 508 AUSA reductase domain protein; thioester reductase 99.06
2et6_A 604 (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-ox 99.06
3zu3_A 405 Putative reductase YPO4104/Y4119/YP_4011; oxidored 99.06
3qp9_A 525 Type I polyketide synthase pikaii; rossmann fold, 99.04
4eue_A 418 Putative reductase CA_C0462; TER, biofuel, synthet 99.02
2zcu_A 286 Uncharacterized oxidoreductase YTFG; alpha-beta sa 99.01
3oh8_A 516 Nucleoside-diphosphate sugar epimerase (SULA FAMI; 99.0
3d7l_A 202 LIN1944 protein; APC89317, structural genomics, PS 99.0
3slk_A 795 Polyketide synthase extender module 2; rossmann fo 98.98
3u0b_A 454 Oxidoreductase, short chain dehydrogenase/reducta 98.98
2pff_A 1688 Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl 98.97
1d7o_A 297 Enoyl-[acyl-carrier protein] reductase (NADH) PRE; 98.97
3zen_D 3089 Fatty acid synthase; transferase, mycolic acid bio 98.97
2uv9_A 1878 Fatty acid synthase alpha subunits; fungal, dehydr 98.96
2uv8_A 1887 Fatty acid synthase subunit alpha (FAS2); fatty ac 98.95
1zmt_A 254 Haloalcohol dehalogenase HHEC; halohydrin dehaloge 98.95
1gz6_A 319 Estradiol 17 beta-dehydrogenase 4; 17BETA-HSD4, MF 98.94
3ehe_A 313 UDP-glucose 4-epimerase (GALE-1); PSI-II, NYSGXRC, 98.93
2et6_A 604 (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-ox 98.93
2x6t_A 357 ADP-L-glycero-D-manno-heptose-6-epimerase; isomera 98.92
3oml_A 613 GH14720P, peroxisomal multifunctional enzyme type 98.92
3lt0_A 329 Enoyl-ACP reductase; triclosan, triclosan variant, 98.92
1vl0_A 292 DTDP-4-dehydrorhamnose reductase, RFBD ortholog; s 98.9
2o2s_A 315 Enoyl-acyl carrier reductase; enoyl reductase, tri 98.9
2ptg_A 319 Enoyl-acyl carrier reductase; apicomplexa, enoyl ( 98.9
1lu9_A 287 Methylene tetrahydromethanopterin dehydrogenase; a 98.9
2yut_A 207 Putative short-chain oxidoreductase; alpha and bet 98.9
3sc6_A 287 DTDP-4-dehydrorhamnose reductase; RFBD, structural 98.9
3ic5_A118 Putative saccharopine dehydrogenase; structural ge 98.89
1e6u_A 321 GDP-fucose synthetase; epimerase/reductase, SDR, R 98.89
3ajr_A 317 NDP-sugar epimerase; L-threonine dehydrogenase, L- 98.85
2vz8_A 2512 Fatty acid synthase; transferase, phosphopantethei 98.83
1n2s_A 299 DTDP-4-, DTDP-glucose oxidoreductase; rossman-fold 98.82
1zmo_A 244 Halohydrin dehalogenase; haloalcohol dehalogenase, 98.8
2ggs_A 273 273AA long hypothetical DTDP-4-dehydrorhamnose red 98.77
1eq2_A 310 ADP-L-glycero-D-mannoheptose 6-epimerase; N-termin 98.76
3st7_A 369 Capsular polysaccharide synthesis enzyme CAP5F; ro 98.71
1u7z_A 226 Coenzyme A biosynthesis bifunctional protein coabc 98.68
4ggo_A 401 Trans-2-enoyl-COA reductase; rossmann fold, oxidor 98.65
2gk4_A 232 Conserved hypothetical protein; alpha-beta-alpha s 98.64
3llv_A141 Exopolyphosphatase-related protein; NAD(P)-binding 98.57
4b8w_A 319 GDP-L-fucose synthase; oxidoreductase; HET: NAP GD 98.55
1y7t_A 327 Malate dehydrogenase; NAD-dependent-MDH-NADPH comp 98.51
1ff9_A 450 Saccharopine reductase; lysine biosynthesis, alpha 98.44
2hmt_A144 YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane 98.34
1id1_A153 Putative potassium channel protein; RCK domain, E. 98.27
1pqw_A198 Polyketide synthase; rossmann fold, dimer, structu 98.25
4ina_A 405 Saccharopine dehydrogenase; structural genomics, P 98.24
1b8p_A 329 Protein (malate dehydrogenase); oxidoreductase; 1. 98.18
2g1u_A155 Hypothetical protein TM1088A; structural genomics, 98.18
1lss_A140 TRK system potassium uptake protein TRKA homolog; 98.17
2axq_A 467 Saccharopine dehydrogenase; rossmann fold variant, 98.13
1jay_A 212 Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossma 98.12
3l4b_C 218 TRKA K+ channel protien TM1088B; potassium channel 98.09
1nyt_A271 Shikimate 5-dehydrogenase; alpha/beta domains, WID 98.07
1v3u_A 333 Leukotriene B4 12- hydroxydehydrogenase/prostaglan 98.07
2hcy_A 347 Alcohol dehydrogenase 1; tetramer of asymmetric di 98.06
1smk_A 326 Malate dehydrogenase, glyoxysomal; tricarboxylic c 98.04
3fwz_A140 Inner membrane protein YBAL; TRKA-N domain, E.coli 98.01
3c24_A 286 Putative oxidoreductase; YP_511008.1, structural g 97.97
1p77_A272 Shikimate 5-dehydrogenase; NADPH, oxidoreductase; 97.96
1nvt_A 287 Shikimate 5'-dehydrogenase; structural genomics, P 97.94
1qor_A 327 Quinone oxidoreductase; HET: NAP; 2.20A {Escherich 97.9
3o8q_A281 Shikimate 5-dehydrogenase I alpha; structural geno 97.9
1wly_A 333 CAAR, 2-haloacrylate reductase; NADPH-dependent ox 97.9
1iz0_A 302 Quinone oxidoreductase; APO-enzyme, riken structur 97.89
3tnl_A 315 Shikimate dehydrogenase; structural genomics, cent 97.89
1yb5_A 351 Quinone oxidoreductase; medium-chain dehydrogenase 97.87
2j8z_A 354 Quinone oxidoreductase; medium-chain dehydrogenase 97.87
2j3h_A 345 NADP-dependent oxidoreductase P1; double bond redu 97.87
3jyo_A283 Quinate/shikimate dehydrogenase; enzyme-cofactor c 97.86
4b7c_A 336 Probable oxidoreductase; NADP cofactor, rossmann f 97.86
4eye_A 342 Probable oxidoreductase; structural genomics, niai 97.86
4g65_A 461 TRK system potassium uptake protein TRKA; structur 97.86
3ond_A 488 Adenosylhomocysteinase; plant protein, enzyme-subs 97.85
2zb4_A 357 Prostaglandin reductase 2; rossmann fold, alternat 97.84
3abi_A 365 Putative uncharacterized protein PH1688; L-lysine 97.81
3pwz_A272 Shikimate dehydrogenase 3; alpha-beta, oxidoreduct 97.8
4dup_A 353 Quinone oxidoreductase; PSI-biology, structural ge 97.8
3gms_A 340 Putative NADPH:quinone reductase; structural genom 97.78
2o7s_A 523 DHQ-SDH PR, bifunctional 3-dehydroquinate dehydrat 97.78
3phh_A269 Shikimate dehydrogenase; shikimate pathway, helico 97.78
3qwb_A 334 Probable quinone oxidoreductase; rossmann fold, qu 97.77
2eez_A 369 Alanine dehydrogenase; TTHA0216, structural genomi 97.72
3jyn_A 325 Quinone oxidoreductase; rossmann fold, protein-NAD 97.7
1pzg_A 331 LDH, lactate dehydrogenase; apicomplexa, APAD, tet 97.69
2eih_A 343 Alcohol dehydrogenase; zinc ION binding protein, s 97.67
3don_A 277 Shikimate dehydrogenase; alpha-beta structure, ros 97.65
1f0y_A 302 HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive 97.63
2aef_A 234 Calcium-gated potassium channel MTHK; rossmann fol 97.62
1jvb_A 347 NAD(H)-dependent alcohol dehydrogenase; archaeon, 97.61
3t4e_A 312 Quinate/shikimate dehydrogenase; structural genomi 97.61
4huj_A 220 Uncharacterized protein; PSI-biology, nysgrc, stru 97.59
2cdc_A 366 Glucose dehydrogenase glucose 1-dehydrogenase, DHG 97.58
1ks9_A 291 KPA reductase;, 2-dehydropantoate 2-reductase; PAN 97.57
3lk7_A 451 UDP-N-acetylmuramoylalanine--D-glutamate ligase; a 97.57
3c85_A183 Putative glutathione-regulated potassium-efflux S 97.57
3pi7_A 349 NADH oxidoreductase; groes-like fold, NAD(P)-bindi 97.56
3tl2_A 315 Malate dehydrogenase; center for structural genomi 97.55
2c0c_A 362 Zinc binding alcohol dehydrogenase, domain contain 97.55
2egg_A297 AROE, shikimate 5-dehydrogenase; dimer, X-RAY diff 97.55
1mld_A 314 Malate dehydrogenase; oxidoreductase(NAD(A)-CHOH(D 97.53
1pjc_A 361 Protein (L-alanine dehydrogenase); oxidoreductase, 97.53
3k96_A 356 Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA 97.52
3fbg_A 346 Putative arginate lyase; structural genomics, unkn 97.52
1xa0_A 328 Putative NADPH dependent oxidoreductases; structur 97.52
4a0s_A 447 Octenoyl-COA reductase/carboxylase; oxidoreductase 97.51
2vns_A 215 Metalloreductase steap3; metal-binding, transmembr 97.51
2pv7_A 298 T-protein [includes: chorismate mutase (EC 5.4.99 97.5
2raf_A 209 Putative dinucleotide-binding oxidoreductase; NP_7 97.49
2ew2_A 316 2-dehydropantoate 2-reductase, putative; alpha-str 97.49
1tt7_A 330 YHFP; alcohol dehydrogenase, Zn-dependent, NAD, st 97.48
1hye_A 313 L-lactate/malate dehydrogenase; nucleotide binding 97.48
1y6j_A 318 L-lactate dehydrogenase; southeast collaboratory f 97.47
4e12_A 283 Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1 97.47
1o6z_A 303 MDH, malate dehydrogenase; halophilic, ION-binding 97.46
1dih_A 273 Dihydrodipicolinate reductase; oxidoreductase; HET 97.46
1bg6_A 359 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L 97.45
2ewd_A 317 Lactate dehydrogenase,; protein-substrate_cofactor 97.42
3fbt_A 282 Chorismate mutase and shikimate 5-dehydrogenase fu 97.41
3dtt_A 245 NADP oxidoreductase; structural genomics, joint ce 97.38
3qha_A 296 Putative oxidoreductase; seattle structural genomi 97.35
2vhw_A 377 Alanine dehydrogenase; NAD, secreted, oxidoreducta 97.34
3ggo_A 314 Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-b 97.34
3nx4_A 324 Putative oxidoreductase; csgid, structural genomic 97.32
3gaz_A 343 Alcohol dehydrogenase superfamily protein; oxidore 97.32
1piw_A 360 Hypothetical zinc-type alcohol dehydrogenase- like 97.32
3oj0_A144 Glutr, glutamyl-tRNA reductase; structural genomic 97.31
3l9w_A 413 Glutathione-regulated potassium-efflux system Pro 97.3
3krt_A 456 Crotonyl COA reductase; structural genomics, prote 97.3
1rjw_A 339 ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD 97.3
2vn8_A 375 Reticulon-4-interacting protein 1; mitochondrion, 97.29
3pef_A 287 6-phosphogluconate dehydrogenase, NAD-binding; gam 97.28
3pqe_A 326 L-LDH, L-lactate dehydrogenase; FBP, oxidoreductas 97.27
1lld_A 319 L-lactate dehydrogenase; oxidoreductase(CHOH (D)-N 97.26
2uyy_A 316 N-PAC protein; long-chain dehydrogenase, cytokine; 97.26
3two_A 348 Mannitol dehydrogenase; cinnamyl-alcohol dehydroge 97.24
2nqt_A 352 N-acetyl-gamma-glutamyl-phosphate reductase; apopr 97.24
3doj_A 310 AT3G25530, dehydrogenase-like protein; gamma-hydro 97.23
5mdh_A 333 Malate dehydrogenase; oxidoreductase, (NAD(A)-CHOH 97.22
3gvi_A 324 Malate dehydrogenase; NAD, oxidoreductase, tricarb 97.2
4e21_A 358 6-phosphogluconate dehydrogenase (decarboxylating; 97.2
3mog_A 483 Probable 3-hydroxybutyryl-COA dehydrogenase; struc 97.19
2hjr_A 328 Malate dehydrogenase; malaria, structural genomics 97.19
3fi9_A 343 Malate dehydrogenase; structural genomics, oxidore 97.17
4ezb_A 317 Uncharacterized conserved protein; structural geno 97.17
1ur5_A 309 Malate dehydrogenase; oxidoreductase, tricarboxyli 97.14
2ozp_A 345 N-acetyl-gamma-glutamyl-phosphate reductase; amino 97.13
3g0o_A 303 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine 97.12
4gbj_A 297 6-phosphogluconate dehydrogenase NAD-binding; stru 97.11
3gg2_A 450 Sugar dehydrogenase, UDP-glucose/GDP-mannose dehyd 97.11
2d8a_A 348 PH0655, probable L-threonine 3-dehydrogenase; pyro 97.11
1jw9_B 249 Molybdopterin biosynthesis MOEB protein; MOEB: mod 97.1
2qyt_A 317 2-dehydropantoate 2-reductase; APC81190, porphyrom 97.1
3p2o_A285 Bifunctional protein fold; structural genomics, ce 97.08
1yqd_A 366 Sinapyl alcohol dehydrogenase; lignin, monolignol, 97.08
1t2d_A 322 LDH-P, L-lactate dehydrogenase; ternary complex, o 97.08
1gu7_A 364 Enoyl-[acyl-carrier-protein] reductase [NADPH, B-s 97.08
2f1k_A 279 Prephenate dehydrogenase; tyrosine synthesis, X-RA 97.06
2rcy_A 262 Pyrroline carboxylate reductase; malaria, structur 97.05
3pdu_A 287 3-hydroxyisobutyrate dehydrogenase family protein; 97.04
3goh_A 315 Alcohol dehydrogenase, zinc-containing; NP_718042. 97.04
3i83_A 320 2-dehydropantoate 2-reductase; structural genomics 97.03
2rir_A300 Dipicolinate synthase, A chain; structural genomic 97.0
1guz_A 310 Malate dehydrogenase; oxidoreductase, tricarboxyli 97.0
3uog_A 363 Alcohol dehydrogenase; structural genomics, protei 97.0
4dvj_A 363 Putative zinc-dependent alcohol dehydrogenase Pro; 96.99
3u62_A253 Shikimate dehydrogenase; shikimate pathway, oxidor 96.99
1vpd_A 299 Tartronate semialdehyde reductase; structural geno 96.98
1uuf_A 369 YAHK, zinc-type alcohol dehydrogenase-like protein 96.97
1leh_A 364 Leucine dehydrogenase; oxidoreductase; 2.20A {Lysi 96.97
3hn2_A 312 2-dehydropantoate 2-reductase; PSI-2, NYSGXRC, str 96.96
1e3j_A 352 NADP(H)-dependent ketose reductase; oxidoreductase 96.96
2gcg_A 330 Glyoxylate reductase/hydroxypyruvate reductase; NA 96.95
1ys4_A 354 Aspartate-semialdehyde dehydrogenase; oxidoreducta 96.95
2dpo_A 319 L-gulonate 3-dehydrogenase; structural genomics, N 96.93
1xyg_A 359 Putative N-acetyl-gamma-glutamyl-phosphate reduct; 96.93
4h7p_A 345 Malate dehydrogenase; ssgcid, structural G seattle 96.93
2dq4_A 343 L-threonine 3-dehydrogenase; NAD-dependent, oxidor 96.93
2v6b_A 304 L-LDH, L-lactate dehydrogenase; oxidoreductase, ra 96.93
2izz_A 322 Pyrroline-5-carboxylate reductase 1; amino-acid bi 96.92
2z2v_A 365 Hypothetical protein PH1688; L-lysine dehydrogenas 96.92
2hk9_A275 Shikimate dehydrogenase; shikimate pathway, drug d 96.92
1kjq_A 391 GART 2, phosphoribosylglycinamide formyltransferas 96.91
3ngx_A276 Bifunctional protein fold; methylenetetrahydrofola 96.9
1gpj_A 404 Glutamyl-tRNA reductase; tRNA-dependent tetrapyrro 96.89
3cky_A 301 2-hydroxymethyl glutarate dehydrogenase; rossmann 96.89
3ghy_A 335 Ketopantoate reductase protein; oxidoreductase, NA 96.89
1mv8_A 436 GMD, GDP-mannose 6-dehydrogenase; rossman fold, do 96.89
3qsg_A 312 NAD-binding phosphogluconate dehydrogenase-like P; 96.88
3d4o_A293 Dipicolinate synthase subunit A; NP_243269.1, stru 96.88
3s2e_A 340 Zinc-containing alcohol dehydrogenase superfamily; 96.88
2dbq_A 334 Glyoxylate reductase; D-3-phosphoglycerate dehydro 96.88
2h6e_A 344 ADH-4, D-arabinose 1-dehydrogenase; rossman fold, 96.88
3g17_A 294 Similar to 2-dehydropantoate 2-reductase; structur 96.87
3p7m_A 321 Malate dehydrogenase; putative dehydrogenase, enzy 96.86
1h2b_A 359 Alcohol dehydrogenase; oxidoreductase, archaea, hy 96.86
4dll_A 320 2-hydroxy-3-oxopropionate reductase; structural ge 96.86
2b5w_A 357 Glucose dehydrogenase; nucleotide binding motif, o 96.85
3gqv_A 371 Enoyl reductase; medium-chain reductase (MDR super 96.84
3dfz_A 223 SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase 96.83
3ktd_A 341 Prephenate dehydrogenase; structural genomics, joi 96.83
2ahr_A 259 Putative pyrroline carboxylate reductase; pyrrolin 96.82
1oju_A 294 MDH, malate dehydrogenase; hyperthermophilic, oxid 96.81
2h78_A 302 Hibadh, 3-hydroxyisobutyrate dehydrogenase; APC601 96.81
3tqh_A 321 Quinone oxidoreductase; HET: NDP; 2.44A {Coxiella 96.8
4a5o_A286 Bifunctional protein fold; oxidoreductase, hydrola 96.79
1evy_A 366 Glycerol-3-phosphate dehydrogenase; rossmann fold, 96.79
1vj0_A 380 Alcohol dehydrogenase, zinc-containing; TM0436, st 96.79
3l07_A285 Bifunctional protein fold; structural genomics, ID 96.78
3tri_A 280 Pyrroline-5-carboxylate reductase; amino acid bios 96.77
1txg_A 335 Glycerol-3-phosphate dehydrogenase [NAD(P)+]; oxid 96.77
1yqg_A 263 Pyrroline-5-carboxylate reductase; structural geno 96.76
3vku_A 326 L-LDH, L-lactate dehydrogenase; rossmann fold, NAD 96.76
1cdo_A 374 Alcohol dehydrogenase; oxidoreductase, oxidoreduct 96.76
1a5z_A 319 L-lactate dehydrogenase; oxidoreductase, glycolysi 96.75
2jhf_A 374 Alcohol dehydrogenase E chain; oxidoreductase, met 96.74
3ado_A 319 Lambda-crystallin; L-gulonate 3-dehydrogenase, str 96.74
1e3i_A 376 Alcohol dehydrogenase, class II; HET: NAD; 2.08A { 96.74
1yb4_A 295 Tartronic semialdehyde reductase; structural genom 96.73
3l6d_A 306 Putative oxidoreductase; structural genomics, prot 96.71
2vou_A 397 2,6-dihydroxypyridine hydroxylase; oxidoreductase, 96.7
>4fn4_A Short chain dehydrogenase; NADH-binding, rossmann fold, oxidoreductase; HET: NAD; 1.75A {Sulfolobus acidocaldarius} Back     alignment and structure
Probab=99.59  E-value=2.4e-15  Score=77.63  Aligned_cols=63  Identities=29%  Similarity=0.171  Sum_probs=52.7

Q ss_pred             CCCCCeEEEEecCcchHHHHHHHHHHHCCCEEEEEEeCCCCcchhHHhhhcCCCCceEEEEccC
Q 036468            1 MSGKGKVVCVTGASGFIASWLVKLLLQRSYTVKATVRDLNNHNAEHLLTLDGAEERLHLFKANS   64 (64)
Q Consensus         1 ~~~~~~~~~i~g~~~~ig~~~~~~l~~~~~~v~~~~r~~~~~~~~~~~~~~~~~~~~~~~~~Di   64 (64)
                      |++++|+++|||++++||+++++.|+++|++|++.+|+++..+ +..+++...+.++..+++|+
T Consensus         3 ~sL~gKvalVTGas~GIG~aiA~~la~~Ga~Vv~~~~~~~~~~-~~~~~i~~~g~~~~~~~~Dv   65 (254)
T 4fn4_A            3 QSLKNKVVIVTGAGSGIGRAIAKKFALNDSIVVAVELLEDRLN-QIVQELRGMGKEVLGVKADV   65 (254)
T ss_dssp             GGGTTCEEEEETTTSHHHHHHHHHHHHTTCEEEEEESCHHHHH-HHHHHHHHTTCCEEEEECCT
T ss_pred             CCCCCCEEEEeCCCCHHHHHHHHHHHHcCCEEEEEECCHHHHH-HHHHHHHhcCCcEEEEEccC
Confidence            4678899999999999999999999999999999999876554 34445555577889999986



>3h7a_A Short chain dehydrogenase; oxidoreductase, PSI-2, NYSGXRC, structural genomics, protein structure initiative; 1.87A {Rhodopseudomonas palustris} Back     alignment and structure
>4gkb_A 3-oxoacyl-[acyl-carrier protein] reductase; putative sugar dehydrogenase, enzyme function initiative, EF structural genomics; 1.50A {Burkholderia multivorans} PDB: 4glo_A* Back     alignment and structure
>3lyl_A 3-oxoacyl-(acyl-carrier-protein) reductase; alpha and beta protein, NAD(P)-binding rossmann fold, csgid, oxidoreductase; 1.95A {Francisella tularensis subsp} SCOP: c.2.1.2 Back     alignment and structure
>3r1i_A Short-chain type dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.95A {Mycobacterium marinum} Back     alignment and structure
>4g81_D Putative hexonate dehydrogenase; enzyme function initiative, EFI, structural genomics, dehydr oxidoreductase; 1.90A {Salmonella enterica subsp} Back     alignment and structure
>3qiv_A Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR protein] reductase; structural genomics; 2.25A {Mycobacterium avium subsp} Back     alignment and structure
>3rih_A Short chain dehydrogenase or reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: PG5; 2.15A {Mycobacterium abscessus} Back     alignment and structure
>4imr_A 3-oxoacyl-(acyl-carrier-protein) reductase; oxidoreductase, nicotinamide adenine dinucleotide phosphate, structural genomics; HET: NAP; 1.96A {Agrobacterium fabrum} Back     alignment and structure
>3v8b_A Putative dehydrogenase, possibly 3-oxoacyl-[acyl- protein] reductase; PSI-biology, structural genomics, protein structure initiati nysgrc; 2.70A {Sinorhizobium meliloti} Back     alignment and structure
>2ae2_A Protein (tropinone reductase-II); oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to pseudotropine; HET: NAP PTO; 1.90A {Datura stramonium} SCOP: c.2.1.2 PDB: 2ae1_A* 1ipe_A* 1ipf_A* Back     alignment and structure
>3svt_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 2.00A {Mycobacterium ulcerans} Back     alignment and structure
>3pk0_A Short-chain dehydrogenase/reductase SDR; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 1.75A {Mycobacterium smegmatis} SCOP: c.2.1.0 Back     alignment and structure
>4iin_A 3-ketoacyl-acyl carrier protein reductase (FABG); structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 2.40A {Helicobacter pylori} PDB: 4ijk_A Back     alignment and structure
>3gaf_A 7-alpha-hydroxysteroid dehydrogenase; seattle structural genomics center for infectious disease, ssgcid, oxidoreductase, structural genomics; 2.20A {Brucella melitensis} Back     alignment and structure
>4hp8_A 2-deoxy-D-gluconate 3-dehydrogenase; enzyme function initiative, EFI, structural genomics, oxidor; HET: NAP; 1.35A {Agrobacterium tumefaciens} Back     alignment and structure
>3awd_A GOX2181, putative polyol dehydrogenase; oxidoreductase; 1.80A {Gluconobacter oxydans} Back     alignment and structure
>3sc4_A Short chain dehydrogenase (A0QTM2 homolog); ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; 2.50A {Mycobacterium thermoresistibile} Back     alignment and structure
>3edm_A Short chain dehydrogenase; structural genomics, oxidoreductase, PSI-2, P structure initiative; 2.30A {Agrobacterium tumefaciens str} Back     alignment and structure
>2hq1_A Glucose/ribitol dehydrogenase; CTH-1438, structural genomics, southeast collaboratory for structural genomics, secsg, PSI; 1.90A {Clostridium thermocellum} Back     alignment and structure
>3tfo_A Putative 3-oxoacyl-(acyl-carrier-protein) reducta; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.08A {Sinorhizobium meliloti} Back     alignment and structure
>3m1a_A Putative dehydrogenase; short, PSI, MCSG, structural genomics, midwest center for structural genomics, protein structure initiative; 2.00A {Streptomyces avermitilis} Back     alignment and structure
>1ae1_A Tropinone reductase-I; oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to tropine, short-chain dehydrogenase; HET: NAP; 2.40A {Datura stramonium} SCOP: c.2.1.2 Back     alignment and structure
>3imf_A Short chain dehydrogenase; structural genomics, infectious D center for structural genomics of infectious diseases, oxidoreductase, csgid; HET: MSE; 1.99A {Bacillus anthracis str} Back     alignment and structure
>3tpc_A Short chain alcohol dehydrogenase-related dehydro; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.34A {Sinorhizobium meliloti} Back     alignment and structure
>3ged_A Short-chain dehydrogenase/reductase SDR; SCOR, rossmann fold, oxidoreductase; 1.70A {Clostridium thermocellum atcc 27405} PDB: 3geg_A* Back     alignment and structure
>3ai3_A NADPH-sorbose reductase; rossmann-fold, NADPH-dependent reductase, short chain dehydrogenase/reductase, oxidoreductase; HET: NAP SOL SOE; 1.80A {Gluconobacter frateurii} PDB: 3ai2_A* 3ai1_A* Back     alignment and structure
>4fs3_A Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; rossmann fold, short chain dehydrogenase, NADPH binding, oxidoreductase; HET: 0WD 0WE; 1.80A {Staphylococcus aureus subsp} PDB: 3gr6_A* 3gns_A* 4all_A* 3gnt_A 4alk_A* 4alj_A* 4ali_A* 4alm_A 4aln_A Back     alignment and structure
>3sju_A Keto reductase; short-chain dehydrogenase, oxidoreductase; HET: NDP; 2.40A {Streptomyces griseoruber} Back     alignment and structure
>3ksu_A 3-oxoacyl-acyl carrier protein reductase; structural genomics, PSI-2, dehydrogenase, protein structure initiative; 2.30A {Oenococcus oeni psu-1} Back     alignment and structure
>3rkr_A Short chain oxidoreductase; rossmann fold; HET: NAP; 2.42A {Uncultured bacterium BIO5} Back     alignment and structure
>3tjr_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, SCD, NAD; HET: UNL; 1.60A {Mycobacterium avium subsp} Back     alignment and structure
>4ibo_A Gluconate dehydrogenase; enzyme function initiative structural genomics, oxidoreductase; 2.10A {Agrobacterium fabrum} Back     alignment and structure
>3e03_A Short chain dehydrogenase; structural genomics, PSI-2, protein structure initiative, NEW YORK structural genomix research consortium; 1.69A {Xanthomonas campestris PV} Back     alignment and structure
>3uf0_A Short-chain dehydrogenase/reductase SDR; gluconate, gluconate 5-dehydratase, NAD(P) dependent, enzyme initiative, EFI, oxidoreductase; HET: NAP; 2.00A {Beutenbergia cavernae} SCOP: c.2.1.0 Back     alignment and structure
>2c29_D Dihydroflavonol 4-reductase; flavonoids, short dehydrogenase reductase, NADPH, dihydroquercetin, rossmann fold, oxidoreductase; HET: NAP DQH; 1.81A {Vitis vinifera} PDB: 2iod_A* 2nnl_D* 3bxx_A* 3c1t_A* Back     alignment and structure
>2o23_A HADH2 protein; HSD17B10, schad, ERAB, type II HADH, 2-methyl-3-hydroxybuTyr dehydrogenase, MHBD, structural genomics, structural genomi consortium; HET: NAD GOL; 1.20A {Homo sapiens} SCOP: c.2.1.2 PDB: 1so8_A 1u7t_A* 1e3s_A* 1e3w_B* 1e3w_A* 1e6w_A* Back     alignment and structure
>4egf_A L-xylulose reductase; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, oxidoreductase; 2.30A {Mycobacterium smegmatis} Back     alignment and structure
>3ijr_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, infectious D center for structural genomics of infectious diseases; HET: NAD; 2.05A {Bacillus anthracis str} PDB: 3i3o_A* Back     alignment and structure
>2rhc_B Actinorhodin polyketide ketoreductase; oxidoreductase, combinatorial biosynthesis, short chain dehydrogenase/reductase; HET: NAP EMO; 2.10A {Streptomyces coelicolor} SCOP: c.2.1.2 PDB: 2rh4_A* 1w4z_A* 3csd_B* 3qrw_A* 3ri3_B* 2rhr_B* 1x7g_A* 1x7h_A* 1xr3_A* Back     alignment and structure
>3nyw_A Putative oxidoreductase; fatty acid synthesis,3-oxoacyl-[ACP] reductase, NADP+ bindin rossman fold, PSI-II, nysgxrc; 2.16A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1yb1_A 17-beta-hydroxysteroid dehydrogenase type XI; short chain dehydrogenase, HUM structural genomics, structural genomics consortium, SGC; HET: AE2; 1.95A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>1fmc_A 7 alpha-hydroxysteroid dehydrogenase; short-chain dehydrogenase/reductase, bIle acid catabolism, oxidoreductase; HET: CHO NAD; 1.80A {Escherichia coli} SCOP: c.2.1.2 PDB: 1ahi_A* 1ahh_A* Back     alignment and structure
>3v2g_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, protein structure initiati nysgrc; 2.30A {Sinorhizobium meliloti} Back     alignment and structure
>4dmm_A 3-oxoacyl-[acyl-carrier-protein] reductase; rossmann fold, oxoacyl-ACP reductase, NADP binding, fatty AC biosynthsis, oxidoreductase; HET: NAP; 2.38A {Synechococcus elongatus} PDB: 4dml_A* Back     alignment and structure
>1xq1_A Putative tropinone reducatse; structural genomics, protein structure initiative, CESG, AT1 reductively methylated protein; 2.10A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2q45_A Back     alignment and structure
>3ucx_A Short chain dehydrogenase; ssgcid, seattle structural genomics center for infectious DI dehydrogenase, oxidoreductase; HET: 1PE; 1.85A {Mycobacterium smegmatis} SCOP: c.2.1.0 Back     alignment and structure
>3ioy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structure initiative; 1.90A {Novosphingobium aromaticivorans DSM12444} Back     alignment and structure
>4fgs_A Probable dehydrogenase protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, three layer; 1.76A {Rhizobium etli} Back     alignment and structure
>3i4f_A 3-oxoacyl-[acyl-carrier protein] reductase; structural genomics, 3-oxoacyl-reductase, PSI-2; 2.39A {Bacillus thuringiensis serovar kurstakorganism_taxid} SCOP: c.2.1.0 Back     alignment and structure
>3u5t_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.40A {Sinorhizobium meliloti} Back     alignment and structure
>2b4q_A Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier-protein] reductase; RHLG-NADP complex, oxidoreductase; HET: NAP; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>1xhl_A Short-chain dehydrogenase/reductase family member putative tropinone reductase-II...; parallel beta-sheet of seven strands in the order 3214567; HET: NDP TNE; 2.40A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>1sby_A Alcohol dehydrogenase; ternary complex, NAD, trifluoroethanol, oxidoreductase; HET: NAD; 1.10A {Scaptodrosophila lebanonensis} SCOP: c.2.1.2 PDB: 1b14_A* 1b15_A* 1a4u_A* 1b2l_A* 1b16_A* 3rj5_A* 3rj9_A* 1mg5_A* Back     alignment and structure
>3afn_B Carbonyl reductase; alpha/beta/alpha, rossmann-fold, oxidoreductase; HET: NAP; 1.63A {Sphingomonas SP} PDB: 3afm_A* Back     alignment and structure
>1zem_A Xylitol dehydrogenase; rossmann fold, dinucleotide-binding domain, oxidoreductase; HET: NAD; 1.90A {Gluconobacter oxydans} SCOP: c.2.1.2 Back     alignment and structure
>3rd5_A Mypaa.01249.C; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; HET: EPE; 1.50A {Mycobacterium paratuberculosis} Back     alignment and structure
>3tox_A Short chain dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; HET: NAP; 1.93A {Sinorhizobium meliloti} Back     alignment and structure
>1g0o_A Trihydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, dinucleotide binding fold, oxidoreductase; HET: NDP PYQ; 1.70A {Magnaporthe grisea} SCOP: c.2.1.2 PDB: 1doh_A* 1g0n_A* 1ybv_A* Back     alignment and structure
>3tzq_B Short-chain type dehydrogenase/reductase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; 2.50A {Mycobacterium marinum} SCOP: c.2.1.0 Back     alignment and structure
>2jah_A Clavulanic acid dehydrogenase; short-chain dehydrogenase/reductase, lactamase inhibitor, AN biosynthesis, NADPH, oxidoreductase; HET: MSE NDP; 1.80A {Streptomyces clavuligerus} PDB: 2jap_A* Back     alignment and structure
>3osu_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, csgid, center for structural genomics O infectious diseases; 1.90A {Staphylococcus aureus subsp} SCOP: c.2.1.0 PDB: 3sj7_A* Back     alignment and structure
>1ja9_A 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, oxidoreductase, chain dehydrogenase; HET: NDP PYQ; 1.50A {Magnaporthe grisea} SCOP: c.2.1.2 Back     alignment and structure
>2zat_A Dehydrogenase/reductase SDR family member 4; alpha/beta, oxidoreductase; HET: NAP; 1.50A {Sus scrofa} PDB: 3o4r_A* Back     alignment and structure
>3n74_A 3-ketoacyl-(acyl-carrier-protein) reductase; seattle structural genomics center for infectious disease, S brucellosis; 2.20A {Brucella melitensis biovar abortus} Back     alignment and structure
>3o26_A Salutaridine reductase; short chain dehydrogenase/reductases, oxidoreductase; HET: NDP; 1.91A {Papaver somniferum} SCOP: c.2.1.0 Back     alignment and structure
>1xkq_A Short-chain reductase family member (5D234); parrallel beta-sheet of seven strands in the order 3214567; HET: NDP; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>3zv4_A CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; oxidoreductase, short chain dehydrogenase/oxidoreductase, SD comamonas testosteroni; 1.80A {Pandoraea pnomenusa} SCOP: c.2.1.2 PDB: 2y99_A* 3zv3_A 2y93_A 3zv5_A* 3zv6_A* 1bdb_A* Back     alignment and structure
>2z1n_A Dehydrogenase; reductase, SDR, oxidoreductase; 1.80A {Aeropyrum pernix} Back     alignment and structure
>3ppi_A 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, dehydrogenas mycobacterium avium, structural genomics; 2.00A {Mycobacterium avium} Back     alignment and structure
>3ctm_A Carbonyl reductase; alcohol dehydrogenase, short-chain dehydrogenases/reductases (SDR), X-RAY crystallography, oxidoreductase; 2.69A {Candida parapsilosis} Back     alignment and structure
>3enk_A UDP-glucose 4-epimerase; seattle structural genomics center for infectious disease, ssgcid, isomerase, NAD; HET: NAD GUD; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0 Back     alignment and structure
>4dqx_A Probable oxidoreductase protein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.00A {Rhizobium etli} Back     alignment and structure
>1h5q_A NADP-dependent mannitol dehydrogenase; oxidoreductase, mannitol metabolism; HET: NAP; 1.50A {Agaricus bisporus} SCOP: c.2.1.2 Back     alignment and structure
>3v2h_A D-beta-hydroxybutyrate dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 3.00A {Sinorhizobium meliloti} Back     alignment and structure
>1iy8_A Levodione reductase; oxidoreductase; HET: NAD; 1.60A {Leifsonia aquatica} SCOP: c.2.1.2 Back     alignment and structure
>3lf2_A Short chain oxidoreductase Q9HYA2; SDR, SCOR, rossmann fold; HET: NAP; 2.30A {Pseudomonas aeruginosa} PDB: 3lf1_A* Back     alignment and structure
>3s55_A Putative short-chain dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 2.10A {Mycobacterium abscessus} SCOP: c.2.1.0 Back     alignment and structure
>3ruf_A WBGU; rossmann fold, UDP-hexose 4-epimerase, isomerase; HET: NAD UDP; 2.00A {Plesiomonas shigelloides} SCOP: c.2.1.2 PDB: 3ru9_A* 3rud_A* 3rue_A* 3rua_A* 3ruh_A* 3ruc_A* 3ru7_A* 3lu1_A* Back     alignment and structure
>4da9_A Short-chain dehydrogenase/reductase; structural genomics, protein structure initiative, PSI-biology; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>2qq5_A DHRS1, dehydrogenase/reductase SDR family member 1; short-chain, structura genomics consortium, SGC, oxidoreductase; 1.80A {Homo sapiens} Back     alignment and structure
>3is3_A 17BETA-hydroxysteroid dehydrogenase; short chain dehydrogenase/REDU SDR, fungi, oxidoreductase; HET: GOL; 1.48A {Cochliobolus lunatus} PDB: 3qwf_A* 3qwh_A* 3qwi_A* 3itd_A Back     alignment and structure
>1w6u_A 2,4-dienoyl-COA reductase, mitochondrial precursor; short chain dehydrogenase, beta- oxidation, NADP, oxidoreductase; HET: HXC NAP; 1.75A {Homo sapiens} SCOP: c.2.1.2 PDB: 1w73_A* 1w8d_A* Back     alignment and structure
>2c07_A 3-oxoacyl-(acyl-carrier protein) reductase; oxidoreductase, FABG, short-chain alcohol reductase, fatty acid biosynthesis, apicoplast; 1.5A {Plasmodium falciparum} SCOP: c.2.1.2 Back     alignment and structure
>3pxx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, NAD, tuberculosis; HET: NAD; 2.00A {Mycobacterium avium} SCOP: c.2.1.0 Back     alignment and structure
>3ftp_A 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid, 3-ketoacyl-(acyl-carrier- protein) reductase, oxidoreductase, structural genomics; 2.05A {Burkholderia pseudomallei} Back     alignment and structure
>3t4x_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, center for structural genomics of infec diseases, csgid; 2.80A {Bacillus anthracis} Back     alignment and structure
>2rh8_A Anthocyanidin reductase; flavonoids, rossmann fold, short chain dehydrogenase/reductase, oxidoreductase; 2.22A {Vitis vinifera} PDB: 3hfs_A Back     alignment and structure
>3pgx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.85A {Mycobacterium avium} SCOP: c.2.1.0 Back     alignment and structure
>2uvd_A 3-oxoacyl-(acyl-carrier-protein) reductase; beta-ketoacyl- (acyl carrier protein) reductase, short-chain dehydrogenase/reductase (SDR); 2.4A {Bacillus anthracis} Back     alignment and structure
>3oid_A Enoyl-[acyl-carrier-protein] reductase [NADPH]; fatty acid synthesis, enoyl-ACP reductases, FABL, rossmann-L NADPH binding, oxidoreductase; HET: TCL NDP; 1.80A {Bacillus subtilis} PDB: 3oic_A* Back     alignment and structure
>3l77_A Short-chain alcohol dehydrogenase; oxidoreductase; HET: NJP PG4; 1.60A {Thermococcus sibiricus} SCOP: c.2.1.0 PDB: 3tn7_A* Back     alignment and structure
>1geg_A Acetoin reductase; SDR family, oxidoreductase; HET: GLC NAD; 1.70A {Klebsiella pneumoniae} SCOP: c.2.1.2 Back     alignment and structure
>3u9l_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.10A {Sinorhizobium meliloti} Back     alignment and structure
>1spx_A Short-chain reductase family member (5L265); parallel beta-sheet of seven strands in the order 3214567; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>1wma_A Carbonyl reductase [NADPH] 1; oxidoreductase; HET: AB3 NDP PE5 P33; 1.24A {Homo sapiens} SCOP: c.2.1.2 PDB: 3bhi_A* 3bhj_A* 3bhm_A* 2pfg_A* 1n5d_A* 2hrb_A* Back     alignment and structure
>3sx2_A Putative 3-ketoacyl-(acyl-carrier-protein) reduct; ssgcid, 3-ketoacyl-(acyl-carrier-protein) reductase, mycobac paratuberculosis; HET: NAD; 1.50A {Mycobacterium avium subsp} Back     alignment and structure
>3gem_A Short chain dehydrogenase; structural genomics, APC65077, oxidoreductase, PSI-2, protein structure initiative; 1.83A {Pseudomonas syringae PV} Back     alignment and structure
>2pd6_A Estradiol 17-beta-dehydrogenase 8; short-chain dehydrogenase/reductase, steroid metabolism, LIP metabolism, structural genomics; HET: NAD; 2.00A {Homo sapiens} Back     alignment and structure
>2q2v_A Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidoreductase; HET: NAD; 1.90A {Pseudomonas putida} PDB: 2q2q_A* 2q2w_A Back     alignment and structure
>3e8x_A Putative NAD-dependent epimerase/dehydratase; structural genomics, APC7755, NADP, P protein structure initiative; HET: MSE NAP; 2.10A {Bacillus halodurans} Back     alignment and structure
>2wsb_A Galactitol dehydrogenase; oxidoreductase, SDR, rossmann fold, tagatose; HET: NAD; 1.25A {Rhodobacter sphaeroides} PDB: 2wdz_A* 3lqf_A* Back     alignment and structure
>3kvo_A Hydroxysteroid dehydrogenase-like protein 2; HSDL2, human hydroxysteroid dehydrogenase like 2, SDHL2, STR genomics, structural genomics consortium; HET: NAP; 2.25A {Homo sapiens} Back     alignment and structure
>3r3s_A Oxidoreductase; structural genomics, csgid, center for structural genomics O infectious diseases, 3-layer(ABA) sandwich, rossmann fold; HET: NAD; 1.25A {Salmonella enterica subsp} Back     alignment and structure
>2pnf_A 3-oxoacyl-[acyl-carrier-protein] reductase; short chain oxidoreductase, rossmann fold, oxidoreductase; HET: 1PE MES; 1.80A {Aquifex aeolicus} PDB: 2p68_A* Back     alignment and structure
>3a28_C L-2.3-butanediol dehydrogenase; chiral substrate recognition, oxidoreductase; HET: NAD; 2.00A {Brevibacterium saccharolyticum} Back     alignment and structure
>1vl8_A Gluconate 5-dehydrogenase; TM0441, structural genomics, JCSG structure initiative, PSI, joint center for structural GENO oxidoreductase; HET: NAP; 2.07A {Thermotoga maritima} SCOP: c.2.1.2 Back     alignment and structure
>2x9g_A PTR1, pteridine reductase; short chain dehydrogenase, oxidoreductase; HET: NAP LYA; 1.10A {Trypanosoma brucei brucei} PDB: 2x9n_A* 2x9v_A* 3bmc_A* 3bmd_A* 3bme_A* 3bmf_A* 3bmg_A* 3bmh_A* 3bmi_A* 3bmj_A* 3bmk_A* 3bml_A* 3bmm_A* 3bmn_A* 3bmo_A* 3bmq_A* 3bmr_A* 3gn1_A* 3gn2_A* 3jq6_A* ... Back     alignment and structure
>4egb_A DTDP-glucose 4,6-dehydratase; rhamnose pathway, center for structural genomics of infectio diseases, csgid, niaid; HET: NAD SUC; 3.00A {Bacillus anthracis} Back     alignment and structure
>1sny_A Sniffer CG10964-PA; alpha and beta protein, rossmann fold, dinucleotide binding oxidoreductase; HET: NAP; 1.75A {Drosophila melanogaster} SCOP: c.2.1.2 Back     alignment and structure
>4e6p_A Probable sorbitol dehydrogenase (L-iditol 2-dehyd; NAD(P)-binding, structural genomics, PSI-biology; HET: MSE; 2.10A {Sinorhizobium meliloti} PDB: 1k2w_A Back     alignment and structure
>3uve_A Carveol dehydrogenase ((+)-trans-carveol dehydrog; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; HET: NAD PG4; 1.55A {Mycobacterium avium} SCOP: c.2.1.0 PDB: 3uwr_A* Back     alignment and structure
>3ak4_A NADH-dependent quinuclidinone reductase; SDR, (R)-3-quinuclidinol, chiral alcohol, oxidoreductase; HET: NAD; 2.00A {Agrobacterium tumefaciens} Back     alignment and structure
>3op4_A 3-oxoacyl-[acyl-carrier protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase; HET: MSE NAP; 1.60A {Vibrio cholerae o1 biovar el tor} SCOP: c.2.1.2 PDB: 3rsh_A* 3rro_A* 4i08_A* 3tzk_A 3tzc_A* 3u09_A 3tzh_A 1q7b_A* 1i01_A* 1q7c_A* 2cf2_E Back     alignment and structure
>3un1_A Probable oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.45A {Sinorhizobium meliloti} Back     alignment and structure
>3l6e_A Oxidoreductase, short-chain dehydrogenase/reducta; structural genomics, PSI-2, protein structure initiative; 2.30A {Aeromonas hydrophila subsp} SCOP: c.2.1.0 Back     alignment and structure
>3f1l_A Uncharacterized oxidoreductase YCIK; E. coli, NADP+,; 0.95A {Escherichia coli K12} SCOP: c.2.1.0 PDB: 3f1k_A 3e9q_A* 3f5q_A 3gz4_A* 3f5s_A 3gy0_A* 3iah_A* 3g1t_A Back     alignment and structure
>2cfc_A 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidoreductase; HET: NAD KPC; 1.8A {Xanthobacter autotrophicus} Back     alignment and structure
>3grp_A 3-oxoacyl-(acyl carrierprotein) reductase; structural genomics, oxidoreductase, S structural genomics center for infectious disease, ssgcid; 2.09A {Bartonella henselae} PDB: 3enn_A 3emk_A Back     alignment and structure
>2ew8_A (S)-1-phenylethanol dehydrogenase; transferase; 2.10A {Azoarcus SP} SCOP: c.2.1.2 PDB: 2ewm_A* Back     alignment and structure
>2gdz_A NAD+-dependent 15-hydroxyprostaglandin dehydrogen; dehydrogenase, structural genomics, SH dehydrogenase/reductase, inflammation; HET: NAD; 1.65A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>3ezl_A Acetoacetyl-COA reductase; ssgcid, acetyacetyl-COA reductase, oxidoreductase, structural genomics; HET: P4C; 2.25A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0 Back     alignment and structure
>1yo6_A Putative carbonyl reductase sniffer; tyrosine-dependent oxidoreductase (SDR family), structural genomics, PSI; 2.60A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>4iiu_A 3-oxoacyl-[acyl-carrier protein] reductase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAP; 2.10A {Escherichia coli} PDB: 4iiv_A* Back     alignment and structure
>1e7w_A Pteridine reductase; dihydrofolate reductase, shortchain dehydrogenase, methotrexate resistance, oxidoreductase; HET: NDP MTX; 1.75A {Leishmania major} SCOP: c.2.1.2 PDB: 1w0c_A* 1e92_A* 2bf7_A* 2bfa_A* 2bfm_A* 2bfo_A* 2bfp_A* 2p8k_A* 3h4v_A* 2xox_A 1p33_A* Back     alignment and structure
>2z1m_A GDP-D-mannose dehydratase; short-chain dehydrogenase/reductase, lyase, structural genom NPPSFA; HET: NDP GDP; 2.00A {Aquifex aeolicus} PDB: 2z95_A* Back     alignment and structure
>2bgk_A Rhizome secoisolariciresinol dehydrogenase; oxidoreductase; 1.6A {Podophyllum peltatum} SCOP: c.2.1.2 PDB: 2bgl_A* 2bgm_A* Back     alignment and structure
>3t7c_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.95A {Mycobacterium avium} Back     alignment and structure
>4dry_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>1yxm_A Pecra, peroxisomal trans 2-enoyl COA reductase; perioxisomes, fatty acid synthesis, short-chain dehydrogenases/reductases, structural genomics; HET: ADE; 1.90A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>3tsc_A Putative oxidoreductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, nucleotide; HET: NAD; 2.05A {Mycobacterium avium subsp} SCOP: c.2.1.0 Back     alignment and structure
>2ehd_A Oxidoreductase, oxidoreductase, short-chain dehydrogenase/reducta; rossman fold, structural genomics, NPPSFA; 2.40A {Thermus thermophilus} Back     alignment and structure
>3gk3_A Acetoacetyl-COA reductase; acetoacetyl-CO reductase, oxidoreductase, structural genomics; 2.10A {Burkholderia pseudomallei 1710B} Back     alignment and structure
>1uls_A Putative 3-oxoacyl-acyl carrier protein reductase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.40A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>1zk4_A R-specific alcohol dehydrogenase; short chain reductases/dehydrogenases, magnesium dependence, oxidoreductase; HET: NAP; 1.00A {Lactobacillus brevis} SCOP: c.2.1.2 PDB: 1nxq_A* 1zjy_A* 1zjz_A* 1zk0_A* 1zk1_A* 1zk2_A 1zk3_A Back     alignment and structure
>3rwb_A TPLDH, pyridoxal 4-dehydrogenase; short chain dehydrogenase/reductase, 4-pyridoxola NAD+, oxidoreductase; HET: NAD 4PL; 1.70A {Mesorhizobium loti} PDB: 3ndr_A* 3nug_A* Back     alignment and structure
>1gee_A Glucose 1-dehydrogenase; short-chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 1.60A {Bacillus megaterium} SCOP: c.2.1.2 PDB: 1rwb_A* 1gco_A* 1g6k_A* 3aus_A 3aut_A* 3auu_A* Back     alignment and structure
>3gvc_A Oxidoreductase, probable short-chain type dehydrogenase/reductase; ssgcid, decode, niaid, UWPPG, SBRI, structural genomics; 2.45A {Mycobacterium tuberculosis} Back     alignment and structure
>2qhx_A Pteridine reductase 1; oxidoreductase, short-chain dehydrogenase/reductase, trypanosomatid, pterin salvage, drug resistance; HET: NAP FE1; 2.61A {Leishmania major} SCOP: c.2.1.2 Back     alignment and structure
>1x1t_A D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, SDR, short chain dehydrogenase, ketone BODY, beta hydroxybutyrate, oxidoreductase; HET: NAD; 1.52A {Pseudomonas fragi} SCOP: c.2.1.2 PDB: 1wmb_A* 2ztl_A* 2ztv_A* 2ztm_A* 2ztu_A* 2yz7_A 2zea_A* 3eew_A* 3vdq_A* 3vdr_A* Back     alignment and structure
>3o38_A Short chain dehydrogenase; tuberculosis, ortholog from A non-pathogenic dehydrogenase, structural genomics; 1.95A {Mycobacterium smegmatis} Back     alignment and structure
>3sxp_A ADP-L-glycero-D-mannoheptose-6-epimerase; rossman fold, NAD binding, isomerase; HET: NAD; 2.55A {Helicobacter pylori} Back     alignment and structure
>4eso_A Putative oxidoreductase; NADP, structural genomics, PSI-biology, NEW structural genomics research consortium, nysgrc; HET: MSE NAP; 1.91A {Sinorhizobium meliloti} PDB: 3vc7_A Back     alignment and structure
>4fc7_A Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossmann fold, peroxisomal beta-oxidation, oxidoreductas; HET: NAP COA; 1.84A {Homo sapiens} PDB: 4fc6_A* Back     alignment and structure
>3qlj_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis; 1.80A {Mycobacterium avium} Back     alignment and structure
>2d1y_A Hypothetical protein TT0321; strucrtural genomics, thermus thermophilus HB8, structural genomics, NPPSFA; HET: NAD; 1.65A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>1mxh_A Pteridine reductase 2; SDR topology, protein-substrate complex, oxidoreductase; HET: NAP DHF; 2.20A {Trypanosoma cruzi} SCOP: c.2.1.2 PDB: 1mxf_A* Back     alignment and structure
>1xu9_A Corticosteroid 11-beta-dehydrogenase, isozyme 1; hydroxysteroid, SDR, oxidoreductase; HET: NDP CPS MES; 1.55A {Homo sapiens} SCOP: c.2.1.2 PDB: 1xu7_A* 3bzu_A* 3czr_A* 3d3e_A* 3d4n_A* 3fco_A* 3frj_A* 3h6k_A* 3hfg_A* 3oq1_A* 3qqp_A* 3pdj_A* 3d5q_A* 2rbe_A* 3byz_A* 3ey4_A* 3tfq_A* 3ch6_A* 2irw_A* 2ilt_A* ... Back     alignment and structure
>2a4k_A 3-oxoacyl-[acyl carrier protein] reductase; reductase,hyperthermophIle, structural genomics, PSI, protei structure initiative; 2.30A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>3icc_A Putative 3-oxoacyl-(acyl carrier protein) reducta; structural genomics, putative 3-oxoacyl-(acyl carrier protei reductase, oxidoreductase; HET: NAP MES; 1.87A {Bacillus anthracis str} Back     alignment and structure
>3k31_A Enoyl-(acyl-carrier-protein) reductase; ssgcid, NIH, niaid, SBRI, UW, decode, eonyl-(acyl-carrier-PR reductase, NAD, oxidoreductase; HET: NAD; 1.80A {Anaplasma phagocytophilum} PDB: 3k2e_A* Back     alignment and structure
>3i1j_A Oxidoreductase, short chain dehydrogenase/reducta; dimer, MIXE beta, structural genomics, PSI-2; 1.90A {Pseudomonas syringae PV} SCOP: c.2.1.0 Back     alignment and structure
>3dqp_A Oxidoreductase YLBE; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 1.40A {Lactococcus lactis subsp} Back     alignment and structure
>2bd0_A Sepiapterin reductase; oxidoreductase; HET: NAP BIO; 1.70A {Chlorobium tepidum} SCOP: c.2.1.2 Back     alignment and structure
>3oig_A Enoyl-[acyl-carrier-protein] reductase [NADH]; fatty acid synthesis, rossmann-like fold, enoyl-ACP reductas binding; HET: NAD IMJ; 1.25A {Bacillus subtilis} SCOP: c.2.1.2 PDB: 3oif_A* 2qio_A* 3oje_A 3ojf_A* Back     alignment and structure
>1hdc_A 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxidoreductase; HET: CBO; 2.20A {Streptomyces exfoliatus} SCOP: c.2.1.2 PDB: 2hsd_A* Back     alignment and structure
>1rpn_A GDP-mannose 4,6-dehydratase; short-chain dehydrogenase/reductase, rossmann fold, lyase; HET: NDP GDP; 2.15A {Pseudomonas aeruginosa} SCOP: c.2.1.2 Back     alignment and structure
>4h15_A Short chain alcohol dehydrogenase-related dehydro; structural genomics, PSI-biology, nysgrc; HET: MSE; 1.45A {Sinorhizobium meliloti} PDB: 4h16_A* Back     alignment and structure
>3d3w_A L-xylulose reductase; uronate cycle, short-chain dehydrogenase/reductase(SDR) superfamily, glucose metabolism, acetylation, carbohydrate metabolism; HET: NAP; 1.87A {Homo sapiens} PDB: 1wnt_A* 1pr9_A* Back     alignment and structure
>1cyd_A Carbonyl reductase; short-chain dehydrogenase, oxidoreductase; HET: NAP; 1.80A {Mus musculus} SCOP: c.2.1.2 Back     alignment and structure
>3qvo_A NMRA family protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MNB; 2.30A {Shigella flexneri 2A} Back     alignment and structure
>3ew7_A LMO0794 protein; Q8Y8U8_lismo, putative NAD-dependent epimerase/dehydratase, LMR162, NESG, structural genomics, PSI-2; 2.73A {Listeria monocytogenes} Back     alignment and structure
>3tl3_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 1.85A {Mycobacterium ulcerans} Back     alignment and structure
>1rkx_A CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 1.80A {Yersinia pseudotuberculosis} SCOP: c.2.1.2 PDB: 1wvg_A* Back     alignment and structure
>1oaa_A Sepiapterin reductase; tetrahydrobiopterin, oxidoreductase; HET: NAP; 1.25A {Mus musculus} SCOP: c.2.1.2 PDB: 1nas_A* 1sep_A* 1z6z_A* Back     alignment and structure
>3oec_A Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; ssgcid, structural genomics; 1.95A {Mycobacterium thermoresistibile} Back     alignment and structure
>1hxh_A 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-beta, rossmann fold, short-chain dehydrogenase, oxidoreductase; 1.22A {Comamonas testosteroni} SCOP: c.2.1.2 Back     alignment and structure
>4b79_A PA4098, probable short-chain dehydrogenase; oxidoreductase, infectious disease, structure-based inhibito; HET: NAD; 1.98A {Pseudomonas aeruginosa PAO1} Back     alignment and structure
>3r6d_A NAD-dependent epimerase/dehydratase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, veillo parvula; HET: MLZ; 1.25A {Veillonella parvula dsm 2008} PDB: 4hng_A 4hnh_A* 3r14_A* Back     alignment and structure
>2ag5_A DHRS6, dehydrogenase/reductase (SDR family) member 6; protein-CO-factor complex, structural genomics, structural G consortium, SGC, oxidoreductase; HET: NAD; 1.84A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>2pzm_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, protein-nucleotide comple binding protein; HET: NAD UDP; 2.00A {Bordetella bronchiseptica} PDB: 2pzl_A* 2pzk_A* Back     alignment and structure
>2pd4_A Enoyl-[acyl-carrier-protein] reductase [NADH]; antibacterial target, type II fatty acid biosynthesis, enoyl-ACP-reductase, FABI; HET: NAD DCN; 2.30A {Helicobacter pylori} SCOP: c.2.1.2 PDB: 2pd3_A* Back     alignment and structure
>3slg_A PBGP3 protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid, melioidosis, glanders; 2.10A {Burkholderia pseudomallei} Back     alignment and structure
>4e3z_A Putative oxidoreductase protein; PSI-biology, structural genomics, protein structure initiati nysgrc,oxidoreductase; 2.00A {Rhizobium etli} Back     alignment and structure
>1nff_A Putative oxidoreductase RV2002; directed evolution, GFP, SDR, hydroxysteroid dehydrogenase, structural genomics, PSI; HET: NAD; 1.80A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1nfq_A* 1nfr_A* Back     alignment and structure
>4dyv_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.80A {Xanthobacter autotrophicus} Back     alignment and structure
>1xg5_A ARPG836; short chain dehydrogenase, human, SGC, structural genomics, structural genomics consortium, oxidoreductase; HET: NAP; 1.53A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>2p4h_X Vestitone reductase; NADPH-dependent reductase, isoflavonoid, plant protein; 1.40A {Medicago sativa} Back     alignment and structure
>3rft_A Uronate dehydrogenase; apoenzyme, rossmann fold, NAD binding, oxidoreductase; 1.90A {Agrobacterium tumefaciens} PDB: 3rfv_A* 3rfx_A* Back     alignment and structure
>1orr_A CDP-tyvelose-2-epimerase; rossmann fold, short-chain dehydrogenase/reductase, isomeras; HET: NAD CDP; 1.50A {Salmonella typhi} SCOP: c.2.1.2 Back     alignment and structure
>3dhn_A NAD-dependent epimerase/dehydratase; reductase, PF01370, Q89Z24_bactn, NESG, BTR310, structural genomics, PSI-2; 2.00A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3guy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structur initiative; 1.90A {Vibrio parahaemolyticus} Back     alignment and structure
>1qsg_A Enoyl-[acyl-carrier-protein] reductase; enoyl reductase, oxidoreductase; HET: GLC NAD TCL; 1.75A {Escherichia coli} SCOP: c.2.1.2 PDB: 1c14_A* 1i2z_A* 1i30_A* 1lx6_A* 1lxc_A* 1mfp_A* 2fhs_A 1qg6_A* 1dfg_A* 1dfh_A* 1d8a_A* 1dfi_A* 3pje_A* 3pjd_A* 3pjf_A* Back     alignment and structure
>2q1w_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, sugar binding protein; HET: NAD; 2.19A {Bordetella bronchiseptica} Back     alignment and structure
>3ek2_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, oxidoreductase, structural genomics; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.2 Back     alignment and structure
>2nwq_A Probable short-chain dehydrogenase; oxidoreductase; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>2hun_A 336AA long hypothetical DTDP-glucose 4,6-dehydrat; rossmann fold, structural genomics, NPPSFA; HET: NAD; 2.07A {Pyrococcus horikoshii} Back     alignment and structure
>2fwm_X 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; enterobactin, rossman fold, chorismate metabolism, short-CHA oxidoreductase, tetramer; 2.00A {Escherichia coli} Back     alignment and structure
>1t2a_A GDP-mannose 4,6 dehydratase; structural genomics consortium, rossman-fold, short-chain dehydrogenase/reductase, SDR, structural genomics,lyase; HET: NDP GDP; 1.84A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>2dtx_A Glucose 1-dehydrogenase related protein; rossmann fold, oxidoreductase; HET: BMA; 1.60A {Thermoplasma acidophilum} PDB: 2dtd_A* 2dte_A* 2zk7_A Back     alignment and structure
>1ek6_A UDP-galactose 4-epimerase; short-chain dehydrogenase, galactosemia, isomerase; HET: NAI UPG; 1.50A {Homo sapiens} SCOP: c.2.1.2 PDB: 1ek5_A* 1hzj_A* 1i3k_A* 1i3l_A* 1i3m_A* 1i3n_A* Back     alignment and structure
>3h2s_A Putative NADH-flavin reductase; Q03B84, NESG, LCR19, structural genomics, PSI-2, protein structure initiative; HET: NDP; 1.78A {Lactobacillus casei atcc 334} Back     alignment and structure
>3f9i_A 3-oxoacyl-[acyl-carrier-protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase, FAT biosynthesis, lipid synthesis, NADP; 2.25A {Rickettsia prowazekii} SCOP: c.2.1.0 Back     alignment and structure
>3p19_A BFPVVD8, putative blue fluorescent protein; rossmann-fold, oxidoreductase; HET: NAP; 2.05A {Vibrio vulnificus} Back     alignment and structure
>1yde_A Retinal dehydrogenase/reductase 3; oxidoreductase, structural genomics, structural genomics CON SGC; 2.40A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>3nrc_A Enoyl-[acyl-carrier-protein] reductase (NADH); rossmann fold, NADH BI oxidoreductase; HET: NAD TCL; 2.10A {Francisella tularensis subsp} PDB: 3uic_A* 2jjy_A* Back     alignment and structure
>2nm0_A Probable 3-oxacyl-(acyl-carrier-protein) reductas; oxidoreductase; 1.99A {Streptomyces coelicolor} Back     alignment and structure
>1oc2_A DTDP-glucose 4,6-dehydratase; lyase, NADH, rhamnose; HET: TDX NAD; 1.5A {Streptococcus suis} SCOP: c.2.1.2 PDB: 1ker_A* 1ket_A* 1kep_A* Back     alignment and structure
>4b4o_A Epimerase family protein SDR39U1; isomerase; HET: NDP PE4; 2.70A {Homo sapiens} Back     alignment and structure
>2b69_A UDP-glucuronate decarboxylase 1; UDP-glucoronic acid decarboxylase, structural genomics, STRU genomics consortium, SGC, lyase; HET: MSE NAD UDP; 1.21A {Homo sapiens} SCOP: c.2.1.2 PDB: 4ef7_A* Back     alignment and structure
>3gdg_A Probable NADP-dependent mannitol dehydrogenase; rossmann fold, beta-alpha-beta motifs, open twisted sheet, A NADP, oxidoreductase; 2.30A {Cladosporium herbarum} SCOP: c.2.1.0 PDB: 3gdf_A Back     alignment and structure
>1xgk_A Nitrogen metabolite repression regulator NMRA; rossmann fold, transcriptional regulation, short chain dehyd reductase, NADP binding; 1.40A {Emericella nidulans} SCOP: c.2.1.2 PDB: 1k6x_A* 1k6j_A 1k6i_A* 1ti7_A* 2vus_A 2vut_A* 2vuu_A* Back     alignment and structure
>2c5a_A GDP-mannose-3', 5'-epimerase; short chain dehydratase/reductase, GDP-gulose, GDP-galactose, keto intermediate, vitamin C, SDR; HET: GDC NAD BTB; 1.4A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2c59_A* 2c54_A* 2c5e_A* Back     alignment and structure
>2p91_A Enoyl-[acyl-carrier-protein] reductase [NADH]; NADH-dependent enoyl-ACP reductase, FABI, aquifex A VF5, structural genomics, PSI; 2.00A {Aquifex aeolicus} Back     alignment and structure
>1sb8_A WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCNAC, SDR, G SYK, UDP, N-acetylglucosamine, N- acetylgalactosamine, UDP-GLC, isomerase; HET: NAD UD2; 2.10A {Pseudomonas aeruginosa} SCOP: c.2.1.2 PDB: 1sb9_A* Back     alignment and structure
>2wyu_A Enoyl-[acyl carrier protein] reductase; oxidoreductase, fatty acid biosynthesis, oxidation reduction; 1.50A {Thermus thermophilus} PDB: 1ulu_A 2wyv_A* 2wyw_A* 2yw9_A* Back     alignment and structure
>3e9n_A Putative short-chain dehydrogenase/reductase; structural genomics, unknown function, oxidoreductase, PSI- 2; 2.40A {Corynebacterium glutamicum} Back     alignment and structure
>3grk_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, niaid, structural genomics, seattle structural genomics center for infectious disease; 2.35A {Brucella melitensis} PDB: 4eit_A* Back     alignment and structure
>1edo_A Beta-keto acyl carrier protein reductase; nucleotide fold, rossmann fold, oxidoreductase; HET: NAP; 2.30A {Brassica napus} SCOP: c.2.1.2 PDB: 2cdh_G Back     alignment and structure
>1hdo_A Biliverdin IX beta reductase; foetal metabolism, HAEM degradation, flavin reductase, diaphorase, green HAEM binding protein; HET: NAP; 1.15A {Homo sapiens} SCOP: c.2.1.2 PDB: 1he2_A* 1he3_A* 1he4_A* 1he5_A* Back     alignment and structure
>3m2p_A UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J, isomerase, structural genomics, PSI-2, protein structure initiative; HET: UDP; 2.95A {Bacillus cereus} Back     alignment and structure
>2hrz_A AGR_C_4963P, nucleoside-diphosphate-sugar epimerase; agrobacterium tumefa structural genomics, PSI-2, protein structure initiative; 1.85A {Agrobacterium tumefaciens} Back     alignment and structure
>4id9_A Short-chain dehydrogenase/reductase; putative dehydrogenase, enzyme function initiative, EFI, STR genomics, oxidoreductase; HET: NAD; 1.60A {Agrobacterium fabrum} PDB: 4idg_A* Back     alignment and structure
>4dqv_A Probable peptide synthetase NRP (peptide synthase; GXXGXXG motif, rossmann fold, short chain dehydrogenase/REDU family, reductase; 2.30A {Mycobacterium tuberculosis} Back     alignment and structure
>2bka_A CC3, TAT-interacting protein TIP30; NADPH, PEG600, transcription; HET: NDP PE8; 1.7A {Homo sapiens} SCOP: c.2.1.2 PDB: 2fmu_A Back     alignment and structure
>2ph3_A 3-oxoacyl-[acyl carrier protein] reductase; TTHA0415, structural genomics, southea collaboratory for structural genomics, secsg; 1.91A {Thermus thermophilus HB8} Back     alignment and structure
>1n7h_A GDP-D-mannose-4,6-dehydratase; rossmann fold, SDR, short-chain dehydrogenase/reductase, LYA; HET: NDP GDP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1n7g_A* Back     alignment and structure
>1db3_A GDP-mannose 4,6-dehydratase; NADP, GDP-fucose, lyase; 2.30A {Escherichia coli} SCOP: c.2.1.2 Back     alignment and structure
>2a35_A Hypothetical protein PA4017; alpha-beta-alpha sandwich, structura genomics, PSI, protein structure initiative; 1.50A {Pseudomonas aeruginosa} SCOP: c.2.1.2 Back     alignment and structure
>2q1s_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NADH complex, sugar binding protein; HET: NAI; 1.50A {Bordetella bronchiseptica} PDB: 2pzj_A* 2q1t_A* 2q1u_A* Back     alignment and structure
>2x4g_A Nucleoside-diphosphate-sugar epimerase; isomerase; 2.65A {Pseudomonas aeruginosa} Back     alignment and structure
>1kew_A RMLB;, DTDP-D-glucose 4,6-dehydratase; rossmann fold, lyase; HET: TYD NAD; 1.80A {Salmonella enterica subsp} SCOP: c.2.1.2 PDB: 1g1a_A* 1keu_A* 1bxk_A* Back     alignment and structure
>3rku_A Oxidoreductase YMR226C; substrate fingerprint, short chain oxidoreductase, rossmann oxidoreductase; HET: NAP; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1r6d_A TDP-glucose-4,6-dehydratase; rossmann fold, short-chain dehydrogenase/reductase, lyase; HET: NAD DAU; 1.35A {Streptomyces venezuelae} SCOP: c.2.1.2 PDB: 1r66_A* Back     alignment and structure
>3vtz_A Glucose 1-dehydrogenase; rossmann fold, oxidoreductase, NAD binding; 2.30A {Thermoplasma volcanium} Back     alignment and structure
>3i6i_A Putative leucoanthocyanidin reductase 1; rossmann fold, short chain dehydrogenase reductase, flavonoi oxidoreductase; HET: NDP; 1.75A {Vitis vinifera} PDB: 3i5m_A 3i52_A* 3i6q_A* Back     alignment and structure
>3ko8_A NAD-dependent epimerase/dehydratase; isomerase, UDP-galactose 4-epimerase; HET: NAD; 1.80A {Pyrobaculum calidifontis} SCOP: c.2.1.0 PDB: 3icp_A* 3aw9_A* Back     alignment and structure
>3asu_A Short-chain dehydrogenase/reductase SDR; SDR family, rossmann-fold, short-chain dehydrogenase/reducta ALLO-threonine dehydrogenase; 1.90A {Escherichia coli} PDB: 3asv_A* Back     alignment and structure
>2r6j_A Eugenol synthase 1; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, plant protein; HET: NDP; 1.50A {Ocimum basilicum} PDB: 2qys_A 2qx7_A* 2qzz_A* 2r2g_A* 3c3x_A* 2qw8_A* Back     alignment and structure
>1y1p_A ARII, aldehyde reductase II; rossmann fold, short chain dehydrogenase reductase, oxidoreductase; HET: NMN AMP; 1.60A {Sporidiobolus salmonicolor} SCOP: c.2.1.2 PDB: 1ujm_A* 1zze_A Back     alignment and structure
>2gn4_A FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann fold, TYK triad, SDR, enzyme, NADP, NADPH, lyase; HET: NDP UD1 MES; 1.90A {Helicobacter pylori} PDB: 2gn6_A* 2gn8_A* 2gn9_A* 2gna_A* Back     alignment and structure
>1xq6_A Unknown protein; structural genomics, protein structure initiative, CESG, AT5G02240, NADP, center for eukaryotic structural genomics; HET: NAP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1ybm_A* 2q46_A* 2q4b_A* Back     alignment and structure
>4f6c_A AUSA reductase domain protein; thioester reductase, oxidoreductase; 2.81A {Staphylococcus aureus} Back     alignment and structure
>1z45_A GAL10 bifunctional protein; epimerase, mutarotase, metabolism, isomerase; HET: GAL NAD GUD; 1.85A {Saccharomyces cerevisiae} SCOP: b.30.5.4 c.2.1.2 Back     alignment and structure
>2h7i_A Enoyl-[acyl-carrier-protein] reductase [NADH]; oxidoreductase, INHA, enoyl acyl carrier reductase, pyrrolid carboxamide; HET: NAD 566; 1.62A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1p44_A* 1p45_A* 2b35_A* 2b36_A* 2b37_A* 2aq8_A* 2h7l_A* 2h7m_A* 2h7n_A* 2h7p_A* 2nsd_A* 2pr2_A* 2x22_A* 2x23_A* 3fne_A* 3fnf_A* 3fng_A* 3fnh_A* 3oew_A* 2aqh_A* ... Back     alignment and structure
>1udb_A Epimerase, UDP-galactose-4-epimerase; isomerase; HET: NAD UFG; 1.65A {Escherichia coli} SCOP: c.2.1.2 PDB: 1lrj_A* 1nai_A* 1uda_A* 1nah_A* 1xel_A* 1kvq_A* 1kvs_A* 1udc_A* 2udp_A* 1a9z_A* 1kvt_A* 1kvr_A* 1lrk_A* 1lrl_A* 1kvu_A* 1a9y_A* Back     alignment and structure
>2wm3_A NMRA-like family domain containing protein 1; unknown function; HET: NAP NFL; 1.85A {Homo sapiens} PDB: 2wmd_A* 2exx_A* 3dxf_A 3e5m_A Back     alignment and structure
>3mje_A AMPHB; rossmann fold, oxidoreductase; HET: NDP; 1.36A {Streptomyces nodosus} PDB: 3mjc_A* 3mjs_A* 3mjv_A* 3mjt_A* Back     alignment and structure
>3ius_A Uncharacterized conserved protein; APC63810, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.66A {Ruegeria pomeroyi dss-3} Back     alignment and structure
>2bll_A Protein YFBG; decarboxylase, short chain dehydrogenase, L-ARA4N biosynthes methyltransferase, transferase; 2.3A {Escherichia coli} SCOP: c.2.1.2 PDB: 1u9j_A 1z73_A 1z75_A 1z7b_A 1z74_A Back     alignment and structure
>2pk3_A GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, short-chain dehydrogenase/reductase, rossmann fold, oxidoreductase; HET: A2R GDD; 1.82A {Aneurinibacillus thermoaerophilus} Back     alignment and structure
>1jtv_A 17 beta-hydroxysteroid dehydrogenase type 1; steroid hormones, alternative binding mode, oxidoreductase; HET: TES; 1.54A {Homo sapiens} SCOP: c.2.1.2 PDB: 1dht_A* 1equ_A* 1bhs_A* 1i5r_A* 1qyv_A* 1qyw_A* 1qyx_A* 3dey_X* 3dhe_A* 3hb4_X* 3hb5_X* 3klp_X* 3km0_A* 1iol_A* 1fds_A* 1fdt_A* 3klm_X* 1fdw_A* 1fdu_A* 1fdv_A* ... Back     alignment and structure
>1gy8_A UDP-galactose 4-epimerase; oxidoreductase; HET: NAD UDP; 2.0A {Trypanosoma brucei} SCOP: c.2.1.2 PDB: 2cnb_A* Back     alignment and structure
>2c20_A UDP-glucose 4-epimerase; carbohydrate metabolism, galactose metabolism, isomerase, NAD, spine; HET: NAD; 2.7A {Bacillus anthracis} Back     alignment and structure
>1o5i_A 3-oxoacyl-(acyl carrier protein) reductase; TM1169, structur genomics, JCSG, PSI, protein structure initiative, joint CE structural genomics; HET: NAD; 2.50A {Thermotoga maritima} SCOP: c.2.1.2 Back     alignment and structure
>1uay_A Type II 3-hydroxyacyl-COA dehydrogenase; beta oxidation, fatty acid, structural genomi structural genomics/proteomics initiative, RSGI; HET: ADN; 1.40A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>2ekp_A 2-deoxy-D-gluconate 3-dehydrogenase; structural genomics, NPPSFA, nation project on protein structural and functional analyses; HET: NAD; 1.15A {Thermus thermophilus} PDB: 1x1e_A* 2ekq_A Back     alignment and structure
>1ooe_A Dihydropteridine reductase; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics; HET: MES; 1.65A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>3orf_A Dihydropteridine reductase; alpha-beta-alpha sandwich, rossmann fold, oxidoreductase (AC NADH), NADH binding, oxidoreductase; HET: NAD; 2.16A {Dictyostelium discoideum} Back     alignment and structure
>2z5l_A Tylkr1, tylactone synthase starter module and modules 1 & 2; short-chain dehydrogenase/reductase, rossman fold; 1.95A {Streptomyces fradiae} Back     alignment and structure
>1uzm_A 3-oxoacyl-[acyl-carrier protein] reductase; beta-ketoacyl reductase, oxidoreductase; 1.49A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1uzn_A* 2ntn_A 1uzl_A Back     alignment and structure
>1qyc_A Phenylcoumaran benzylic ether reductase PT1; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.20A {Pinus taeda} SCOP: c.2.1.2 Back     alignment and structure
>1dhr_A Dihydropteridine reductase; oxidoreductase(acting on NADH or NADPH); HET: NAD; 2.30A {Rattus norvegicus} SCOP: c.2.1.2 PDB: 1dir_A* 1hdr_A* Back     alignment and structure
>2v6g_A Progesterone 5-beta-reductase; tyrosine-dependent oxidoreductase, oxidoreductase, SDR, cardenolides, cardiac glycosides; HET: NAP; 2.3A {Digitalis lanata} PDB: 2v6f_A* Back     alignment and structure
>3uxy_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: NAD; 2.10A {Rhodobacter sphaeroides} Back     alignment and structure
>3e48_A Putative nucleoside-diphosphate-sugar epimerase; alpha-beta protein., structural genomics, PSI-2, protein STR initiative; 1.60A {Staphylococcus aureus subsp} Back     alignment and structure
>3kzv_A Uncharacterized oxidoreductase YIR035C; cytoplasmic protein, unknown function, structural genomics, MCSG, protein structure initiative; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3gpi_A NAD-dependent epimerase/dehydratase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.44A {Methylobacillus flagellatus KT} Back     alignment and structure
>4e4y_A Short chain dehydrogenase family protein; structural genomics, the center for structural genomics of I diseases, csgid, niaid; 1.80A {Francisella tularensis subsp} Back     alignment and structure
>2gas_A Isoflavone reductase; NADPH-dependent reductase, oxidoreductase; 1.60A {Medicago sativa} Back     alignment and structure
>1qyd_A Pinoresinol-lariciresinol reductase; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.50A {Thuja plicata} SCOP: c.2.1.2 Back     alignment and structure
>3c1o_A Eugenol synthase; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, oxidoreductase; HET: NAP; 1.80A {Clarkia breweri} Back     alignment and structure
>3uce_A Dehydrogenase; rossmann fold, oxidoreductase; HET: NDP; 1.80A {Vibrio vulnificus} Back     alignment and structure
>2fr1_A Erythromycin synthase, eryai; short chain dehydrogenase/reductase, oxidoreductase; HET: NDP; 1.79A {Saccharopolyspora erythraea} SCOP: c.2.1.2 c.2.1.2 PDB: 2fr0_A* Back     alignment and structure
>1i24_A Sulfolipid biosynthesis protein SQD1; SDR, short-chain dehydrogenase/reductase, rossmann fold, BIO protein; HET: NAD UPG; 1.20A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1i2c_A* 1i2b_A* 1qrr_A* Back     alignment and structure
>2yy7_A L-threonine dehydrogenase; thermolabIle, flavobacterium FRIG KUC-1, oxidoreductase; HET: PE8 NAD MES; 2.06A {Flavobacterium frigidimaris} Back     alignment and structure
>3s8m_A Enoyl-ACP reductase; rossmann fold, oxidoreductase, NADH binding, fatty acid SYNT enoyl-ACP; 1.60A {Xanthomonas oryzae PV} Back     alignment and structure
>2p5y_A UDP-glucose 4-epimerase; TTHA0591, structural genomics, PSI; HET: NAD; 1.92A {Thermus thermophilus HB8} PDB: 2p5u_A* Back     alignment and structure
>3vps_A TUNA, NAD-dependent epimerase/dehydratase; tunicamycins, biosynthesis, EXO-glycal, rossman transferase; HET: UD1 NAD; 1.90A {Streptomyces chartreusis} Back     alignment and structure
>1z7e_A Protein aRNA; rossmann fold, OB-like fold, hydrolase; HET: ATP UGA; 3.00A {Escherichia coli} SCOP: b.46.1.1 c.2.1.2 c.65.1.1 Back     alignment and structure
>2dkn_A 3-alpha-hydroxysteroid dehydrogenase; oxidoreductase, rossmann fold; HET: NAI; 1.80A {Pseudomonas SP} Back     alignment and structure
>2jl1_A Triphenylmethane reductase; oxidoreductase, bioremediation; HET: NAP GOL; 1.96A {Citrobacter SP} PDB: 2vrb_A* 2vrc_A 2vrc_D Back     alignment and structure
>3ay3_A NAD-dependent epimerase/dehydratase; glucuronic acid dehydrogeanse, oxidoreductase; 2.10A {Chromohalobacter salexigens} Back     alignment and structure
>1fjh_A 3alpha-hydroxysteroid dehydrogenase/carbonyl reductase; short chain dehydrogenase, SDR, xenobiotic, metyrapone, oligomerisation; 1.68A {Comamonas testosteroni} SCOP: c.2.1.2 PDB: 1fk8_A* Back     alignment and structure
>2ydy_A Methionine adenosyltransferase 2 subunit beta; oxidoreductase; 2.25A {Homo sapiens} PDB: 2ydx_A Back     alignment and structure
>4f6l_B AUSA reductase domain protein; thioester reductase, oxidoreductase; 3.86A {Staphylococcus aureus} Back     alignment and structure
>2et6_A (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-oxidation, peroxisome, SDR, oxido; 2.22A {Candida tropicalis} Back     alignment and structure
>3zu3_A Putative reductase YPO4104/Y4119/YP_4011; oxidoreductase, fatty acid biosynthesis II, short-chain dehydrogenase reductase superfamily; HET: NAI; 1.80A {Yersinia pestis} PDB: 3zu4_A* 3zu5_A* 3zu2_A* Back     alignment and structure
>3qp9_A Type I polyketide synthase pikaii; rossmann fold, ketoreductase, epimerization, oxidoreductase; 1.88A {Streptomyces venezuelae} Back     alignment and structure
>4eue_A Putative reductase CA_C0462; TER, biofuel, synthetic biology, catalytic mechan substrate specificity, oxidoreductase; HET: NAI; 2.00A {Clostridium acetobutylicum} PDB: 4euf_A* 4euh_A* Back     alignment and structure
>2zcu_A Uncharacterized oxidoreductase YTFG; alpha-beta sandwich; 1.80A {Escherichia coli} PDB: 2zcv_A* Back     alignment and structure
>3oh8_A Nucleoside-diphosphate sugar epimerase (SULA FAMI; DUF1731_C, northeast structural genomics consortium, NESG, C PSI-biology; 2.00A {Corynebacterium glutamicum} Back     alignment and structure
>3d7l_A LIN1944 protein; APC89317, structural genomics, PS protein structure initiative, midwest center for structural genomics, MCSG; 2.06A {Listeria innocua} Back     alignment and structure
>3slk_A Polyketide synthase extender module 2; rossmann fold, NADPH, oxidoreductase; HET: NDP; 3.00A {Saccharopolyspora spinosa} Back     alignment and structure
>3u0b_A Oxidoreductase, short chain dehydrogenase/reducta protein; structural genomics, ssgcid; 1.70A {Mycobacterium smegmatis} PDB: 3lls_A 3v1t_C 3v1u_A* 4fw8_A* 3q6i_A* 3m1l_A Back     alignment and structure
>2pff_A Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl-carrier-PR; fatty acid synthase, acyl-carrier-protein, beta-ketoacyl RED beta-ketoacyl synthase, dehydratase; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>1d7o_A Enoyl-[acyl-carrier protein] reductase (NADH) PRE; triclosan, enoyl reductase, oxidoreductase; HET: NAD TCL; 1.90A {Brassica napus} SCOP: c.2.1.2 PDB: 1eno_A* 1enp_A* 1cwu_A* Back     alignment and structure
>3zen_D Fatty acid synthase; transferase, mycolic acid biosynthesis, multifunctional ENZY substrate channeling; HET: FMN; 7.50A {Mycobacterium smegmatis} PDB: 4b3y_A* Back     alignment and structure
>2uv9_A Fatty acid synthase alpha subunits; fungal, dehydratase, enoyl reductase, ketoacyl synthase, ketoacyl reductase; 3.1A {Thermomyces lanuginosus} PDB: 2uvb_A* Back     alignment and structure
>2uv8_A Fatty acid synthase subunit alpha (FAS2); fatty acid biosynthesis, malonyl/palmitoyl transferase, phosphopantetheine, transferase; HET: GVL FMN; 3.10A {Saccharomyces cerevisiae} PDB: 2vkz_A* 3hmj_A* Back     alignment and structure
>1zmt_A Haloalcohol dehalogenase HHEC; halohydrin dehalogenase, epoxide catalysis, enantioselectivity, lyase; HET: RNO; 1.70A {Agrobacterium tumefaciens} SCOP: c.2.1.2 PDB: 1pwz_A 1px0_A* 1pwx_A* 1zo8_A* Back     alignment and structure
>1gz6_A Estradiol 17 beta-dehydrogenase 4; 17BETA-HSD4, MFE-2, beta-oxidation, peroxisome, SDR, steroid biosynthesis, oxidoreductase, NADP; HET: NAI; 2.38A {Rattus norvegicus} SCOP: c.2.1.2 PDB: 1zbq_A* Back     alignment and structure
>3ehe_A UDP-glucose 4-epimerase (GALE-1); PSI-II, NYSGXRC, ST genomics, protein structure initiative, NEW YORK SGX resear for structural genomics; HET: NAD; 1.87A {Archaeoglobus fulgidus} SCOP: c.2.1.0 Back     alignment and structure
>2et6_A (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-oxidation, peroxisome, SDR, oxido; 2.22A {Candida tropicalis} Back     alignment and structure
>2x6t_A ADP-L-glycero-D-manno-heptose-6-epimerase; isomerase, carbohydrate metabolism, stress response; HET: NAP ADP BMA; 2.36A {Escherichia coli} PDB: 2x86_A* Back     alignment and structure
>3oml_A GH14720P, peroxisomal multifunctional enzyme type 2, CG3415; rossmann fold, hot-DOG fold, hydratase 2 motif, peroxisomes, oxidoreductase; 2.15A {Drosophila melanogaster} Back     alignment and structure
>3lt0_A Enoyl-ACP reductase; triclosan, triclosan variant, oxidoredu P.falciparum; HET: NAD FT1; 1.96A {Plasmodium falciparum} SCOP: c.2.1.2 PDB: 1v35_A* 3lsy_A* 1uh5_A* 3lt1_A* 3lt2_A* 3lt4_A* 3am4_A* 3am3_A* 3am5_A* 2o2y_A* 2oos_A* 2ol4_A* 2op0_A* 2op1_A* 1vrw_A* 1zsn_A* 1zw1_A* 1zxb_A* 1zxl_A* 2foi_A* ... Back     alignment and structure
>1vl0_A DTDP-4-dehydrorhamnose reductase, RFBD ortholog; structural joint center for structural genomics, JCSG, protein structu initiative; HET: NAI UNL; 2.05A {Clostridium acetobutylicum} SCOP: c.2.1.2 Back     alignment and structure
>2o2s_A Enoyl-acyl carrier reductase; enoyl reductase, triclosan, rossmann fold, oxidoreductase; HET: NAD TCL; 2.60A {Toxoplasma gondii} PDB: 2o50_A 3nj8_A* Back     alignment and structure
>2ptg_A Enoyl-acyl carrier reductase; apicomplexa, enoyl (acyl-carrier-P reductase, oxidoreductase; 2.60A {Eimeria tenella} Back     alignment and structure
>1lu9_A Methylene tetrahydromethanopterin dehydrogenase; alpha/beta twisted open sheet structure, oxidoreductase; 1.90A {Methylobacterium extorquens} SCOP: c.2.1.7 c.58.1.4 PDB: 1lua_A* Back     alignment and structure
>2yut_A Putative short-chain oxidoreductase; alpha and beta proteins (A/B), NAD(P)-binding rossmann-fold structural genomics, NPPSFA; HET: NAP; 2.20A {Thermus thermophilus} Back     alignment and structure
>3sc6_A DTDP-4-dehydrorhamnose reductase; RFBD, structural genomics, infectious diseases, bacillus anthracis STR. AMES, rhamnose biosynthetic pathway; HET: NAP; 2.65A {Bacillus anthracis} SCOP: c.2.1.0 Back     alignment and structure
>3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi} Back     alignment and structure
>1e6u_A GDP-fucose synthetase; epimerase/reductase, SDR, RED; HET: NAP; 1.45A {Escherichia coli} SCOP: c.2.1.2 PDB: 1e7q_A* 1bsv_A* 1fxs_A* 1gfs_A 1e7s_A* 1bws_A* 1e7r_A* Back     alignment and structure
>3ajr_A NDP-sugar epimerase; L-threonine dehydrogenase, L-3- hydroxynorvaline, oxidoreductase; HET: NAD; 1.77A {Thermoplasma volcanium} PDB: 3a9w_A* 3a4v_A* 3a1n_A* Back     alignment and structure
>2vz8_A Fatty acid synthase; transferase, phosphopantetheine, multienzyme, megasynthase, fatty acid synthesis; 3.2A {Sus scrofa} PDB: 2vz9_A* Back     alignment and structure
>1n2s_A DTDP-4-, DTDP-glucose oxidoreductase; rossman-fold, sugar-nucleotide-binding domain; HET: NAD; 2.00A {Salmonella enterica subsp} SCOP: c.2.1.2 PDB: 1kc1_A* 1kc3_A* 1kbz_A* Back     alignment and structure
>1zmo_A Halohydrin dehalogenase; haloalcohol dehalogenase, short- chain dehydrogenase/reductase family, lyase; 2.00A {Arthrobacter SP} Back     alignment and structure
>2ggs_A 273AA long hypothetical DTDP-4-dehydrorhamnose reductase; alpha, beta, oxidoreductase; HET: NDP; 1.70A {Sulfolobus tokodaii} Back     alignment and structure
>1eq2_A ADP-L-glycero-D-mannoheptose 6-epimerase; N-terminal domain rossmann fold, C-terminal mixed alpha/beta domain; HET: NAP ADQ; 2.00A {Escherichia coli} SCOP: c.2.1.2 Back     alignment and structure
>3st7_A Capsular polysaccharide synthesis enzyme CAP5F; rossmann fold, cupid domain, short-chain dehydrogenase/reduc NADPH; 2.45A {Staphylococcus aureus} PDB: 2zkl_A 3vhr_A Back     alignment and structure
>1u7z_A Coenzyme A biosynthesis bifunctional protein coabc; ligase; HET: PMT; 2.30A {Escherichia coli} SCOP: c.72.3.1 PDB: 1u7w_A* 1u7u_A* 1u80_A* Back     alignment and structure
>4ggo_A Trans-2-enoyl-COA reductase; rossmann fold, oxidoreductase; 2.00A {Treponema denticola atcc 35405} PDB: 4ggp_A Back     alignment and structure
>2gk4_A Conserved hypothetical protein; alpha-beta-alpha sandwich, flavoprotein, structural genomics protein structure initiative; 1.83A {Streptococcus pneumoniae} Back     alignment and structure
>3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} Back     alignment and structure
>4b8w_A GDP-L-fucose synthase; oxidoreductase; HET: NAP GDP; 2.75A {Homo sapiens} Back     alignment and structure
>1y7t_A Malate dehydrogenase; NAD-dependent-MDH-NADPH complex, oxidoreductase; HET: NDP; 1.65A {Thermus thermophilus} SCOP: c.2.1.5 d.162.1.1 PDB: 1iz9_A* 2cvq_A* 1bmd_A* 1bdm_A* 1wze_A* 1wzi_A* Back     alignment and structure
>1ff9_A Saccharopine reductase; lysine biosynthesis, alpha-aminoadipate pathway, dehydrogenase, oxidoreductase; 2.00A {Magnaporthe grisea} SCOP: c.2.1.3 d.81.1.2 PDB: 1e5l_A* 1e5q_A Back     alignment and structure
>2hmt_A YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane protein, ION transporter, symporter, transport protein; HET: NAI; 2.20A {Bacillus subtilis} SCOP: c.2.1.9 PDB: 2hms_A* 2hmu_A* 2hmv_A* 2hmw_A* 1lsu_A* Back     alignment and structure
>1id1_A Putative potassium channel protein; RCK domain, E.coli potassium channel, BK channel, rossmann fold, membrane protein; 2.40A {Escherichia coli} SCOP: c.2.1.9 Back     alignment and structure
>1pqw_A Polyketide synthase; rossmann fold, dimer, structural genomics, PSI, protein STRU initiative; 2.66A {Mycobacterium tuberculosis} SCOP: c.2.1.1 Back     alignment and structure
>4ina_A Saccharopine dehydrogenase; structural genomics, PSI-biology, northeast structural genom consortium, NESG, oxidoreductas; 2.49A {Wolinella succinogenes} Back     alignment and structure
>1b8p_A Protein (malate dehydrogenase); oxidoreductase; 1.90A {Aquaspirillum arcticum} SCOP: c.2.1.5 d.162.1.1 PDB: 1b8u_A* 1b8v_A* 3d5t_A Back     alignment and structure
>2g1u_A Hypothetical protein TM1088A; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.50A {Thermotoga maritima} PDB: 3l4b_A* Back     alignment and structure
>1lss_A TRK system potassium uptake protein TRKA homolog; KTN domain, NAD, RCK domain, potassium transport, potassium channel, KTRA; HET: NAD; 2.30A {Methanocaldococcus jannaschii} SCOP: c.2.1.9 Back     alignment and structure
>2axq_A Saccharopine dehydrogenase; rossmann fold variant, saccharopine reductase fold (domain II), alpha/beta protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>1jay_A Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossman fold, structural genomics; HET: NAP F42; 1.65A {Archaeoglobus fulgidus} SCOP: c.2.1.6 PDB: 1jax_A* Back     alignment and structure
>3l4b_C TRKA K+ channel protien TM1088B; potassium channel, ring-gating complex, structural GEN PSI-2-2, protein structure initiative; HET: AMP; 3.45A {Thermotoga maritima} Back     alignment and structure
>1nyt_A Shikimate 5-dehydrogenase; alpha/beta domains, WIDE cleft separation, oxidoreductase; HET: NAP; 1.50A {Escherichia coli} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>1v3u_A Leukotriene B4 12- hydroxydehydrogenase/prostaglandin 15-keto reductase; rossmann fold, riken structural genomics/proteomics initiative, RSGI; 2.00A {Cavia porcellus} SCOP: b.35.1.2 c.2.1.1 PDB: 1v3t_A 1v3v_A* 2dm6_A* 1zsv_A 2y05_A* Back     alignment and structure
>2hcy_A Alcohol dehydrogenase 1; tetramer of asymmetric dimers, zinc coordination, intramolec disulfide bonds, oxidoreductase; HET: 8ID; 2.44A {Saccharomyces cerevisiae} Back     alignment and structure
>1smk_A Malate dehydrogenase, glyoxysomal; tricarboxylic cycle, glyoxysome, NAD, glyoxylate bypass, oxidoreductase; HET: CIT; 2.50A {Citrullus lanatus} PDB: 1sev_A Back     alignment and structure
>3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12} Back     alignment and structure
>3c24_A Putative oxidoreductase; YP_511008.1, structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.62A {Jannaschia SP} Back     alignment and structure
>1p77_A Shikimate 5-dehydrogenase; NADPH, oxidoreductase; HET: ATR; 1.95A {Haemophilus influenzae} SCOP: c.2.1.7 c.58.1.5 PDB: 1p74_A* Back     alignment and structure
>1nvt_A Shikimate 5'-dehydrogenase; structural genomics, PSI, protein structure initiative; HET: NAP; 2.35A {Methanocaldococcus jannaschii} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>1qor_A Quinone oxidoreductase; HET: NAP; 2.20A {Escherichia coli} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>3o8q_A Shikimate 5-dehydrogenase I alpha; structural genomics, center for structural genomics of infec diseases, csgid; HET: EPE; 1.45A {Vibrio cholerae biovar el tor} PDB: 3sef_A* 3pgj_A* 3o8q_B* Back     alignment and structure
>1wly_A CAAR, 2-haloacrylate reductase; NADPH-dependent oxidoreductase, oxidoreductase; 1.30A {Burkholderia SP} Back     alignment and structure
>1iz0_A Quinone oxidoreductase; APO-enzyme, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.30A {Thermus thermophilus} SCOP: b.35.1.2 c.2.1.1 PDB: 1iyz_A 2cf2_D Back     alignment and structure
>3tnl_A Shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD SKM; 1.45A {Listeria monocytogenes} PDB: 3toz_A* Back     alignment and structure
>1yb5_A Quinone oxidoreductase; medium-chain dehydrogenase/reductase, quinon reduction, structural genomics, structural genomics consort; HET: NAP; 1.85A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>2j8z_A Quinone oxidoreductase; medium-chain dehydrogenase- reductases, QUIN oxidoreductase, oxidative stress response; HET: NAP; 2.50A {Homo sapiens} PDB: 2oby_A* Back     alignment and structure
>2j3h_A NADP-dependent oxidoreductase P1; double bond reductase (AT5G16970), APO form; 2.5A {Arabidopsis thaliana} PDB: 2j3i_A* 2j3j_A* 2j3k_A* Back     alignment and structure
>3jyo_A Quinate/shikimate dehydrogenase; enzyme-cofactor complex, amino-acid biosynthesis, aromatic A biosynthesis, NAD, oxidoreductase; HET: NAD; 1.00A {Corynebacterium glutamicum} PDB: 3jyp_A* 3jyq_A* 2nlo_A Back     alignment and structure
>4b7c_A Probable oxidoreductase; NADP cofactor, rossmann fold; HET: MES; 2.10A {Pseudomonas aeruginosa PA01} PDB: 4b7x_A* Back     alignment and structure
>4eye_A Probable oxidoreductase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.10A {Mycobacterium abscessus} Back     alignment and structure
>4g65_A TRK system potassium uptake protein TRKA; structural genomics, center for structural genomics of infec diseases, csgid, niaid; HET: MSE; 2.09A {Vibrio vulnificus} Back     alignment and structure
>3ond_A Adenosylhomocysteinase; plant protein, enzyme-substrate complex, NAD cofactor, regul SAM-dependent methylation reactions; HET: NAD ADN; 1.17A {Lupinus luteus} PDB: 3one_A* 3onf_A* Back     alignment and structure
>2zb4_A Prostaglandin reductase 2; rossmann fold, alternative splicing, cytoplasm, NADP, oxidoreductase; HET: NAP 5OP; 1.63A {Homo sapiens} PDB: 2zb7_A* 2zb8_A* 2w98_A* 2vna_A* 2w4q_A* 1vj1_A 2zb3_A* Back     alignment and structure
>3abi_A Putative uncharacterized protein PH1688; L-lysine dehydrogenase, oxidoreductase; HET: NAD; 2.44A {Pyrococcus horikoshii} Back     alignment and structure
>3pwz_A Shikimate dehydrogenase 3; alpha-beta, oxidoreductase; 1.71A {Pseudomonas putida} Back     alignment and structure
>4dup_A Quinone oxidoreductase; PSI-biology, structural genomics, protein structure initiati structural genomics research consortium, nysgrc; 2.45A {Rhizobium etli} Back     alignment and structure
>3gms_A Putative NADPH:quinone reductase; structural genomics, putative quinone oxidoreductase, unknown function, PSI-2; 1.76A {Bacillus thuringiensis} Back     alignment and structure
>2o7s_A DHQ-SDH PR, bifunctional 3-dehydroquinate dehydratase/shikima dehydrogenase; shikimate, NADPH, dehydroshikimate, bifunctional enzyme; HET: DHK TLA NAP; 1.78A {Arabidopsis thaliana} PDB: 2o7q_A* 2gpt_A* Back     alignment and structure
>3phh_A Shikimate dehydrogenase; shikimate pathway, helicobacter PYL oxidoreductase, alpha/beta domain, rossmann fold; HET: SKM; 1.42A {Helicobacter pylori} PDB: 3phg_A* 3phi_A* 3phj_A* 4foo_A 4fpx_A 4fos_A* 4fr5_A* 4fq8_A* Back     alignment and structure
>3qwb_A Probable quinone oxidoreductase; rossmann fold, quinone oxidoreductases, NADPH, cytoplasm and oxidoreductase; HET: NDP; 1.59A {Saccharomyces cerevisiae} PDB: 3qwa_A* Back     alignment and structure
>2eez_A Alanine dehydrogenase; TTHA0216, structural genomic NPPSFA, national project on protein structural and function analyses; 2.71A {Thermus thermophilus} Back     alignment and structure
>3jyn_A Quinone oxidoreductase; rossmann fold, protein-NADPH complex; HET: NDP; 2.01A {Pseudomonas syringae PV} PDB: 3jyl_A* Back     alignment and structure
>1pzg_A LDH, lactate dehydrogenase; apicomplexa, APAD, tetramer, rossmann fold, oxidoreductase; HET: CME A3D; 1.60A {Toxoplasma gondii} SCOP: c.2.1.5 d.162.1.1 PDB: 1pzf_A* 1pze_A* 1pzh_A* 3om9_A* 1sov_A 1sow_A* 3czm_A* Back     alignment and structure
>2eih_A Alcohol dehydrogenase; zinc ION binding protein, structural genomics, NPPSFA, natio project on protein structural and functional analyses; 2.30A {Thermus thermophilus} Back     alignment and structure
>3don_A Shikimate dehydrogenase; alpha-beta structure, rossman fold, amino-acid biosynthesis, amino acid biosynthesis, NADP, oxidoreductase; 2.10A {Staphylococcus epidermidis} PDB: 3doo_A* Back     alignment and structure
>1f0y_A HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive ternary complex, oxidoreductase; HET: CAA NAD; 1.80A {Homo sapiens} SCOP: a.100.1.3 c.2.1.6 PDB: 3rqs_A 1lsj_A* 1il0_A* 1lso_A* 1m76_A* 1m75_A* 1f14_A 1f12_A 1f17_A* 3had_A* 2hdh_A* 3hdh_A* Back     alignment and structure
>2aef_A Calcium-gated potassium channel MTHK; rossmann fold, helix-turn-helix, Ca2+ binding, flexible interface; 1.70A {Methanothermobacterthermautotrophicus} PDB: 2aej_A 2aem_A 3rbx_A 2ogu_A 2fy8_A 3kxd_A Back     alignment and structure
>1jvb_A NAD(H)-dependent alcohol dehydrogenase; archaeon, zinc, oxidoreductase; HET: MSE; 1.85A {Sulfolobus solfataricus} SCOP: b.35.1.2 c.2.1.1 PDB: 1r37_A* 1nto_A 1nvg_A 3i4c_A 2eer_A* Back     alignment and structure
>3t4e_A Quinate/shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 1.95A {Salmonella enterica subsp} PDB: 1npd_A* 1o9b_A* 1vi2_A* Back     alignment and structure
>4huj_A Uncharacterized protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, dinucleotide-binding; 1.77A {Sinorhizobium meliloti} Back     alignment and structure
>2cdc_A Glucose dehydrogenase glucose 1-dehydrogenase, DHG-1; reductase, oxidoreductase, MDR family; HET: XYS XYP NAP; 1.50A {Sulfolobus solfataricus} PDB: 2cdb_A* 2cd9_A 2cda_A* Back     alignment and structure
>1ks9_A KPA reductase;, 2-dehydropantoate 2-reductase; PANE, APBA, ketopantoate reductase, rossman fold, monomer, APO, oxidoreductase; 1.70A {Escherichia coli} SCOP: a.100.1.7 c.2.1.6 PDB: 1yon_A* 1yjq_A* 2ofp_A* Back     alignment and structure
>3lk7_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; agalacitae, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: MSE; 1.50A {Streptococcus agalactiae} Back     alignment and structure
>3c85_A Putative glutathione-regulated potassium-efflux S protein KEFB; TRKA domain; HET: AMP; 1.90A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3pi7_A NADH oxidoreductase; groes-like fold, NAD(P)-binding rossmann fold, structural GE joint center for structural genomics, JCSG; HET: MSE; 1.71A {Mesorhizobium loti} Back     alignment and structure
>3tl2_A Malate dehydrogenase; center for structural genomics of infectious diseases, csgid dehydrogenase, oxidoreductase, citric acid cycle; 1.70A {Bacillus anthracis} Back     alignment and structure
>2c0c_A Zinc binding alcohol dehydrogenase, domain containing 2; oxidoreductase, quinone oxidoreductase, medium-chain dehydrogenase/reductase; HET: NAP; 1.45A {Homo sapiens} PDB: 2x1h_A* 2x7h_A* 2wek_A* Back     alignment and structure
>2egg_A AROE, shikimate 5-dehydrogenase; dimer, X-RAY diffraction, structural genomics, NPPSFA; 2.25A {Geobacillus kaustophilus} Back     alignment and structure
>1mld_A Malate dehydrogenase; oxidoreductase(NAD(A)-CHOH(D)); HET: CIT; 1.83A {Sus scrofa} SCOP: c.2.1.5 d.162.1.1 PDB: 2dfd_A* Back     alignment and structure
>1pjc_A Protein (L-alanine dehydrogenase); oxidoreductase, NAD; HET: NAD; 2.00A {Phormidium lapideum} SCOP: c.2.1.4 c.23.12.2 PDB: 1pjb_A* 1say_A Back     alignment and structure
>3k96_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA, IDP01976, oxidoreductase, phospholipid biosynthesis; HET: EPE; 2.10A {Coxiella burnetii} Back     alignment and structure
>3fbg_A Putative arginate lyase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.60A {Staphylococcus haemolyticus} Back     alignment and structure
>1xa0_A Putative NADPH dependent oxidoreductases; structural genomics, protein structure initiative, MCSG; HET: DTY; 2.80A {Geobacillus stearothermophilus} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>4a0s_A Octenoyl-COA reductase/carboxylase; oxidoreductase, transferase, cinnabaramide PKS biosynthesis; HET: CO8 NAP; 1.90A {Streptomyces SP} PDB: 4a10_A Back     alignment and structure
>2vns_A Metalloreductase steap3; metal-binding, transmembrane, rossmann fold, transport, cell cycle, transferrin, flavoprotein, alternative splicing; HET: CIT; 2.0A {Homo sapiens} PDB: 2vq3_A* Back     alignment and structure
>2pv7_A T-protein [includes: chorismate mutase (EC 5.4.99 and prephenate dehydrogenase (EC...; 1574749, chorismate mutase type II; HET: MSE TYR NAD; 2.00A {Haemophilus influenzae} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>2raf_A Putative dinucleotide-binding oxidoreductase; NP_786167.1, NADP oxidoreductase coenzyme F420-dependent, structural genomics; HET: MSE NAP; 1.60A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>2ew2_A 2-dehydropantoate 2-reductase, putative; alpha-structure, alpha-beta structure, structural genomics, protein structure initiative; HET: MSE; 2.00A {Enterococcus faecalis} Back     alignment and structure
>1tt7_A YHFP; alcohol dehydrogenase, Zn-dependent, NAD, structural genomics, protein structure initiative, PSI; 2.70A {Bacillus subtilis} SCOP: b.35.1.2 c.2.1.1 PDB: 1y9e_A* Back     alignment and structure
>1hye_A L-lactate/malate dehydrogenase; nucleotide binding domain, oxidoreductase; HET: NAP; 1.90A {Methanocaldococcus jannaschii} SCOP: c.2.1.5 d.162.1.1 PDB: 1hyg_A* Back     alignment and structure
>1y6j_A L-lactate dehydrogenase; southeast collaboratory for structural genomics, secsg, protein struc initiative, PSI, oxidoreductase; 3.01A {Clostridium thermocellum} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>4e12_A Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1.93A {Acinetobacter baylyi} PDB: 4dyd_A* 4e13_A* Back     alignment and structure
>1o6z_A MDH, malate dehydrogenase; halophilic, ION-binding, protein-solvent interaction, oxidoreductase; HET: NAD; 1.95A {Haloarcula marismortui} SCOP: c.2.1.5 d.162.1.1 PDB: 1gt2_A* 2x0r_A* 2j5k_A 2j5q_A 2j5r_A 1d3a_A 1hlp_A* 2hlp_A Back     alignment and structure
>1dih_A Dihydrodipicolinate reductase; oxidoreductase; HET: NDP; 2.20A {Escherichia coli} SCOP: c.2.1.3 d.81.1.3 PDB: 1arz_A* 1dru_A* 1drv_A* 1drw_A* Back     alignment and structure
>1bg6_A N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L) stereospecific opine dehydrogenase, oxidoreductase; 1.80A {Arthrobacter SP} SCOP: a.100.1.5 c.2.1.6 Back     alignment and structure
>2ewd_A Lactate dehydrogenase,; protein-substrate_cofactor analog complex, oxidoreductase; HET: A3D; 2.00A {Cryptosporidium parvum} PDB: 2frm_A 2fn7_A* 2fnz_A* 2fm3_A Back     alignment and structure
>3fbt_A Chorismate mutase and shikimate 5-dehydrogenase fusion protein; structural genomics, oxidoreductase, amino-acid biosynthesis; 2.10A {Clostridium acetobutylicum} Back     alignment and structure
>3dtt_A NADP oxidoreductase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: NAP; 1.70A {Arthrobacter SP} Back     alignment and structure
>3qha_A Putative oxidoreductase; seattle structural genomics center for infectious disease, S mycobacterium avium 104, rossmann fold; 2.25A {Mycobacterium avium} Back     alignment and structure
>2vhw_A Alanine dehydrogenase; NAD, secreted, oxidoreductase; HET: NAI; 2.0A {Mycobacterium tuberculosis} PDB: 2vhx_A* 2vhy_A 2vhz_A* 2vhv_A* 2voe_A 2voj_A* Back     alignment and structure
>3ggo_A Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-beta, oxidoreductase; HET: NAI ENO; 2.15A {Aquifex aeolicus} PDB: 3ggg_D* 3ggp_A* Back     alignment and structure
>3nx4_A Putative oxidoreductase; csgid, structural genomics, center for struc genomics of infectious diseases, PSI, protein structure INI; HET: MSE NAP; 1.90A {Salmonella enterica subsp} PDB: 1o89_A 1o8c_A* Back     alignment and structure
>3gaz_A Alcohol dehydrogenase superfamily protein; oxidoreductase, PSI-II, alcohol dehydrogenase superf structural genomics; 1.96A {Novosphingobium aromaticivorans} Back     alignment and structure
>1piw_A Hypothetical zinc-type alcohol dehydrogenase- like protein in PRE5-FET4 intergenic...; ADH topology, NADP(H)dependent, oxidoreductase; HET: NAP; 3.00A {Saccharomyces cerevisiae} SCOP: b.35.1.2 c.2.1.1 PDB: 1ps0_A* 1q1n_A Back     alignment and structure
>3oj0_A Glutr, glutamyl-tRNA reductase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE SO4; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>3l9w_A Glutathione-regulated potassium-efflux system Pro linker, ancillary protein KEFF; potassium channel regulation, domains, antiport; HET: FMN AMP GSH; 1.75A {Escherichia coli} PDB: 3eyw_A* 3l9x_A* Back     alignment and structure
>3krt_A Crotonyl COA reductase; structural genomics, protein structure initiative, NYSGXRC, PSI-2; 2.19A {Streptomyces coelicolor} PDB: 3hzz_A Back     alignment and structure
>1rjw_A ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD, zinc, tetramer; 2.35A {Geobacillus stearothermophilus} SCOP: b.35.1.2 c.2.1.1 PDB: 3pii_A Back     alignment and structure
>2vn8_A Reticulon-4-interacting protein 1; mitochondrion, transit peptide, receptor inhibitor; HET: NDP CIT; 2.1A {Homo sapiens} Back     alignment and structure
>3pef_A 6-phosphogluconate dehydrogenase, NAD-binding; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R geobacter metallireducens; HET: NAP; 2.07A {Geobacter metallireducens} Back     alignment and structure
>3pqe_A L-LDH, L-lactate dehydrogenase; FBP, oxidoreductase; 2.20A {Bacillus subtilis} PDB: 3pqf_A* 3pqd_A* Back     alignment and structure
>1lld_A L-lactate dehydrogenase; oxidoreductase(CHOH (D)-NAD (A)); HET: NAD; 2.00A {Bifidobacterium longum subsp} SCOP: c.2.1.5 d.162.1.1 PDB: 1lth_T* Back     alignment and structure
>2uyy_A N-PAC protein; long-chain dehydrogenase, cytokine; HET: NA7; 2.5A {Homo sapiens} Back     alignment and structure
>3two_A Mannitol dehydrogenase; cinnamyl-alcohol dehydrogenase, NADP(H) oxidoreductase; HET: NDP; 2.18A {Helicobacter pylori} Back     alignment and structure
>2nqt_A N-acetyl-gamma-glutamyl-phosphate reductase; apoprotein, dimer, rossmann fold, structural genomics, PSI, protein structure initiative; 1.58A {Mycobacterium tuberculosis} PDB: 2i3a_A* 2i3g_A Back     alignment and structure
>3doj_A AT3G25530, dehydrogenase-like protein; gamma-hydroxybutyrate dehydrogenase, 4-hydroxybutyrate dehydrogenase; 2.10A {Arabidopsis thaliana} Back     alignment and structure
>5mdh_A Malate dehydrogenase; oxidoreductase, (NAD(A)-CHOH(D)); HET: NAD; 2.40A {Sus scrofa} SCOP: c.2.1.5 d.162.1.1 PDB: 4mdh_A* Back     alignment and structure
>3gvi_A Malate dehydrogenase; NAD, oxidoreductase, tricarboxylic acid cycle, structural genomics; HET: ADP; 2.25A {Brucella melitensis biovar ABORTUS2308} PDB: 3gvh_A* Back     alignment and structure
>4e21_A 6-phosphogluconate dehydrogenase (decarboxylating; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.30A {Geobacter metallireducens} Back     alignment and structure
>3mog_A Probable 3-hydroxybutyryl-COA dehydrogenase; structural genomics, PSI, protein structure initiative, NYSG oxidoreductase; 2.20A {Escherichia coli} Back     alignment and structure
>2hjr_A Malate dehydrogenase; malaria, structural genomics, structural genomics consortium, SGC, oxidoreductase; HET: CIT APR; 2.20A {Cryptosporidium parvum} Back     alignment and structure
>3fi9_A Malate dehydrogenase; structural genomics, oxidoreductase, PSI-2, protein structur initiative; 1.90A {Porphyromonas gingivalis} Back     alignment and structure
>4ezb_A Uncharacterized conserved protein; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 2.10A {Sinorhizobium meliloti} Back     alignment and structure
>1ur5_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle; HET: NAD; 1.75A {Chloroflexus aurantiacus} SCOP: c.2.1.5 d.162.1.1 PDB: 1uxg_A* 1guy_A* 1uxk_A* 1uxh_A* 1uxj_A* 1uxi_A* Back     alignment and structure
>2ozp_A N-acetyl-gamma-glutamyl-phosphate reductase; amino acid biosynthesis, structural genomics, riken structur genomics/proteomics initiative; 2.01A {Thermus thermophilus} Back     alignment and structure
>3g0o_A 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine catabolism, tartaric acid, target 11128H, NYSGXRC, PSI-2, structural genomics; HET: TLA; 1.80A {Salmonella typhimurium} Back     alignment and structure
>4gbj_A 6-phosphogluconate dehydrogenase NAD-binding; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.05A {Dyadobacter fermentans} Back     alignment and structure
>3gg2_A Sugar dehydrogenase, UDP-glucose/GDP-mannose dehydrogenase family; structural genomics, oxidoreductase, PSI-2; HET: UGA; 1.70A {Porphyromonas gingivalis} Back     alignment and structure
>2d8a_A PH0655, probable L-threonine 3-dehydrogenase; pyrococcus horikoshii OT3, structural genomics; HET: NAD; 2.05A {Pyrococcus horikoshii} PDB: 2dfv_A* 3gfb_A* Back     alignment and structure
>1jw9_B Molybdopterin biosynthesis MOEB protein; MOEB: modified rossmann fold, (2) Cys-X-X-Cys zinc-binding M MOAD: ubiquitin-like fold; 1.70A {Escherichia coli} SCOP: c.111.1.1 PDB: 1jwa_B* 1jwb_B* Back     alignment and structure
>2qyt_A 2-dehydropantoate 2-reductase; APC81190, porphyromonas gingi W83, structural genomics, PSI-2; HET: MSE; 2.15A {Porphyromonas gingivalis} Back     alignment and structure
>3p2o_A Bifunctional protein fold; structural genomics, center for structural genomics of infec diseases, csgid, alpha-beta-alpha sandwich; HET: NAD; 2.23A {Campylobacter jejuni subsp} Back     alignment and structure
>1yqd_A Sinapyl alcohol dehydrogenase; lignin, monolignol, oxidoreductase, zinc-dependent, plant DE biosynthesis, substrate inhibition; HET: NAP; 1.65A {Populus tremuloides} PDB: 1yqx_A* Back     alignment and structure
>1t2d_A LDH-P, L-lactate dehydrogenase; ternary complex, oxidoreductase; HET: NAD; 1.10A {Plasmodium falciparum} SCOP: c.2.1.5 d.162.1.1 PDB: 1t25_A* 1t26_A* 1t2c_A* 1t24_A* 2x8l_A 2ydn_A* 2a94_A* 1u4s_A* 1u5a_A* 1u5c_A* 1u4o_A* 1t2e_A* 1xiv_A* 1ceq_A 1ldg_A* 1cet_A* 1oc4_A* 2a92_A* 2aa3_A* Back     alignment and structure
>1gu7_A Enoyl-[acyl-carrier-protein] reductase [NADPH, B-specific] 1,mitochondrial; oxidoreductase, thioester reduction, fatty acids; 1.70A {Candida tropicalis} SCOP: b.35.1.2 c.2.1.1 PDB: 1guf_A* 1n9g_B* 1n9g_A* 1gyr_A 1h0k_A Back     alignment and structure
>2f1k_A Prephenate dehydrogenase; tyrosine synthesis, X-RA crystallography structure, oxidoreductase; HET: OMT NAP; 1.55A {Synechocystis SP} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>2rcy_A Pyrroline carboxylate reductase; malaria, structural genomics, pyrroline reductase, oxidoredu structural genomics consortium, SGC; HET: NAP; 2.30A {Plasmodium falciparum} Back     alignment and structure
>3pdu_A 3-hydroxyisobutyrate dehydrogenase family protein; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R glyoxylate metabolism; HET: NAP; 1.89A {Geobacter sulfurreducens} Back     alignment and structure
>3goh_A Alcohol dehydrogenase, zinc-containing; NP_718042.1, alcohol dehydrogenase superfamily protein, ALCO dehydrogenase groes-like domain; 1.55A {Shewanella oneidensis} Back     alignment and structure
>3i83_A 2-dehydropantoate 2-reductase; structural genomics, oxidoreductase, NADP, pantothenate BIOS PSI-2, protein structure initiative; 1.90A {Methylococcus capsulatus} Back     alignment and structure
>2rir_A Dipicolinate synthase, A chain; structural genomics, APC1343, PSI-2, structure initiative; HET: MSE NAP; 2.79A {Bacillus subtilis} Back     alignment and structure
>1guz_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle, NAD; HET: NAD; 2.0A {Chlorobium vibrioforme} SCOP: c.2.1.5 d.162.1.1 PDB: 1gv1_A 1gv0_A* Back     alignment and structure
>3uog_A Alcohol dehydrogenase; structural genomics, protein structure initiative, PSI-biolo YORK structural genomics research consortium; 2.20A {Sinorhizobium meliloti 1021} Back     alignment and structure
>4dvj_A Putative zinc-dependent alcohol dehydrogenase Pro; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.99A {Rhizobium etli} Back     alignment and structure
>3u62_A Shikimate dehydrogenase; shikimate pathway, oxidoreductase; 1.45A {Thermotoga maritima} Back     alignment and structure
>1vpd_A Tartronate semialdehyde reductase; structural genomics, MCSG, protein structure initiative, PSI, midwest center for structural genomics; HET: MSE TLA; 1.65A {Salmonella typhimurium} SCOP: a.100.1.1 c.2.1.6 Back     alignment and structure
>1uuf_A YAHK, zinc-type alcohol dehydrogenase-like protein YAHK; oxidoreductase, zinc binding, oxydoreductase, metal-binding; 1.76A {Escherichia coli} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>1leh_A Leucine dehydrogenase; oxidoreductase; 2.20A {Lysinibacillus sphaericus} SCOP: c.2.1.7 c.58.1.1 Back     alignment and structure
>3hn2_A 2-dehydropantoate 2-reductase; PSI-2, NYSGXRC, structural GE protein structure initiative; 2.50A {Geobacter metallireducens} Back     alignment and structure
>1e3j_A NADP(H)-dependent ketose reductase; oxidoreductase, fructose reduction; 2.3A {Bemisia argentifolii} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>2gcg_A Glyoxylate reductase/hydroxypyruvate reductase; NAD(P) rossmann fold, formate/glycerate dehydrogenase substr binding domain, oxidoreductase; HET: NDP; 2.20A {Homo sapiens} PDB: 2wwr_A 2h1s_A 2q50_A Back     alignment and structure
>1ys4_A Aspartate-semialdehyde dehydrogenase; oxidoreductase, asadh; HET: NAP; 2.29A {Methanocaldococcus jannaschii} Back     alignment and structure
>1xyg_A Putative N-acetyl-gamma-glutamyl-phosphate reduct; structural genomics, protein structure initiative, CENT eukaryotic structural genomics; 2.19A {Arabidopsis thaliana} SCOP: c.2.1.3 d.81.1.1 PDB: 2q49_A 2cvo_A Back     alignment and structure
>4h7p_A Malate dehydrogenase; ssgcid, structural G seattle structural genomics center for infectious disease, oxidoreductase; 1.30A {Leishmania major} Back     alignment and structure
>2dq4_A L-threonine 3-dehydrogenase; NAD-dependent, oxidoreductase, structural genomics, NPPSFA; HET: MES; 2.50A {Thermus thermophilus} PDB: 2ejv_A* Back     alignment and structure
>2v6b_A L-LDH, L-lactate dehydrogenase; oxidoreductase, radioresistance, NAD, cytoplasm, mesophilic, glycolysis; 2.50A {Deinococcus radiodurans} Back     alignment and structure
>2izz_A Pyrroline-5-carboxylate reductase 1; amino-acid biosynthesis, NADP, oxidoreductase, proline biosy; HET: NAD; 1.95A {Homo sapiens} PDB: 2ger_A 2gr9_A* 2gra_A* Back     alignment and structure
>2hk9_A Shikimate dehydrogenase; shikimate pathway, drug design, oxidoreductase; HET: ATR SKM NAP; 2.20A {Aquifex aeolicus} PDB: 2hk8_A 2hk7_A Back     alignment and structure
>1kjq_A GART 2, phosphoribosylglycinamide formyltransferase 2, 5'-; ATP-grAsp, purine biosynthesis, nucleotide; HET: ADP MPO; 1.05A {Escherichia coli} SCOP: b.84.2.1 c.30.1.1 d.142.1.2 PDB: 1kj9_A* 1kji_A* 1kjj_A* 1kj8_A* 1eyz_A* 1ez1_A* Back     alignment and structure
>3ngx_A Bifunctional protein fold; methylenetetrahydrofolate dehydrogenase/cyclohydrolase; 2.30A {Thermoplasma acidophilum} PDB: 3ngl_A Back     alignment and structure
>1gpj_A Glutamyl-tRNA reductase; tRNA-dependent tetrapyrrole biosynthesis; HET: GMC CIT; 1.95A {Methanopyrus kandleri} SCOP: a.151.1.1 c.2.1.7 d.58.39.1 Back     alignment and structure
>3cky_A 2-hydroxymethyl glutarate dehydrogenase; rossmann fold, two domain enzyme, oxidoreductase; 2.30A {Eubacterium barkeri} Back     alignment and structure
>3ghy_A Ketopantoate reductase protein; oxidoreductase, NAD-binding domain, PSI-2, NYSGXRC, structur genomics, protein structure initiative; 2.00A {Ralstonia solanacearum} Back     alignment and structure
>1mv8_A GMD, GDP-mannose 6-dehydrogenase; rossman fold, domain-swapped dimer, enzyme complex with COFA product, oxidoreductase; HET: SUC NAD GDX; 1.55A {Pseudomonas aeruginosa} SCOP: a.100.1.4 c.2.1.6 c.26.3.1 PDB: 1mfz_A* 1muu_A* Back     alignment and structure
>3qsg_A NAD-binding phosphogluconate dehydrogenase-like P; structural genomics, PSI-biology, midwest center for structu genomics; 1.90A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>3d4o_A Dipicolinate synthase subunit A; NP_243269.1, structural GEN joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: MSE TAR; 2.10A {Bacillus halodurans} Back     alignment and structure
>3s2e_A Zinc-containing alcohol dehydrogenase superfamily; FURX, oxidoreductase; HET: NAD; 1.76A {Ralstonia eutropha} PDB: 3s1l_A* 3s2f_A* 3s2g_A* 3s2i_A* 1llu_A* 3meq_A* Back     alignment and structure
>2dbq_A Glyoxylate reductase; D-3-phosphoglycerate dehydrogenase, ST genomics, NPPSFA; HET: NAP; 1.70A {Pyrococcus horikoshii} PDB: 2dbr_A* 2dbz_A* Back     alignment and structure
>2h6e_A ADH-4, D-arabinose 1-dehydrogenase; rossman fold, medium chain alcohol dehydrogenase, oxidoreduc; 1.80A {Sulfolobus solfataricus} Back     alignment and structure
>3g17_A Similar to 2-dehydropantoate 2-reductase; structural genomics, putative 2-dehydropantoate 2-reductase, protein structure initiative; 2.30A {Staphylococcus aureus subsp} Back     alignment and structure
>3p7m_A Malate dehydrogenase; putative dehydrogenase, enzyme, structural genomics, center structural genomics of infectious diseases, csgid; 2.20A {Francisella tularensis} Back     alignment and structure
>1h2b_A Alcohol dehydrogenase; oxidoreductase, archaea, hyperthermophIle, zinc; HET: OCA NAJ; 1.62A {Aeropyrum pernix} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>4dll_A 2-hydroxy-3-oxopropionate reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.11A {Polaromonas SP} Back     alignment and structure
>2b5w_A Glucose dehydrogenase; nucleotide binding motif, oxidoreductase; HET: FLC NAP; 1.60A {Haloferax mediterranei} PDB: 2b5v_A* 2vwg_A* 2vwh_A* 2vwp_A* 2vwq_A* Back     alignment and structure
>3gqv_A Enoyl reductase; medium-chain reductase (MDR superfamily), rossmann fold, NAD binding, oxidoreductase; HET: NAP; 1.74A {Aspergillus terreus} PDB: 3b6z_A* 3b70_A* Back     alignment and structure
>3dfz_A SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase, cobalamin biosynthesis, NAD, oxidoreducta porphyrin biosynthesis; 2.30A {Bacillus megaterium} Back     alignment and structure
>3ktd_A Prephenate dehydrogenase; structural genomics, joint center F structural genomics, JCSG, protein structure initiative; 2.60A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>2ahr_A Putative pyrroline carboxylate reductase; pyrroline reductase, proline biosynthesis, NAD(P protein, rossmann fold, doain swapping; HET: NAP; 2.15A {Streptococcus pyogenes} SCOP: a.100.1.10 c.2.1.6 PDB: 2amf_A Back     alignment and structure
>1oju_A MDH, malate dehydrogenase; hyperthermophilic, oxidoreductase; HET: ENA; 2.79A {Archaeoglobus fulgidus} PDB: 1ojs_A* 2x0i_A* 2x0j_A* Back     alignment and structure
>3tqh_A Quinone oxidoreductase; HET: NDP; 2.44A {Coxiella burnetii} Back     alignment and structure
>4a5o_A Bifunctional protein fold; oxidoreductase, hydrolase; 2.20A {Pseudomonas aeruginosa PAO1} Back     alignment and structure
>1evy_A Glycerol-3-phosphate dehydrogenase; rossmann fold, oxidoreductase; HET: MYS; 1.75A {Leishmania mexicana} SCOP: a.100.1.6 c.2.1.6 PDB: 1evz_A* 1jdj_A* 1m66_A* 1m67_A* 1n1e_A* 1n1g_A* Back     alignment and structure
>1vj0_A Alcohol dehydrogenase, zinc-containing; TM0436, structural G JCSG, PSI, protein structure initiative, joint center for S genomics; 2.00A {Thermotoga maritima} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>3l07_A Bifunctional protein fold; structural genomics, IDP01849, methylenetetrahydrofolate dehydrogenase; 1.88A {Francisella tularensis} Back     alignment and structure
>3tri_A Pyrroline-5-carboxylate reductase; amino acid biosynthesis, oxidoreductase; HET: NAP; 2.50A {Coxiella burnetii} Back     alignment and structure
>1txg_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; oxidoreductase; 1.70A {Archaeoglobus fulgidus} SCOP: a.100.1.6 c.2.1.6 Back     alignment and structure
>1yqg_A Pyrroline-5-carboxylate reductase; structural genomics, PSI, structure initiative, midwest center for structural genomic oxidoreductase; 1.90A {Neisseria meningitidis} SCOP: a.100.1.10 c.2.1.6 PDB: 2ag8_A* Back     alignment and structure
>3vku_A L-LDH, L-lactate dehydrogenase; rossmann fold, NADH binding, oxidoreductase; 1.96A {Lactobacillus casei} PDB: 2zqz_A 2zqy_A 3vkv_A* 1llc_A* Back     alignment and structure
>1cdo_A Alcohol dehydrogenase; oxidoreductase, oxidoreductase (CH-OH(D)-NAD(A)); HET: NAD; 2.05A {Gadus callarias} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>1a5z_A L-lactate dehydrogenase; oxidoreductase, glycolysis, hyperthermophiles, thermotoga MA protein stability; HET: FBP NAD; 2.10A {Thermotoga maritima} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>2jhf_A Alcohol dehydrogenase E chain; oxidoreductase, metal coordination, NAD, zinc, inhibition, acetylation, metal-binding; HET: NAD; 1.0A {Equus caballus} SCOP: b.35.1.2 c.2.1.1 PDB: 1adc_A* 1adf_A* 1adg_A* 1adb_A* 1bto_A* 1heu_A* 1hf3_A* 1hld_A* 1lde_A* 1ldy_A* 1mg0_A* 1n92_A* 1p1r_A* 1ye3_A 1het_A* 2jhg_A* 2ohx_A* 2oxi_A* 3bto_A* 4dwv_A* ... Back     alignment and structure
>3ado_A Lambda-crystallin; L-gulonate 3-dehydrogenase, structural genomics, riken struc genomics/proteomics initiative, RSGI, acetylation; 1.70A {Oryctolagus cuniculus} PDB: 3adp_A* 3f3s_A* Back     alignment and structure
>1e3i_A Alcohol dehydrogenase, class II; HET: NAD; 2.08A {Mus musculus} SCOP: b.35.1.2 c.2.1.1 PDB: 1e3e_A* 1e3l_A* 3cos_A* Back     alignment and structure
>1yb4_A Tartronic semialdehyde reductase; structural genomics, oxidoreductase, salmonella typhimurium LT2, PSI, protein ST initiative; 2.40A {Salmonella typhimurium} Back     alignment and structure
>3l6d_A Putative oxidoreductase; structural genomics, protein structure initiative, oxidoredu PSI-2; HET: MSE; 1.90A {Pseudomonas putida} Back     alignment and structure
>2vou_A 2,6-dihydroxypyridine hydroxylase; oxidoreductase, aromatic hydroxylase, nicotine degradation, mono-oxygenase; HET: FAD; 2.6A {Arthrobacter nicotinovorans} SCOP: c.3.1.2 d.16.1.2 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 64
d1y1pa1 342 c.2.1.2 (A:2-343) Aldehyde reductase II {Sporobolo 7e-18
d1xgka_ 350 c.2.1.2 (A:) Negative transcriptional regulator Nm 8e-14
d1rkxa_ 356 c.2.1.2 (A:) CDP-glucose-4,6-dehydratase {Yersinia 1e-11
d1rpna_ 321 c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Pseudomo 8e-11
d1n7ha_ 339 c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Thale-cr 1e-10
d1qyda_ 312 c.2.1.2 (A:) Pinoresinol-lariciresinol reductase { 4e-10
d1t2aa_ 347 c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Human (H 7e-10
d1db3a_ 357 c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Escheric 8e-10
d1hdoa_ 205 c.2.1.2 (A:) Biliverdin IX beta reductase {Human ( 1e-09
d1qyca_ 307 c.2.1.2 (A:) Phenylcoumaran benzylic ether reducta 2e-09
d1oc2a_ 346 c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) { 3e-09
d1z45a2 347 c.2.1.2 (A:11-357) Uridine diphosphogalactose-4-ep 7e-09
d1sb8a_ 341 c.2.1.2 (A:) UDP-N-acetylglucosamine 4-epimerase W 1e-08
d1i24a_ 393 c.2.1.2 (A:) Sulfolipid biosynthesis protein SQD1 2e-08
d2q46a1 252 c.2.1.2 (A:2-253) Hypothetical protein At5g02240 ( 4e-08
d2c5aa1 363 c.2.1.2 (A:13-375) GDP-mannose-3', 5'-epimerase {T 7e-08
d2blla1 342 c.2.1.2 (A:316-657) Polymyxin resistance protein A 1e-07
d2a35a1 212 c.2.1.2 (A:4-215) Hypothetical protein PA4017 {Pse 1e-07
d1eq2a_ 307 c.2.1.2 (A:) ADP-L-glycero-D-mannoheptose 6-epimer 2e-07
d1kewa_ 361 c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) { 2e-07
d1ek6a_ 346 c.2.1.2 (A:) Uridine diphosphogalactose-4-epimeras 2e-07
d2b69a1 312 c.2.1.2 (A:4-315) UDP-glucuronate decarboxylase 1 3e-07
d1orra_ 338 c.2.1.2 (A:) CDP-tyvelose-2-epimerase {Salmonella 3e-07
d1udca_ 338 c.2.1.2 (A:) Uridine diphosphogalactose-4-epimeras 4e-07
d2bkaa1 232 c.2.1.2 (A:5-236) TAT-interacting protein TIP30 {H 4e-07
d1vl0a_ 281 c.2.1.2 (A:) DTDP-4-dehydrorhamnose reductase RfbD 5e-07
d1r6da_ 322 c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) { 7e-07
d1e6ua_ 315 c.2.1.2 (A:) GDP-4-keto-6-deoxy-d-mannose epimeras 9e-07
d1n2sa_ 298 c.2.1.2 (A:) dTDP-6-deoxy-L-lyxo-4-hexulose reduct 2e-06
d1sbya1 254 c.2.1.2 (A:1-254) Drosophila alcohol dehydrogenase 1e-05
d1gy8a_ 383 c.2.1.2 (A:) Uridine diphosphogalactose-4-epimeras 5e-05
d1zk4a1 251 c.2.1.2 (A:1-251) R-specific alcohol dehydrogenase 2e-04
d2bgka1 268 c.2.1.2 (A:11-278) Rhizome secoisolariciresinol de 2e-04
d1uzma1 237 c.2.1.2 (A:9-245) beta-keto acyl carrier protein r 3e-04
d2o23a1 248 c.2.1.2 (A:6-253) Type II 3-hydroxyacyl-CoA dehydr 3e-04
d1h5qa_ 260 c.2.1.2 (A:) Mannitol dehydrogenase {Mushroom (Aga 4e-04
d1xu9a_ 269 c.2.1.2 (A:) 11-beta-hydroxysteroid dehydrogenase 4e-04
d1xhla_ 274 c.2.1.2 (A:) Hypothetical protein F25D1.5 {Caenorh 5e-04
d1xg5a_ 257 c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC41 5e-04
d1q7ba_ 243 c.2.1.2 (A:) beta-keto acyl carrier protein reduct 6e-04
d1xkqa_ 272 c.2.1.2 (A:) Hypothetical protein R05D8.7 {Caenorh 6e-04
d1k2wa_ 256 c.2.1.2 (A:) Sorbitol dehydrogenase {Rhodobacter s 6e-04
d1spxa_ 264 c.2.1.2 (A:) Glucose dehydrogenase (5l265) {Nemato 8e-04
d1geea_ 261 c.2.1.2 (A:) Glucose dehydrogenase {Bacillus megat 8e-04
d1g0oa_ 272 c.2.1.2 (A:) 1,3,8-trihydroxynaphtalene reductase 0.001
d1fmca_ 255 c.2.1.2 (A:) 7-alpha-hydroxysteroid dehydrogenase 0.001
d1gz6a_ 302 c.2.1.2 (A:) (3R)-hydroxyacyl-CoA dehydrogenase do 0.001
d1pr9a_ 244 c.2.1.2 (A:) Carbonyl reductase {Human (Homo sapie 0.001
d1dhra_ 236 c.2.1.2 (A:) Dihydropteridin reductase (pteridine 0.001
d1zema1 260 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconoba 0.001
d1ulsa_ 242 c.2.1.2 (A:) beta-keto acyl carrier protein reduct 0.002
d1bdba_ 276 c.2.1.2 (A:) Cis-biphenyl-2,3-dihydrodiol-2,3-dehy 0.002
d1cyda_ 242 c.2.1.2 (A:) Carbonyl reductase {Mouse (Mus muscul 0.002
d2ag5a1 245 c.2.1.2 (A:1-245) Dehydrogenase/reductase SDR fami 0.002
d1xq1a_ 259 c.2.1.2 (A:) Tropinone reductase {Thale cress (Ara 0.002
d1o5ia_ 234 c.2.1.2 (A:) beta-keto acyl carrier protein reduct 0.002
d1vl8a_ 251 c.2.1.2 (A:) Gluconate 5-dehydrogenase {Thermotoga 0.002
d1ydea1 250 c.2.1.2 (A:4-253) Retinal dehydrogenase/reductase 0.002
d2ae2a_ 259 c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datu 0.002
d1ae1a_ 258 c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datu 0.002
d1ja9a_ 259 c.2.1.2 (A:) 1,3,6,8-tetrahydroxynaphthalene reduc 0.002
d1yxma1 297 c.2.1.2 (A:7-303) Peroxisomal trans 2-enoyl CoA re 0.003
d1iy8a_ 258 c.2.1.2 (A:) Levodione reductase {Corynebacterium 0.003
d2a4ka1 241 c.2.1.2 (A:2-242) beta-keto acyl carrier protein r 0.003
d1nffa_ 244 c.2.1.2 (A:) Putative oxidoreductase Rv2002 {Mycob 0.003
d1yb1a_ 244 c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase 0.003
d1w6ua_ 294 c.2.1.2 (A:) 2,4-dienoyl-CoA reductase, mitochondr 0.003
d1hxha_ 253 c.2.1.2 (A:) 3beta/17beta hydroxysteroid dehydroge 0.003
d2c07a1 251 c.2.1.2 (A:54-304) beta-keto acyl carrier protein 0.004
d1yo6a1 250 c.2.1.2 (A:1-250) Putative carbonyl reductase snif 0.004
d1x1ta1 260 c.2.1.2 (A:1-260) D(-)-3-hydroxybutyrate dehydroge 0.004
d2gdza1 254 c.2.1.2 (A:3-256) 15-hydroxyprostaglandin dehydrog 0.004
>d1y1pa1 c.2.1.2 (A:2-343) Aldehyde reductase II {Sporobolomyces salmonicolor [TaxId: 5005]} Length = 342 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: NAD(P)-binding Rossmann-fold domains
superfamily: NAD(P)-binding Rossmann-fold domains
family: Tyrosine-dependent oxidoreductases
domain: Aldehyde reductase II
species: Sporobolomyces salmonicolor [TaxId: 5005]
 Score = 72.5 bits (176), Expect = 7e-18
 Identities = 18/61 (29%), Positives = 29/61 (47%), Gaps = 1/61 (1%)

Query: 4  KGKVVCVTGASGFIASWLVKLLLQRSYTVKATVRDLNN-HNAEHLLTLDGAEERLHLFKA 62
          +G +V VTGA+GF+AS +V+ LL+  Y V+ T R  +   N +                 
Sbjct: 10 EGSLVLVTGANGFVASHVVEQLLEHGYKVRGTARSASKLANLQKRWDAKYPGRFETAVVE 69

Query: 63 N 63
          +
Sbjct: 70 D 70


>d1xgka_ c.2.1.2 (A:) Negative transcriptional regulator NmrA {Aspergillus nidulans [TaxId: 162425]} Length = 350 Back     information, alignment and structure
>d1rkxa_ c.2.1.2 (A:) CDP-glucose-4,6-dehydratase {Yersinia pseudotuberculosis [TaxId: 633]} Length = 356 Back     information, alignment and structure
>d1rpna_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Pseudomonas aeruginosa [TaxId: 287]} Length = 321 Back     information, alignment and structure
>d1n7ha_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 339 Back     information, alignment and structure
>d1qyda_ c.2.1.2 (A:) Pinoresinol-lariciresinol reductase {Giant arborvitae (Thuja plicata) [TaxId: 3316]} Length = 312 Back     information, alignment and structure
>d1t2aa_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Human (Homo sapiens) [TaxId: 9606]} Length = 347 Back     information, alignment and structure
>d1db3a_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Escherichia coli [TaxId: 562]} Length = 357 Back     information, alignment and structure
>d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]} Length = 205 Back     information, alignment and structure
>d1qyca_ c.2.1.2 (A:) Phenylcoumaran benzylic ether reductase {Loblolly pine (Pinus taeda) [TaxId: 3352]} Length = 307 Back     information, alignment and structure
>d1oc2a_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} Length = 346 Back     information, alignment and structure
>d1z45a2 c.2.1.2 (A:11-357) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 347 Back     information, alignment and structure
>d1sb8a_ c.2.1.2 (A:) UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomonas aeruginosa [TaxId: 287]} Length = 341 Back     information, alignment and structure
>d1i24a_ c.2.1.2 (A:) Sulfolipid biosynthesis protein SQD1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 393 Back     information, alignment and structure
>d2q46a1 c.2.1.2 (A:2-253) Hypothetical protein At5g02240 (T7H20_290) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 252 Back     information, alignment and structure
>d2c5aa1 c.2.1.2 (A:13-375) GDP-mannose-3', 5'-epimerase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 363 Back     information, alignment and structure
>d2blla1 c.2.1.2 (A:316-657) Polymyxin resistance protein ArnA (PrmI) {Escherichia coli [TaxId: 562]} Length = 342 Back     information, alignment and structure
>d2a35a1 c.2.1.2 (A:4-215) Hypothetical protein PA4017 {Pseudomonas aeruginosa [TaxId: 287]} Length = 212 Back     information, alignment and structure
>d1eq2a_ c.2.1.2 (A:) ADP-L-glycero-D-mannoheptose 6-epimerase {Escherichia coli [TaxId: 562]} Length = 307 Back     information, alignment and structure
>d1kewa_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} Length = 361 Back     information, alignment and structure
>d1ek6a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Human (Homo sapiens) [TaxId: 9606]} Length = 346 Back     information, alignment and structure
>d2b69a1 c.2.1.2 (A:4-315) UDP-glucuronate decarboxylase 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 312 Back     information, alignment and structure
>d1orra_ c.2.1.2 (A:) CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 90370]} Length = 338 Back     information, alignment and structure
>d1udca_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Escherichia coli [TaxId: 562]} Length = 338 Back     information, alignment and structure
>d2bkaa1 c.2.1.2 (A:5-236) TAT-interacting protein TIP30 {Human (Homo sapiens) [TaxId: 9606]} Length = 232 Back     information, alignment and structure
>d1vl0a_ c.2.1.2 (A:) DTDP-4-dehydrorhamnose reductase RfbD {Clostridium acetobutylicum [TaxId: 1488]} Length = 281 Back     information, alignment and structure
>d1r6da_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptomyces venezuelae [TaxId: 54571]} Length = 322 Back     information, alignment and structure
>d1e6ua_ c.2.1.2 (A:) GDP-4-keto-6-deoxy-d-mannose epimerase/reductase (GDP-fucose synthetase) {Escherichia coli [TaxId: 562]} Length = 315 Back     information, alignment and structure
>d1n2sa_ c.2.1.2 (A:) dTDP-6-deoxy-L-lyxo-4-hexulose reductase (RmlD) {Salmonella enterica serovar typhimurium [TaxId: 90371]} Length = 298 Back     information, alignment and structure
>d1sbya1 c.2.1.2 (A:1-254) Drosophila alcohol dehydrogenase {Fly (Drosophila lebanonensis) [TaxId: 7225]} Length = 254 Back     information, alignment and structure
>d1gy8a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Trypanosoma brucei [TaxId: 5691]} Length = 383 Back     information, alignment and structure
>d1zk4a1 c.2.1.2 (A:1-251) R-specific alcohol dehydrogenase {Lactobacillus brevis [TaxId: 1580]} Length = 251 Back     information, alignment and structure
>d2bgka1 c.2.1.2 (A:11-278) Rhizome secoisolariciresinol dehydrogenase {Mayapple (Podophyllum peltatum) [TaxId: 35933]} Length = 268 Back     information, alignment and structure
>d1uzma1 c.2.1.2 (A:9-245) beta-keto acyl carrier protein reductase {Mycobacterium tuberculosis [TaxId: 1773]} Length = 237 Back     information, alignment and structure
>d2o23a1 c.2.1.2 (A:6-253) Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Length = 248 Back     information, alignment and structure
>d1h5qa_ c.2.1.2 (A:) Mannitol dehydrogenase {Mushroom (Agaricus bisporus) [TaxId: 5341]} Length = 260 Back     information, alignment and structure
>d1xu9a_ c.2.1.2 (A:) 11-beta-hydroxysteroid dehydrogenase 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 269 Back     information, alignment and structure
>d1xhla_ c.2.1.2 (A:) Hypothetical protein F25D1.5 {Caenorhabditis elegans [TaxId: 6239]} Length = 274 Back     information, alignment and structure
>d1xg5a_ c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC4172) {Human (Homo sapiens) [TaxId: 9606]} Length = 257 Back     information, alignment and structure
>d1q7ba_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Escherichia coli [TaxId: 562]} Length = 243 Back     information, alignment and structure
>d1xkqa_ c.2.1.2 (A:) Hypothetical protein R05D8.7 {Caenorhabditis elegans [TaxId: 6239]} Length = 272 Back     information, alignment and structure
>d1k2wa_ c.2.1.2 (A:) Sorbitol dehydrogenase {Rhodobacter sphaeroides [TaxId: 1063]} Length = 256 Back     information, alignment and structure
>d1spxa_ c.2.1.2 (A:) Glucose dehydrogenase (5l265) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 264 Back     information, alignment and structure
>d1geea_ c.2.1.2 (A:) Glucose dehydrogenase {Bacillus megaterium [TaxId: 1404]} Length = 261 Back     information, alignment and structure
>d1g0oa_ c.2.1.2 (A:) 1,3,8-trihydroxynaphtalene reductase (THNR, naphtol reductase) {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Length = 272 Back     information, alignment and structure
>d1fmca_ c.2.1.2 (A:) 7-alpha-hydroxysteroid dehydrogenase {Escherichia coli [TaxId: 562]} Length = 255 Back     information, alignment and structure
>d1gz6a_ c.2.1.2 (A:) (3R)-hydroxyacyl-CoA dehydrogenase domain of estradiol 17 beta-Dehydrogenase 4 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 302 Back     information, alignment and structure
>d1pr9a_ c.2.1.2 (A:) Carbonyl reductase {Human (Homo sapiens) [TaxId: 9606]} Length = 244 Back     information, alignment and structure
>d1dhra_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 236 Back     information, alignment and structure
>d1zema1 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconobacter oxydans [TaxId: 442]} Length = 260 Back     information, alignment and structure
>d1ulsa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermus thermophilus [TaxId: 274]} Length = 242 Back     information, alignment and structure
>d1bdba_ c.2.1.2 (A:) Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Pseudomonas sp., lb400 [TaxId: 306]} Length = 276 Back     information, alignment and structure
>d1cyda_ c.2.1.2 (A:) Carbonyl reductase {Mouse (Mus musculus) [TaxId: 10090]} Length = 242 Back     information, alignment and structure
>d2ag5a1 c.2.1.2 (A:1-245) Dehydrogenase/reductase SDR family member 6, DHRS6 {Human (Homo sapiens) [TaxId: 9606]} Length = 245 Back     information, alignment and structure
>d1xq1a_ c.2.1.2 (A:) Tropinone reductase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 259 Back     information, alignment and structure
>d1o5ia_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermotoga maritima [TaxId: 2336]} Length = 234 Back     information, alignment and structure
>d1vl8a_ c.2.1.2 (A:) Gluconate 5-dehydrogenase {Thermotoga maritima [TaxId: 2336]} Length = 251 Back     information, alignment and structure
>d1ydea1 c.2.1.2 (A:4-253) Retinal dehydrogenase/reductase 3 {Human (Homo sapiens) [TaxId: 9606]} Length = 250 Back     information, alignment and structure
>d2ae2a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), II [TaxId: 4076]} Length = 259 Back     information, alignment and structure
>d1ae1a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), I [TaxId: 4076]} Length = 258 Back     information, alignment and structure
>d1ja9a_ c.2.1.2 (A:) 1,3,6,8-tetrahydroxynaphthalene reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Length = 259 Back     information, alignment and structure
>d1yxma1 c.2.1.2 (A:7-303) Peroxisomal trans 2-enoyl CoA reductase {Human (Homo sapiens) [TaxId: 9606]} Length = 297 Back     information, alignment and structure
>d1iy8a_ c.2.1.2 (A:) Levodione reductase {Corynebacterium aquaticum [TaxId: 144185]} Length = 258 Back     information, alignment and structure
>d2a4ka1 c.2.1.2 (A:2-242) beta-keto acyl carrier protein reductase {Thermus thermophilus, TTHB020 [TaxId: 274]} Length = 241 Back     information, alignment and structure
>d1nffa_ c.2.1.2 (A:) Putative oxidoreductase Rv2002 {Mycobacterium tuberculosis [TaxId: 1773]} Length = 244 Back     information, alignment and structure
>d1yb1a_ c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase type XI {Human (Homo sapiens) [TaxId: 9606]} Length = 244 Back     information, alignment and structure
>d1w6ua_ c.2.1.2 (A:) 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {Human (Homo sapiens), [TaxId: 9606]} Length = 294 Back     information, alignment and structure
>d1hxha_ c.2.1.2 (A:) 3beta/17beta hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Length = 253 Back     information, alignment and structure
>d2c07a1 c.2.1.2 (A:54-304) beta-keto acyl carrier protein reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Length = 251 Back     information, alignment and structure
>d1yo6a1 c.2.1.2 (A:1-250) Putative carbonyl reductase sniffer {Caenorhabditis elegans [TaxId: 6239]} Length = 250 Back     information, alignment and structure
>d1x1ta1 c.2.1.2 (A:1-260) D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas fragi [TaxId: 296]} Length = 260 Back     information, alignment and structure
>d2gdza1 c.2.1.2 (A:3-256) 15-hydroxyprostaglandin dehydrogenase, PGDH {Human (Homo sapiens) [TaxId: 9606]} Length = 254 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query64
d1fmca_ 255 7-alpha-hydroxysteroid dehydrogenase {Escherichia 99.6
d2ae2a_ 259 Tropinone reductase {Jimsonweed (Datura stramonium 99.59
d1h5qa_ 260 Mannitol dehydrogenase {Mushroom (Agaricus bisporu 99.59
d1ae1a_ 258 Tropinone reductase {Jimsonweed (Datura stramonium 99.58
d2c07a1 251 beta-keto acyl carrier protein reductase {Malaria 99.57
d1yb1a_ 244 17-beta-hydroxysteroid dehydrogenase type XI {Huma 99.57
d1xq1a_ 259 Tropinone reductase {Thale cress (Arabidopsis thal 99.56
d1k2wa_ 256 Sorbitol dehydrogenase {Rhodobacter sphaeroides [T 99.55
d1zema1 260 Xylitol dehydrogenase {Gluconobacter oxydans [TaxI 99.54
d1sbya1 254 Drosophila alcohol dehydrogenase {Fly (Drosophila 99.53
d1cyda_ 242 Carbonyl reductase {Mouse (Mus musculus) [TaxId: 1 99.52
d1xkqa_ 272 Hypothetical protein R05D8.7 {Caenorhabditis elega 99.52
d1g0oa_ 272 1,3,8-trihydroxynaphtalene reductase (THNR, naphto 99.52
d1vl8a_ 251 Gluconate 5-dehydrogenase {Thermotoga maritima [Ta 99.52
d1geea_ 261 Glucose dehydrogenase {Bacillus megaterium [TaxId: 99.52
d1xg5a_ 257 Putative dehydrogenase ARPG836 (MGC4172) {Human (H 99.52
d1bdba_ 276 Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Ps 99.52
d2rhca1 257 beta-keto acyl carrier protein reductase {Streptom 99.51
d1rpna_ 321 GDP-mannose 4,6-dehydratase {Pseudomonas aeruginos 99.51
d1ja9a_ 259 1,3,6,8-tetrahydroxynaphthalene reductase {Rice bl 99.51
d1spxa_ 264 Glucose dehydrogenase (5l265) {Nematode (Caenorhab 99.51
d1pr9a_ 244 Carbonyl reductase {Human (Homo sapiens) [TaxId: 9 99.5
d1xhla_ 274 Hypothetical protein F25D1.5 {Caenorhabditis elega 99.5
d1ulsa_ 242 beta-keto acyl carrier protein reductase {Thermus 99.5
d2ew8a1 247 (s)-1-phenylethanol dehydrogenase {Azoarcus sp. eb 99.49
d1rkxa_ 356 CDP-glucose-4,6-dehydratase {Yersinia pseudotuberc 99.49
d1gega_ 255 meso-2,3-butanediol dehydrogenase {Klebsiella pneu 99.49
d1snya_ 248 Carbonyl reductase sniffer {Fruit fly (Drosophila 99.49
d2gdza1 254 15-hydroxyprostaglandin dehydrogenase, PGDH {Human 99.48
d1zk4a1 251 R-specific alcohol dehydrogenase {Lactobacillus br 99.48
d1w6ua_ 294 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {H 99.47
d1iy8a_ 258 Levodione reductase {Corynebacterium aquaticum [Ta 99.47
d2bgka1 268 Rhizome secoisolariciresinol dehydrogenase {Mayapp 99.47
d1hdca_ 254 3-alpha,20-beta-hydroxysteroid dehydrogenase {Stre 99.47
d1nffa_ 244 Putative oxidoreductase Rv2002 {Mycobacterium tube 99.45
d1q7ba_ 243 beta-keto acyl carrier protein reductase {Escheric 99.45
d2o23a1 248 Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Ho 99.44
d1yxma1 297 Peroxisomal trans 2-enoyl CoA reductase {Human (Ho 99.44
d1hdoa_ 205 Biliverdin IX beta reductase {Human (Homo sapiens) 99.43
d2a4ka1 241 beta-keto acyl carrier protein reductase {Thermus 99.43
d1x1ta1 260 D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas 99.43
d1xu9a_ 269 11-beta-hydroxysteroid dehydrogenase 1 {Human (Hom 99.42
d1orra_ 338 CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 99.42
d1ydea1 250 Retinal dehydrogenase/reductase 3 {Human (Homo sap 99.42
d1ulua_ 256 Enoyl-ACP reductase {Thermus thermophilus [TaxId: 99.41
d1yo6a1 250 Putative carbonyl reductase sniffer {Caenorhabditi 99.39
d1udca_ 338 Uridine diphosphogalactose-4-epimerase (UDP-galact 99.39
d1oaaa_ 259 Sepiapterin reductase {Mouse (Mus musculus) [TaxId 99.39
d1wmaa1 275 Carbonyl reductase/20beta-hydroxysteroid dehydroge 99.39
d1t2aa_ 347 GDP-mannose 4,6-dehydratase {Human (Homo sapiens) 99.39
d1hxha_ 253 3beta/17beta hydroxysteroid dehydrogenase {Comamon 99.38
d1ek6a_ 346 Uridine diphosphogalactose-4-epimerase (UDP-galact 99.38
d1uzma1 237 beta-keto acyl carrier protein reductase {Mycobact 99.37
d1edoa_ 244 beta-keto acyl carrier protein reductase {Oil seed 99.37
d1y1pa1 342 Aldehyde reductase II {Sporobolomyces salmonicolor 99.36
d1n7ha_ 339 GDP-mannose 4,6-dehydratase {Thale-cress (Arabidop 99.36
d1xgka_ 350 Negative transcriptional regulator NmrA {Aspergill 99.36
d2ag5a1 245 Dehydrogenase/reductase SDR family member 6, DHRS6 99.35
d1db3a_ 357 GDP-mannose 4,6-dehydratase {Escherichia coli [Tax 99.35
d1qyda_ 312 Pinoresinol-lariciresinol reductase {Giant arborvi 99.34
d2fr1a1 259 Erythromycin synthase, eryAI, 1st ketoreductase mo 99.33
d1kewa_ 361 dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus 99.33
d1o5ia_ 234 beta-keto acyl carrier protein reductase {Thermoto 99.33
d2bd0a1 240 Bacterial sepiapterin reductase {Chlorobium tepidu 99.33
d1luaa1 191 Methylene-tetrahydromethanopterin dehydrogenase {M 99.33
d2d1ya1 248 Hypothetical protein TTHA0369 {Thermus thermophilu 99.33
d1qyca_ 307 Phenylcoumaran benzylic ether reductase {Loblolly 99.32
d1oc2a_ 346 dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus 99.32
d2pd4a1 274 Enoyl-ACP reductase {Helicobacter pylori [TaxId: 2 99.32
d2c5aa1 363 GDP-mannose-3', 5'-epimerase {Thale cress (Arabido 99.31
d1z45a2 347 Uridine diphosphogalactose-4-epimerase (UDP-galact 99.3
d2blla1 342 Polymyxin resistance protein ArnA (PrmI) {Escheric 99.3
d1i24a_ 393 Sulfolipid biosynthesis protein SQD1 {Thale cress 99.3
d1sb8a_ 341 UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomo 99.27
d1qsga_ 258 Enoyl-ACP reductase {Escherichia coli [TaxId: 562] 99.26
d1jtva_ 285 Human estrogenic 17beta-hydroxysteroid dehydrogena 99.2
d2b69a1 312 UDP-glucuronate decarboxylase 1 {Human (Homo sapie 99.2
d1gz6a_ 302 (3R)-hydroxyacyl-CoA dehydrogenase domain of estra 99.19
d2h7ma1 268 Enoyl-ACP reductase {Mycobacterium tuberculosis, T 99.18
d1uaya_ 241 Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus t 99.18
d2q46a1 252 Hypothetical protein At5g02240 (T7H20_290) {Thale 99.18
d1mxha_ 266 Dihydropteridin reductase (pteridine reductase) {T 99.17
d1fjha_ 257 3-alpha-hydroxysteroid dehydrogenase {Comamonas te 99.16
d2bkaa1 232 TAT-interacting protein TIP30 {Human (Homo sapiens 99.14
d1ooea_ 235 Dihydropteridin reductase (pteridine reductase) {N 99.12
d1e7wa_ 284 Dihydropteridin reductase (pteridine reductase) {L 99.12
d1dhra_ 236 Dihydropteridin reductase (pteridine reductase) {R 99.11
d1vl0a_ 281 DTDP-4-dehydrorhamnose reductase RfbD {Clostridium 99.1
d1r6da_ 322 dTDP-glucose 4,6-dehydratase (RmlB) {Streptomyces 99.06
d1d7oa_ 297 Enoyl-ACP reductase {Oil seed rape (Brassica napus 99.06
d1jaya_ 212 Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archae 99.02
d2a35a1 212 Hypothetical protein PA4017 {Pseudomonas aeruginos 98.98
d1gy8a_ 383 Uridine diphosphogalactose-4-epimerase (UDP-galact 98.96
d1e6ua_ 315 GDP-4-keto-6-deoxy-d-mannose epimerase/reductase ( 98.93
d1zmta1 252 Halohydrin dehalogenase HheC {Agrobacterium tumefa 98.79
d1eq2a_ 307 ADP-L-glycero-D-mannoheptose 6-epimerase {Escheric 98.75
d1n2sa_ 298 dTDP-6-deoxy-L-lyxo-4-hexulose reductase (RmlD) {S 98.66
d1e5qa1 182 Saccharopine reductase {Rice blast fungus (Magnapo 98.57
d1lssa_132 Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax 98.57
d1uh5a_ 329 Enoyl-ACP reductase {Malaria parasite (Plasmodium 98.52
d2pv7a2152 Prephenate dehydrogenase TyrA {Haemophilus influen 98.48
d1o8ca277 Hypothetical protein YhdH {Escherichia coli [TaxId 98.46
d1ks9a2 167 Ketopantoate reductase PanE {Escherichia coli [Tax 98.27
d2jfga193 UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 98.06
d2hmva1134 Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} 98.02
d1f0ya2 192 Short chain L-3-hydroxyacyl CoA dehydrogenase {Hum 97.94
d1tt7a2167 Hypothetical protein YhfP {Bacillus subtilis [TaxI 97.93
d1iz0a2171 Quinone oxidoreductase {Thermus thermophilus [TaxI 97.91
d1nyta1170 Shikimate 5-dehydrogenase AroE {Escherichia coli [ 97.9
d1xa0a2176 B. subtilis YhfP homologue {Bacillus stearothermop 97.9
d1o89a2177 Hypothetical protein YhdH {Escherichia coli [TaxId 97.9
d1yb5a2174 Quinone oxidoreductase {Human (Homo sapiens) [TaxI 97.85
d1bg6a2 184 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A 97.79
d1v3va2182 Leukotriene b4 12-hydroxydehydrogenase/prostagland 97.77
d2f1ka2 165 Prephenate dehydrogenase TyrA {Synechocystis sp. p 97.77
d1id1a_153 Rck domain from putative potassium channel Kch {Es 97.71
d1pqwa_183 Putative enoyl reductase domain of polyketide synt 97.67
d1qora2179 Quinone oxidoreductase {Escherichia coli [TaxId: 5 97.65
d1piwa2168 Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas 97.54
d1wdka3 186 Fatty oxidation complex alpha subunit, middle doma 97.54
d1c0pa1 268 D-aminoacid oxidase, N-terminal domain {Rhodotorul 97.53
d1p77a1171 Shikimate 5-dehydrogenase AroE {Haemophilus influe 97.51
d1txga2 180 Glycerol-3- phosphate dehydrogenase {Archaeoglobus 97.51
d1pzga1154 Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5 97.49
d1pjqa1113 Siroheme synthase CysG, domain 1 {Salmonella typhi 97.48
d1ez4a1146 Lactate dehydrogenase {Lactobacillus pentosus [Tax 97.48
d1n1ea2 189 Glycerol-3- phosphate dehydrogenase {Trypanosome ( 97.47
d1kyqa1150 Bifunctional dehydrogenase/ferrochelatase Met8p, N 97.46
d1hyea1145 MJ0490, lactate/malate dehydrogenase {Archaeon Met 97.45
d1vi2a1 182 Putative shikimate dehydrogenase YdiB {Escherichia 97.4
d2cvoa1 183 Putative semialdehyde dehydrogenase {Rice (Oryza s 97.34
d2g17a1 179 N-acetyl-gamma-glutamyl-phosphate reductase ArgC { 97.34
d1gpja2159 Glutamyl tRNA-reductase middle domain {Archaeon Me 97.33
d2pgda2 176 6-phosphogluconate dehydrogenase {Sheep (Ovis orie 97.31
d1npya1167 Shikimate 5-dehydrogenase-like protein HI0607 {Hae 97.29
d1llua2166 Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax 97.27
d1vpda2 161 Hydroxyisobutyrate dehydrogenase {Salmonella typhi 97.27
d1vj0a2182 Hypothetical protein TM0436 {Thermotoga maritima [ 97.26
d3cuma2 162 Hydroxyisobutyrate dehydrogenase {Pseudomonas aeru 97.25
d1vm6a3128 Dihydrodipicolinate reductase {Thermotoga maritima 97.24
d1guza1142 Malate dehydrogenase {Chlorobium vibrioforme [TaxI 97.23
d1uufa2168 Hypothetical protein YahK {Escherichia coli [TaxId 97.23
d1t4ba1146 Aspartate beta-semialdehyde dehydrogenase {Escheri 97.21
d1e3ja2170 Ketose reductase (sorbitol dehydrogenase) {Silverl 97.2
d2hjsa1144 Usg-1 protein homolog PA3116 {Pseudomonas aerugino 97.2
d1mv8a2 202 GDP-mannose 6-dehydrogenase {Pseudomonas aeruginos 97.19
d1v59a2122 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 97.18
d1c1da1 201 Phenylalanine dehydrogenase {Rhodococcus sp., M4 [ 97.17
d1pgja2 178 6-phosphogluconate dehydrogenase {Trypanosoma bruc 97.17
d1ebda2117 Dihydrolipoamide dehydrogenase {Bacillus stearothe 97.13
d1vkna1 176 N-acetyl-gamma-glutamyl-phosphate reductase ArgC { 97.11
d1yqga2152 Pyrroline-5-carboxylate reductase ProC {Neisseria 97.11
d1djqa2156 Trimethylamine dehydrogenase, C-terminal domain {M 97.07
d1ldna1148 Lactate dehydrogenase {Bacillus stearothermophilus 97.07
d1i36a2152 Conserved hypothetical protein MTH1747 {Archaeon M 97.06
d1r0ka2150 1-deoxy-D-xylulose-5-phosphate reductoisomerase {Z 97.05
d1gu7a2189 2,4-dienoyl-CoA reductase {Yeast (Candida tropical 97.03
d1mb4a1147 Aspartate beta-semialdehyde dehydrogenase {Vibrio 97.02
d1ihua2 279 Arsenite-translocating ATPase ArsA {Escherichia co 96.99
d3lada2119 Dihydrolipoamide dehydrogenase {Azotobacter vinela 96.95
d7mdha1175 Malate dehydrogenase {Sorghum (Sorghum vulgare), c 96.94
d1y7ta1154 Malate dehydrogenase {Thermus thermophilus [TaxId: 96.93
d1pl8a2171 Ketose reductase (sorbitol dehydrogenase) {Human ( 96.93
d1y6ja1142 Lactate dehydrogenase {Clostridium thermocellum [T 96.93
d1h6va2122 Mammalian thioredoxin reductase {Rat (Rattus norve 96.91
d1mlda1144 Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 96.91
d2gz1a1154 Aspartate beta-semialdehyde dehydrogenase {Strepto 96.91
d2g5ca2 171 Prephenate dehydrogenase TyrA {Aquifex aeolicus [T 96.86
d1jvba2170 Alcohol dehydrogenase {Archaeon Sulfolobus solfata 96.85
d2ivda1 347 Protoporphyrinogen oxidase {Myxococcus xanthus [Ta 96.83
d1gesa2116 Glutathione reductase {Escherichia coli [TaxId: 56 96.8
d1dxla2123 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 96.79
d1ps9a3179 2,4-dienoyl-CoA reductase, middle domain {Escheric 96.76
d2voua1 265 Dihydroxypyridine hydroxylase DhpH {Arthrobacter n 96.75
d1cp2a_ 269 Nitrogenase iron protein {Clostridium pasteurianum 96.74
d3grsa2125 Glutathione reductase {Human (Homo sapiens) [TaxId 96.74
d2jhfa2176 Alcohol dehydrogenase {Horse (Equus caballus) [Tax 96.73
d1onfa2117 Glutathione reductase {Plasmodium falciparum [TaxI 96.72
d1vj1a2187 Putative zinc-binding alcohol dehydrogenase {Mouse 96.69
d1nhpa2123 NADH peroxidase {Enterococcus faecalis [TaxId: 135 96.69
d1d7ya2121 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 96.68
d1d1ta2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 96.68
d1lvla2115 Dihydrolipoamide dehydrogenase {Pseudomonas putida 96.67
d2cmda1145 Malate dehydrogenase {Escherichia coli [TaxId: 562 96.66
d1hyha1146 L-2-hydroxyisocapronate dehydrogenase, L-HICDH {La 96.65
d1j6ua189 UDP-N-acetylmuramate-alanine ligase MurC {Thermoto 96.64
d1rjwa2168 Alcohol dehydrogenase {Bacillus stearothermophilus 96.63
d2bcgg1 297 Guanine nucleotide dissociation inhibitor, GDI {Ba 96.62
d1p3da196 UDP-N-acetylmuramate-alanine ligase MurC {Haemophi 96.58
d2ldxa1159 Lactate dehydrogenase {Mouse (Mus musculus) [TaxId 96.57
d1q0qa2151 1-deoxy-D-xylulose-5-phosphate reductoisomerase {E 96.56
d5mdha1154 Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 96.56
d1a5za1140 Lactate dehydrogenase {Thermotoga maritima [TaxId: 96.55
d1u7za_ 223 Coenzyme A biosynthesis bifunctional protein CoaBC 96.54
d1seza1 373 Protoporphyrinogen oxidase {Tobacco (Nicotiana tab 96.53
d1ojta2125 Dihydrolipoamide dehydrogenase {Neisseria meningit 96.51
d2bi7a1 314 UDP-galactopyranose mutase, N-terminal domain {Kle 96.5
d1kjqa2111 Glycinamide ribonucleotide transformylase PurT, N- 96.49
d1ryia1 276 Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} 96.47
d1gtea4 196 Dihydropyrimidine dehydrogenase, domain 2 {Pig (Su 96.46
d1xhca2122 NADH oxidase /nitrite reductase {Pyrococcus furios 96.45
d1uxja1142 Malate dehydrogenase {Chloroflexus aurantiacus [Ta 96.45
d1ojua1142 Malate dehydrogenase {Archaeon Archaeoglobus fulgi 96.44
d1g3qa_ 237 Cell division regulator MinD {Archaeon Pyrococcus 96.42
d1p0fa2174 Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 96.41
d2iida1 370 L-aminoacid oxidase {Malayan pit viper (Calloselas 96.4
d1o6za1142 Malate dehydrogenase {Archaeon Haloarcula marismor 96.38
d1d5ta1 336 Guanine nucleotide dissociation inhibitor, GDI {Co 96.37
d1q1ra2133 Putidaredoxin reductase {Pseudomonas putida [TaxId 96.36
d2ahra2152 Pyrroline-5-carboxylate reductase ProC {Streptococ 96.35
d1li4a1163 S-adenosylhomocystein hydrolase {Human (Homo sapie 96.32
d1dlja2 196 UDP-glucose dehydrogenase (UDPGDH) {Streptococcus 96.31
d1byia_ 224 Dethiobiotin synthetase {Escherichia coli [TaxId: 96.31
d1llda1143 Lactate dehydrogenase {Bifidobacterium longum, str 96.31
d1jw9b_ 247 Molybdenum cofactor biosynthesis protein MoeB {Esc 96.31
d1jqba2174 Bacterial secondary alcohol dehydrogenase {Clostri 96.27
d1a4ia1170 Methylenetetrahydrofolate dehydrogenase/cyclohydro 96.26
d1t2da1150 Lactate dehydrogenase {Malaria parasite (Plasmodiu 96.23
d1f0ka_ 351 Peptidoglycan biosynthesis glycosyltransferase Mur 96.23
d1b0aa1166 Methylenetetrahydrofolate dehydrogenase/cyclohydro 96.23
d1p9oa_ 290 Phosphopantothenoylcysteine synthetase {Human (Hom 96.19
d1nvta1 177 Shikimate 5-dehydrogenase AroE {Archaeon Methanoco 96.16
d1qp8a1181 Putative formate dehydrogenase {Archaeon Pyrobacul 96.16
d1yl7a1135 Dihydrodipicolinate reductase {Mycobacterium tuber 96.12
d1edza1171 Methylenetetrahydrofolate dehydrogenase/cyclohydro 96.09
d1mo9a2121 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 96.06
d1v9la1 242 Glutamate dehydrogenase {Pyrobaculum islandicum [T 96.06
d1hyqa_ 232 Cell division regulator MinD {Archaeon Archaeoglob 96.06
d1k0ia1 292 p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas a 96.0
d1a9xa3127 Carbamoyl phosphate synthetase (CPS), large subuni 95.91
d1e3ia2174 Alcohol dehydrogenase {Mouse (Mus musculus), class 95.86
d1hwxa1 293 Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: 95.83
d1leha1 230 Leucine dehydrogenase {Bacillus sphaericus [TaxId: 95.81
d1i0za1160 Lactate dehydrogenase {Human (Homo sapiens), heart 95.8
d2fzwa2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 95.8
d2dw4a2 449 Lysine-specific histone demethylase 1, LSD1 {Human 95.77
d1bgva1 255 Glutamate dehydrogenase {Clostridium symbiosum [Ta 95.77
d1djqa3 233 Trimethylamine dehydrogenase, middle domain {Methy 95.76
d1pj5a2 305 N,N-dimethylglycine oxidase {Arthrobacter globifor 95.75
d1f8fa2174 Benzyl alcohol dehydrogenase {Acinetobacter calcoa 95.74
d1diha1162 Dihydrodipicolinate reductase {Escherichia coli [T 95.67
d2afhe1 289 Nitrogenase iron protein {Azotobacter vinelandii [ 95.65
d1dxya1199 D-2-hydroxyisocaproate dehydrogenase {Lactobacillu 95.65
d2fy8a1129 Potassium channel-related protein MthK {Archaeon M 95.63
d1a9xa4121 Carbamoyl phosphate synthetase (CPS), large subuni 95.6
d1kola2 195 Formaldehyde dehydrogenase {Pseudomonas putida [Ta 95.54
d1j4aa1197 D-lactate dehydrogenase {Lactobacillus helveticus 95.48
d1h2ba2172 Alcohol dehydrogenase {Archaeon Aeropyrum pernix [ 95.35
d1mx3a1193 Transcription corepressor CtbP {Human (Homo sapien 95.28
d2gf3a1 281 Sarcosine oxidase {Bacillus sp., strain b0618 [Tax 95.25
d1yovb1 426 UBA3 {Human (Homo sapiens) [TaxId: 9606]} 95.25
d3c96a1 288 Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 95.19
d2gv8a1 335 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 95.12
d2d59a1139 Hypothetical protein PH1109 {Pyrococcus horikoshii 95.08
d1cdoa2175 Alcohol dehydrogenase {Cod (Gadus callarias) [TaxI 95.02
d1ihua1 296 Arsenite-translocating ATPase ArsA {Escherichia co 95.0
d1ygya1184 Phosphoglycerate dehydrogenase {Mycobacterium tube 95.0
d2f5va1 379 Pyranose 2-oxidase {White-rot fungus (Peniophora s 94.93
d1fcda1 186 Flavocytochrome c sulfide dehydrogenase, FCSD, fla 94.78
d1i8ta1 298 UDP-galactopyranose mutase, N-terminal domain {Esc 94.64
d1b5qa1 347 Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} 94.63
d2bisa1 437 Glycogen synthase 1, GlgA {Pyrococcus abyssi [TaxI 94.49
d2gqfa1 253 Hypothetical protein HI0933 {Haemophilus influenza 94.46
d1aoga2117 Trypanothione reductase {Trypanosoma cruzi [TaxId: 94.43
d1y81a1116 Hypothetical protein PF0725 {Pyrococcus furiosus [ 94.42
d1m6ya2 192 TM0872, methyltransferase domain {Thermotoga marit 94.36
d1gesa1 217 Glutathione reductase {Escherichia coli [TaxId: 56 94.3
d1rp0a1 278 Thiazole biosynthetic enzyme Thi4 {Thale cress(Ara 94.27
d2naca1188 Formate dehydrogenase {Pseudomonas sp., strain 101 94.15
d1sc6a1188 Phosphoglycerate dehydrogenase {Escherichia coli [ 93.89
d1y8ca_ 246 Putative methyltransferase CAC2371 {Clostridium ac 93.86
d1q1ra1 185 Putidaredoxin reductase {Pseudomonas putida [TaxId 93.77
d2v5za1 383 Monoamine oxidase B {Human (Homo sapiens) [TaxId: 93.7
d1d7ya1 183 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 93.68
d1nhpa1 198 NADH peroxidase {Enterococcus faecalis [TaxId: 135 93.67
d1cjca2 230 Adrenodoxin reductase of mitochondrial p450 system 93.58
d1pjza_ 201 Thiopurine S-methyltransferase {Pseudomonas syring 93.43
d1vdca1 192 Thioredoxin reductase {Mouse-ear cress (Arabidopsi 93.24
d2i0za1 251 Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396] 93.12
d1gtma1 239 Glutamate dehydrogenase {Archaeon Pyrococcus furio 93.02
d1gdha1191 D-glycerate dehydrogenase {Hyphomicrobium methylov 92.92
d1v8ba1163 S-adenosylhomocystein hydrolase {Plasmodium falcip 92.9
d1dxla1 221 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 92.89
d1yova1 529 Amyloid beta precursor protein-binding protein 1, 92.87
d1wzna1 251 Hypothetical methyltransferase PH1305 {Archaeon Py 92.8
d1pn0a1 360 Phenol hydroxylase {Soil-living yeast (Trichosporo 92.67
d3grsa1 221 Glutathione reductase {Human (Homo sapiens) [TaxId 92.63
d1n4wa1 367 Cholesterol oxidase of GMC family {Streptomyces sp 92.63
d1b26a1 234 Glutamate dehydrogenase {Thermotoga maritima [TaxI 92.59
d2fyta1 311 Protein arginine N-methyltransferase 3, PRMT3 {Hum 92.58
d1kifa1 246 D-aminoacid oxidase, N-terminal domain {Pig (Sus s 92.41
d2blna2 203 Polymyxin resistance protein ArnA, N-terminal doma 92.37
d1w4xa1 298 Phenylacetone monooxygenase {Thermobifida fusca [T 92.21
d1y0pa2 308 Flavocytochrome c3 (respiratory fumarate reductase 92.18
d1ve3a1 226 Hypothetical protein PH0226 {Archaeon Pyrococcus h 92.03
d2cvza2156 Hydroxyisobutyrate dehydrogenase {Thermus thermoph 92.02
d1f06a1 170 Diaminopimelic acid dehydrogenase (DAPDH) {Coryneb 92.01
d1rzua_ 477 Glycogen synthase 1, GlgA {Agrobacterium tumefacie 91.95
d1pn3a_ 391 TDP-epi-vancosaminyltransferase GtfA {Amycolatopsi 91.89
d2i76a2153 Hypothetical protein TM1727 {Thermotoga maritima [ 91.86
d2csua1129 Acetate-CoA ligase alpha chain, AcdA, N-terminal d 91.81
d1lqta2 239 Ferredoxin:NADP reductase FprA {Mycobacterium tube 91.55
d2bw0a2 203 10-formyltetrahydrofolate dehydrogenase domain 1 { 91.11
d1oria_ 316 Protein arginine N-methyltransferase 1, PRMT1 {Rat 91.08
d1trba1 190 Thioredoxin reductase {Escherichia coli [TaxId: 56 91.08
d3etja278 N5-carboxyaminoimidazole ribonucleotide synthetase 91.08
d1v59a1 233 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 90.92
d2gv8a2107 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 90.89
d1d4ca2 322 Flavocytochrome c3 (respiratory fumarate reductase 90.59
d1iuka_136 Hypothetical protein TT1466 {Thermus thermophilus 90.59
d1iira_ 401 UDP-glucosyltransferase GtfB {Amycolatopsis orient 90.43
d2i3ba1 189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 90.29
d2bzga1 229 Thiopurine S-methyltransferase {Human (Homo sapien 90.25
d1pvva2163 Ornithine transcarbamoylase {Archaeon Pyrococcus f 89.97
d1fl2a2126 Alkyl hydroperoxide reductase subunit F (AhpF), C- 89.84
d1rrva_ 401 TDP-vancosaminyltransferase GftD {Amycolatopsis or 89.8
d1m6ia2137 Apoptosis-inducing factor (AIF) {Human (Homo sapie 89.8
d3coxa1 370 Cholesterol oxidase of GMC family {Brevibacterium 89.72
d1ebda1 223 Dihydrolipoamide dehydrogenase {Bacillus stearothe 89.69
d1feca2117 Trypanothione reductase {Crithidia fasciculata [Ta 89.62
d1iowa196 D-Ala-D-Ala ligase, N-domain {Escherichia coli, ge 89.59
d1jg1a_215 Protein-L-isoaspartyl O-methyltransferase {Archaeo 89.57
d1lvla1 220 Dihydrolipoamide dehydrogenase {Pseudomonas putida 89.49
d3lada1 229 Dihydrolipoamide dehydrogenase {Azotobacter vinela 89.48
d2gh1a1 281 Methyltransferase BC2162 {Bacillus cereus [TaxId: 89.36
d1xhca1 167 NADH oxidase /nitrite reductase {Pyrococcus furios 89.33
d1nvmb1157 Acetaldehyde dehydrogenase (acylating) {Pseudomona 89.32
d2gmha1 380 Electron transfer flavoprotein-ubiquinone oxidored 89.31
d1vdca2130 Thioredoxin reductase {Mouse-ear cress (Arabidopsi 89.3
d1mo9a1 261 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 89.21
d2nu7a1119 Succinyl-CoA synthetase, alpha-chain, N-terminal ( 89.14
d1l7da1183 Nicotinamide nucleotide transhydrogenase dI compon 89.12
d1vl5a_ 231 Hypothetical protein BH2331 {Bacillus halodurans [ 88.96
d2bs2a2 336 Fumarate reductase {Wolinella succinogenes [TaxId: 88.83
d1yb2a1 250 Hypothetical protein Ta0852 {Thermoplasma acidophi 88.81
d2cl5a1214 Catechol O-methyltransferase, COMT {Rat (Rattus no 88.76
d1pjca1168 L-alanine dehydrogenase {Phormidium lapideum [TaxI 88.63
d1ojta1 229 Dihydrolipoamide dehydrogenase {Neisseria meningit 88.55
d2esra1152 Putative methyltransferase SPy1538 {Streptococcus 88.51
d2nxca1254 PrmA-like protein TTHA0656 (TT0836) {Thermus therm 88.42
d1trba2126 Thioredoxin reductase {Escherichia coli [TaxId: 56 88.42
d2b3ta1 274 N5-glutamine methyltransferase, HemK {Escherichia 88.33
d2igta1 309 Putative methyltransferase Atu0340 {Agrobacterium 87.98
d1nt2a_209 Fibrillarin homologue {Archaeon Archaeoglobus fulg 87.79
d2i6ga1 198 Putative methyltransferase TehB {Salmonella typhim 87.47
d2dt5a2126 Transcriptional repressor Rex, C-terminal domain { 87.33
d1tqha_ 242 Carboxylesterase Est {Bacillus stearothermophilus 87.11
d1h6va1 235 Mammalian thioredoxin reductase {Rat (Rattus norve 87.06
d1qo8a2 317 Flavocytochrome c3 (respiratory fumarate reductase 86.95
d1dl5a1213 Protein-L-isoaspartyl O-methyltransferase {Thermot 86.82
d1onfa1 259 Glutathione reductase {Plasmodium falciparum [TaxI 86.65
d1dusa_194 Hypothetical protein MJ0882 {Archaeon Methanococcu 86.14
d1fl2a1 184 Alkyl hydroperoxide reductase subunit F (AhpF), C- 86.1
d1xkla_ 258 Salicylic acid-binding protein 2 (SABP2) {Common t 85.94
d1euca1130 Succinyl-CoA synthetase, alpha-chain, N-terminal ( 85.59
d1fmta2 206 Methionyl-tRNAfmet formyltransferase {Escherichia 85.47
d1k92a1 188 Argininosuccinate synthetase, N-terminal domain {E 85.34
d1ps9a2162 2,4-dienoyl-CoA reductase, C-terminal domain {Esch 84.91
d1kdga1 360 Flavoprotein domain of flavocytochrome cellobiose 84.82
d1l3ia_186 Precorrin-6Y methyltransferase (CbiT) {Archaeon Me 84.75
d1imja_ 208 Ccg1/TafII250-interacting factor B (Cib) {Human (H 84.63
d1p3y1_ 183 MrsD {Bacillus sp. hil-y85/54728 [TaxId: 69002]} 84.22
d1p5ja_ 319 L-serine dehydratase {Human (Homo sapiens) [TaxId: 84.21
d1jbqa_ 355 Cystathionine beta-synthase {Human (Homo sapiens) 84.0
d1vjta1 193 Putative alpha-glucosidase TM0752 {Thermotoga mari 83.94
d1i1na_224 Protein-L-isoaspartyl O-methyltransferase {Human ( 83.63
d1j20a1 165 Argininosuccinate synthetase, N-terminal domain {T 83.59
d1b7go1 178 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 83.23
d1m6ia1 213 Apoptosis-inducing factor (AIF) {Human (Homo sapie 82.89
d1oi7a1121 Succinyl-CoA synthetase, alpha-chain, N-terminal ( 82.88
d1ri5a_ 252 mRNA cap (Guanine N-7) methyltransferase {Fungus ( 82.83
d3c70a1 256 Hydroxynitrile lyase {Rubber tree (Hevea brasilien 82.69
d2iw1a1 370 Lipopolysaccharide core biosynthesis protein RfaG 82.69
d1w4xa2 235 Phenylacetone monooxygenase {Thermobifida fusca [T 82.55
d1vkza290 Glycinamide ribonucleotide synthetase (GAR-syn), N 82.36
d2bhsa1 292 O-acetylserine sulfhydrylase (Cysteine synthase) { 82.3
d1g6q1_ 328 Arginine methyltransferase, HMT1 {Baker's yeast (S 82.15
d1xxla_ 234 Hypothetical protein YcgJ {Bacillus subtilis [TaxI 81.74
d1neka2 330 Succinate dehydogenase {Escherichia coli [TaxId: 5 81.17
d3bswa1 193 Acetyltransferase PglD {Campylobacter jejuni [TaxI 81.06
d1gpea1 391 Glucose oxidase {Penicillium amagasakiense [TaxId: 80.96
d1im8a_ 225 Hypothetical protein HI0319 (YecO) {Haemophilus in 80.7
d1wg8a2 182 TM0872, methyltransferase domain {Thermus thermoph 80.28
d1np6a_ 170 Molybdopterin-guanine dinucleotide biosynthesis pr 80.15
d1nkva_ 245 Hypothetical Protein YjhP {Escherichia coli [TaxId 80.03
d2fhpa1182 Putative methylase EF2452 {Enterococcus faecalis [ 80.03
>d1fmca_ c.2.1.2 (A:) 7-alpha-hydroxysteroid dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: NAD(P)-binding Rossmann-fold domains
superfamily: NAD(P)-binding Rossmann-fold domains
family: Tyrosine-dependent oxidoreductases
domain: 7-alpha-hydroxysteroid dehydrogenase
species: Escherichia coli [TaxId: 562]
Probab=99.60  E-value=6.1e-16  Score=78.50  Aligned_cols=63  Identities=13%  Similarity=0.104  Sum_probs=51.6

Q ss_pred             CCCCCeEEEEecCcchHHHHHHHHHHHCCCEEEEEEeCCCCcchhHHhhhcCCCCceEEEEccC
Q 036468            1 MSGKGKVVCVTGASGFIASWLVKLLLQRSYTVKATVRDLNNHNAEHLLTLDGAEERLHLFKANS   64 (64)
Q Consensus         1 ~~~~~~~~~i~g~~~~ig~~~~~~l~~~~~~v~~~~r~~~~~~~~~~~~~~~~~~~~~~~~~Di   64 (64)
                      |.+++++++|||++++||+++++.|+++|++|++.+|+.++.+ +..+++...+.++..+++|+
T Consensus         7 m~L~gK~alITGas~GIG~aia~~la~~Ga~V~~~~r~~~~~~-~~~~~l~~~g~~~~~~~~Dv   69 (255)
T d1fmca_           7 LRLDGKCAIITGAGAGIGKEIAITFATAGASVVVSDINADAAN-HVVDEIQQLGGQAFACRCDI   69 (255)
T ss_dssp             GCCTTCEEEETTTTSHHHHHHHHHHHTTTCEEEEEESCHHHHH-HHHHHHHHTTCCEEEEECCT
T ss_pred             CCCCCCEEEEeCCCcHHHHHHHHHHHHCCCEEEEEECCHHHHH-HHHHHHHHcCCcEEEEEccC
Confidence            3457899999999999999999999999999999999776554 34444544467888999986



>d2ae2a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), II [TaxId: 4076]} Back     information, alignment and structure
>d1h5qa_ c.2.1.2 (A:) Mannitol dehydrogenase {Mushroom (Agaricus bisporus) [TaxId: 5341]} Back     information, alignment and structure
>d1ae1a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), I [TaxId: 4076]} Back     information, alignment and structure
>d2c07a1 c.2.1.2 (A:54-304) beta-keto acyl carrier protein reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1yb1a_ c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase type XI {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xq1a_ c.2.1.2 (A:) Tropinone reductase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1k2wa_ c.2.1.2 (A:) Sorbitol dehydrogenase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1zema1 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconobacter oxydans [TaxId: 442]} Back     information, alignment and structure
>d1sbya1 c.2.1.2 (A:1-254) Drosophila alcohol dehydrogenase {Fly (Drosophila lebanonensis) [TaxId: 7225]} Back     information, alignment and structure
>d1cyda_ c.2.1.2 (A:) Carbonyl reductase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1xkqa_ c.2.1.2 (A:) Hypothetical protein R05D8.7 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1g0oa_ c.2.1.2 (A:) 1,3,8-trihydroxynaphtalene reductase (THNR, naphtol reductase) {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1vl8a_ c.2.1.2 (A:) Gluconate 5-dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1geea_ c.2.1.2 (A:) Glucose dehydrogenase {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
>d1xg5a_ c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC4172) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bdba_ c.2.1.2 (A:) Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Pseudomonas sp., lb400 [TaxId: 306]} Back     information, alignment and structure
>d2rhca1 c.2.1.2 (A:5-261) beta-keto acyl carrier protein reductase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1rpna_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1ja9a_ c.2.1.2 (A:) 1,3,6,8-tetrahydroxynaphthalene reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1spxa_ c.2.1.2 (A:) Glucose dehydrogenase (5l265) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pr9a_ c.2.1.2 (A:) Carbonyl reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xhla_ c.2.1.2 (A:) Hypothetical protein F25D1.5 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1ulsa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2ew8a1 c.2.1.2 (A:3-249) (s)-1-phenylethanol dehydrogenase {Azoarcus sp. ebn1 [TaxId: 76114]} Back     information, alignment and structure
>d1rkxa_ c.2.1.2 (A:) CDP-glucose-4,6-dehydratase {Yersinia pseudotuberculosis [TaxId: 633]} Back     information, alignment and structure
>d1gega_ c.2.1.2 (A:) meso-2,3-butanediol dehydrogenase {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1snya_ c.2.1.2 (A:) Carbonyl reductase sniffer {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2gdza1 c.2.1.2 (A:3-256) 15-hydroxyprostaglandin dehydrogenase, PGDH {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zk4a1 c.2.1.2 (A:1-251) R-specific alcohol dehydrogenase {Lactobacillus brevis [TaxId: 1580]} Back     information, alignment and structure
>d1w6ua_ c.2.1.2 (A:) 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {Human (Homo sapiens), [TaxId: 9606]} Back     information, alignment and structure
>d1iy8a_ c.2.1.2 (A:) Levodione reductase {Corynebacterium aquaticum [TaxId: 144185]} Back     information, alignment and structure
>d2bgka1 c.2.1.2 (A:11-278) Rhizome secoisolariciresinol dehydrogenase {Mayapple (Podophyllum peltatum) [TaxId: 35933]} Back     information, alignment and structure
>d1hdca_ c.2.1.2 (A:) 3-alpha,20-beta-hydroxysteroid dehydrogenase {Streptomyces hydrogenans [TaxId: 1905]} Back     information, alignment and structure
>d1nffa_ c.2.1.2 (A:) Putative oxidoreductase Rv2002 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1q7ba_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2o23a1 c.2.1.2 (A:6-253) Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yxma1 c.2.1.2 (A:7-303) Peroxisomal trans 2-enoyl CoA reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2a4ka1 c.2.1.2 (A:2-242) beta-keto acyl carrier protein reductase {Thermus thermophilus, TTHB020 [TaxId: 274]} Back     information, alignment and structure
>d1x1ta1 c.2.1.2 (A:1-260) D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1xu9a_ c.2.1.2 (A:) 11-beta-hydroxysteroid dehydrogenase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1orra_ c.2.1.2 (A:) CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 90370]} Back     information, alignment and structure
>d1ydea1 c.2.1.2 (A:4-253) Retinal dehydrogenase/reductase 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ulua_ c.2.1.2 (A:) Enoyl-ACP reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1yo6a1 c.2.1.2 (A:1-250) Putative carbonyl reductase sniffer {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1udca_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1oaaa_ c.2.1.2 (A:) Sepiapterin reductase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wmaa1 c.2.1.2 (A:2-276) Carbonyl reductase/20beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t2aa_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxha_ c.2.1.2 (A:) 3beta/17beta hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1ek6a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uzma1 c.2.1.2 (A:9-245) beta-keto acyl carrier protein reductase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1edoa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} Back     information, alignment and structure
>d1y1pa1 c.2.1.2 (A:2-343) Aldehyde reductase II {Sporobolomyces salmonicolor [TaxId: 5005]} Back     information, alignment and structure
>d1n7ha_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1xgka_ c.2.1.2 (A:) Negative transcriptional regulator NmrA {Aspergillus nidulans [TaxId: 162425]} Back     information, alignment and structure
>d2ag5a1 c.2.1.2 (A:1-245) Dehydrogenase/reductase SDR family member 6, DHRS6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1db3a_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qyda_ c.2.1.2 (A:) Pinoresinol-lariciresinol reductase {Giant arborvitae (Thuja plicata) [TaxId: 3316]} Back     information, alignment and structure
>d2fr1a1 c.2.1.2 (A:1657-1915) Erythromycin synthase, eryAI, 1st ketoreductase module {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1kewa_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} Back     information, alignment and structure
>d1o5ia_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2bd0a1 c.2.1.2 (A:2-241) Bacterial sepiapterin reductase {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1luaa1 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d2d1ya1 c.2.1.2 (A:2-249) Hypothetical protein TTHA0369 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1qyca_ c.2.1.2 (A:) Phenylcoumaran benzylic ether reductase {Loblolly pine (Pinus taeda) [TaxId: 3352]} Back     information, alignment and structure
>d1oc2a_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} Back     information, alignment and structure
>d2pd4a1 c.2.1.2 (A:2-275) Enoyl-ACP reductase {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2c5aa1 c.2.1.2 (A:13-375) GDP-mannose-3', 5'-epimerase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1z45a2 c.2.1.2 (A:11-357) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2blla1 c.2.1.2 (A:316-657) Polymyxin resistance protein ArnA (PrmI) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1i24a_ c.2.1.2 (A:) Sulfolipid biosynthesis protein SQD1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1sb8a_ c.2.1.2 (A:) UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1qsga_ c.2.1.2 (A:) Enoyl-ACP reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jtva_ c.2.1.2 (A:) Human estrogenic 17beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b69a1 c.2.1.2 (A:4-315) UDP-glucuronate decarboxylase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gz6a_ c.2.1.2 (A:) (3R)-hydroxyacyl-CoA dehydrogenase domain of estradiol 17 beta-Dehydrogenase 4 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2h7ma1 c.2.1.2 (A:2-269) Enoyl-ACP reductase {Mycobacterium tuberculosis, TB, gene InhA [TaxId: 1773]} Back     information, alignment and structure
>d1uaya_ c.2.1.2 (A:) Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2q46a1 c.2.1.2 (A:2-253) Hypothetical protein At5g02240 (T7H20_290) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1mxha_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1fjha_ c.2.1.2 (A:) 3-alpha-hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d2bkaa1 c.2.1.2 (A:5-236) TAT-interacting protein TIP30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ooea_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1e7wa_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1dhra_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1vl0a_ c.2.1.2 (A:) DTDP-4-dehydrorhamnose reductase RfbD {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d1r6da_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1d7oa_ c.2.1.2 (A:) Enoyl-ACP reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} Back     information, alignment and structure
>d1jaya_ c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2a35a1 c.2.1.2 (A:4-215) Hypothetical protein PA4017 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1gy8a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1e6ua_ c.2.1.2 (A:) GDP-4-keto-6-deoxy-d-mannose epimerase/reductase (GDP-fucose synthetase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zmta1 c.2.1.2 (A:2-253) Halohydrin dehalogenase HheC {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1eq2a_ c.2.1.2 (A:) ADP-L-glycero-D-mannoheptose 6-epimerase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1n2sa_ c.2.1.2 (A:) dTDP-6-deoxy-L-lyxo-4-hexulose reductase (RmlD) {Salmonella enterica serovar typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1uh5a_ c.2.1.2 (A:) Enoyl-ACP reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d2pv7a2 c.2.1.6 (A:92-243) Prephenate dehydrogenase TyrA {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1o8ca2 c.2.1.1 (A:116-192) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ks9a2 c.2.1.6 (A:1-167) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1f0ya2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tt7a2 c.2.1.1 (A:128-294) Hypothetical protein YhfP {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1iz0a2 c.2.1.1 (A:99-269) Quinone oxidoreductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1nyta1 c.2.1.7 (A:102-271) Shikimate 5-dehydrogenase AroE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xa0a2 c.2.1.1 (A:119-294) B. subtilis YhfP homologue {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1o89a2 c.2.1.1 (A:116-292) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yb5a2 c.2.1.1 (A:121-294) Quinone oxidoreductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} Back     information, alignment and structure
>d1v3va2 c.2.1.1 (A:113-294) Leukotriene b4 12-hydroxydehydrogenase/prostaglandin 15-keto reductase {Guinea pig (Cavia porcellus) [TaxId: 10141]} Back     information, alignment and structure
>d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} Back     information, alignment and structure
>d1id1a_ c.2.1.9 (A:) Rck domain from putative potassium channel Kch {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pqwa_ c.2.1.1 (A:) Putative enoyl reductase domain of polyketide synthase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1qora2 c.2.1.1 (A:113-291) Quinone oxidoreductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wdka3 c.2.1.6 (A:311-496) Fatty oxidation complex alpha subunit, middle domain {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]} Back     information, alignment and structure
>d1p77a1 c.2.1.7 (A:102-272) Shikimate 5-dehydrogenase AroE {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1txga2 c.2.1.6 (A:1-180) Glycerol-3- phosphate dehydrogenase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1pzga1 c.2.1.5 (A:14-163) Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5811]} Back     information, alignment and structure
>d1pjqa1 c.2.1.11 (A:1-113) Siroheme synthase CysG, domain 1 {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1ez4a1 c.2.1.5 (A:16-162) Lactate dehydrogenase {Lactobacillus pentosus [TaxId: 1589]} Back     information, alignment and structure
>d1n1ea2 c.2.1.6 (A:9-197) Glycerol-3- phosphate dehydrogenase {Trypanosome (Leishmania mexicana) [TaxId: 5665]} Back     information, alignment and structure
>d1kyqa1 c.2.1.11 (A:1-150) Bifunctional dehydrogenase/ferrochelatase Met8p, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hyea1 c.2.1.5 (A:1-145) MJ0490, lactate/malate dehydrogenase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1vi2a1 c.2.1.7 (A:107-288) Putative shikimate dehydrogenase YdiB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2cvoa1 c.2.1.3 (A:68-218,A:384-415) Putative semialdehyde dehydrogenase {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d2g17a1 c.2.1.3 (A:1-153,A:309-334) N-acetyl-gamma-glutamyl-phosphate reductase ArgC {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1gpja2 c.2.1.7 (A:144-302) Glutamyl tRNA-reductase middle domain {Archaeon Methanopyrus kandleri [TaxId: 2320]} Back     information, alignment and structure
>d2pgda2 c.2.1.6 (A:1-176) 6-phosphogluconate dehydrogenase {Sheep (Ovis orientalis aries) [TaxId: 9940]} Back     information, alignment and structure
>d1npya1 c.2.1.7 (A:103-269) Shikimate 5-dehydrogenase-like protein HI0607 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1llua2 c.2.1.1 (A:144-309) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1vpda2 c.2.1.6 (A:3-163) Hydroxyisobutyrate dehydrogenase {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d3cuma2 c.2.1.6 (A:1-162) Hydroxyisobutyrate dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1vm6a3 c.2.1.3 (A:1-96,A:183-214) Dihydrodipicolinate reductase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1guza1 c.2.1.5 (A:1-142) Malate dehydrogenase {Chlorobium vibrioforme [TaxId: 1098]} Back     information, alignment and structure
>d1uufa2 c.2.1.1 (A:145-312) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1t4ba1 c.2.1.3 (A:1-133,A:355-367) Aspartate beta-semialdehyde dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Back     information, alignment and structure
>d2hjsa1 c.2.1.3 (A:3-129,A:320-336) Usg-1 protein homolog PA3116 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1mv8a2 c.2.1.6 (A:1-202) GDP-mannose 6-dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1c1da1 c.2.1.7 (A:149-349) Phenylalanine dehydrogenase {Rhodococcus sp., M4 [TaxId: 1831]} Back     information, alignment and structure
>d1pgja2 c.2.1.6 (A:1-178) 6-phosphogluconate dehydrogenase {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1vkna1 c.2.1.3 (A:1-144,A:308-339) N-acetyl-gamma-glutamyl-phosphate reductase ArgC {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1yqga2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Neisseria meningitidis, serogroup B [TaxId: 487]} Back     information, alignment and structure
>d1djqa2 c.3.1.1 (A:490-645) Trimethylamine dehydrogenase, C-terminal domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1ldna1 c.2.1.5 (A:15-162) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1i36a2 c.2.1.6 (A:1-152) Conserved hypothetical protein MTH1747 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1r0ka2 c.2.1.3 (A:3-126,A:265-290) 1-deoxy-D-xylulose-5-phosphate reductoisomerase {Zymomonas mobilis [TaxId: 542]} Back     information, alignment and structure
>d1gu7a2 c.2.1.1 (A:161-349) 2,4-dienoyl-CoA reductase {Yeast (Candida tropicalis) [TaxId: 5482]} Back     information, alignment and structure
>d1mb4a1 c.2.1.3 (A:1-132,A:355-369) Aspartate beta-semialdehyde dehydrogenase {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1ihua2 c.37.1.10 (A:308-586) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d7mdha1 c.2.1.5 (A:23-197) Malate dehydrogenase {Sorghum (Sorghum vulgare), chloroplast [TaxId: 4558]} Back     information, alignment and structure
>d1y7ta1 c.2.1.5 (A:0-153) Malate dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y6ja1 c.2.1.5 (A:7-148) Lactate dehydrogenase {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1mlda1 c.2.1.5 (A:1-144) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2gz1a1 c.2.1.3 (A:2-127,A:330-357) Aspartate beta-semialdehyde dehydrogenase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d2g5ca2 c.2.1.6 (A:30-200) Prephenate dehydrogenase TyrA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1jvba2 c.2.1.1 (A:144-313) Alcohol dehydrogenase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} Back     information, alignment and structure
>d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dxla2 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1ps9a3 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA reductase, middle domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d1cp2a_ c.37.1.10 (A:) Nitrogenase iron protein {Clostridium pasteurianum [TaxId: 1501]} Back     information, alignment and structure
>d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2jhfa2 c.2.1.1 (A:164-339) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]} Back     information, alignment and structure
>d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1vj1a2 c.2.1.1 (A:125-311) Putative zinc-binding alcohol dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1d1ta2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2cmda1 c.2.1.5 (A:1-145) Malate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hyha1 c.2.1.5 (A:21-166) L-2-hydroxyisocapronate dehydrogenase, L-HICDH {Lactobacillus confusus [TaxId: 1583]} Back     information, alignment and structure
>d1j6ua1 c.5.1.1 (A:0-88) UDP-N-acetylmuramate-alanine ligase MurC {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1rjwa2 c.2.1.1 (A:138-305) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1p3da1 c.5.1.1 (A:11-106) UDP-N-acetylmuramate-alanine ligase MurC {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2ldxa1 c.2.1.5 (A:1-159) Lactate dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1q0qa2 c.2.1.3 (A:1-125,A:275-300) 1-deoxy-D-xylulose-5-phosphate reductoisomerase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d5mdha1 c.2.1.5 (A:1-154) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1a5za1 c.2.1.5 (A:22-163) Lactate dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1u7za_ c.72.3.1 (A:) Coenzyme A biosynthesis bifunctional protein CoaBC, phosphopantothenoylcysteine synthase domain (CoaB) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1ojta2 c.3.1.5 (A:276-400) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d2bi7a1 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mutase, N-terminal domain {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1kjqa2 c.30.1.1 (A:2-112) Glycinamide ribonucleotide transformylase PurT, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} Back     information, alignment and structure
>d1gtea4 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1uxja1 c.2.1.5 (A:2-143) Malate dehydrogenase {Chloroflexus aurantiacus [TaxId: 1108]} Back     information, alignment and structure
>d1ojua1 c.2.1.5 (A:22-163) Malate dehydrogenase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1g3qa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1p0fa2 c.2.1.1 (A:1164-1337) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]} Back     information, alignment and structure
>d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Back     information, alignment and structure
>d1o6za1 c.2.1.5 (A:22-162) Malate dehydrogenase {Archaeon Haloarcula marismortui [TaxId: 2238]} Back     information, alignment and structure
>d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2ahra2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1li4a1 c.2.1.4 (A:190-352) S-adenosylhomocystein hydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dlja2 c.2.1.6 (A:1-196) UDP-glucose dehydrogenase (UDPGDH) {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1byia_ c.37.1.10 (A:) Dethiobiotin synthetase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1llda1 c.2.1.5 (A:7-149) Lactate dehydrogenase {Bifidobacterium longum, strain am101-2 [TaxId: 216816]} Back     information, alignment and structure
>d1jw9b_ c.111.1.1 (B:) Molybdenum cofactor biosynthesis protein MoeB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} Back     information, alignment and structure
>d1a4ia1 c.2.1.7 (A:127-296) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t2da1 c.2.1.5 (A:1-150) Lactate dehydrogenase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1f0ka_ c.87.1.2 (A:) Peptidoglycan biosynthesis glycosyltransferase MurG {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1b0aa1 c.2.1.7 (A:123-288) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1p9oa_ c.72.3.1 (A:) Phosphopantothenoylcysteine synthetase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nvta1 c.2.1.7 (A:111-287) Shikimate 5-dehydrogenase AroE {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1qp8a1 c.2.1.4 (A:83-263) Putative formate dehydrogenase {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1yl7a1 c.2.1.3 (A:2-105,A:215-245) Dihydrodipicolinate reductase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1edza1 c.2.1.7 (A:149-319) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1mo9a2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d1v9la1 c.2.1.7 (A:180-421) Glutamate dehydrogenase {Pyrobaculum islandicum [TaxId: 2277]} Back     information, alignment and structure
>d1hyqa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1k0ia1 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1a9xa3 c.30.1.1 (A:1-127) Carbamoyl phosphate synthetase (CPS), large subunit PreATP-grasp domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e3ia2 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} Back     information, alignment and structure
>d1hwxa1 c.2.1.7 (A:209-501) Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1leha1 c.2.1.7 (A:135-364) Leucine dehydrogenase {Bacillus sphaericus [TaxId: 1421]} Back     information, alignment and structure
>d1i0za1 c.2.1.5 (A:1-160) Lactate dehydrogenase {Human (Homo sapiens), heart isoform (H chain) [TaxId: 9606]} Back     information, alignment and structure
>d2fzwa2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bgva1 c.2.1.7 (A:195-449) Glutamate dehydrogenase {Clostridium symbiosum [TaxId: 1512]} Back     information, alignment and structure
>d1djqa3 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1pj5a2 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine oxidase {Arthrobacter globiformis [TaxId: 1665]} Back     information, alignment and structure
>d1f8fa2 c.2.1.1 (A:163-336) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1diha1 c.2.1.3 (A:2-130,A:241-273) Dihydrodipicolinate reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2afhe1 c.37.1.10 (E:1-289) Nitrogenase iron protein {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1dxya1 c.2.1.4 (A:101-299) D-2-hydroxyisocaproate dehydrogenase {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d2fy8a1 c.2.1.9 (A:116-244) Potassium channel-related protein MthK {Archaeon Methanothermobacter thermautotrophicus [TaxId: 145262]} Back     information, alignment and structure
>d1a9xa4 c.30.1.1 (A:556-676) Carbamoyl phosphate synthetase (CPS), large subunit PreATP-grasp domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kola2 c.2.1.1 (A:161-355) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1j4aa1 c.2.1.4 (A:104-300) D-lactate dehydrogenase {Lactobacillus helveticus [TaxId: 1587]} Back     information, alignment and structure
>d1h2ba2 c.2.1.1 (A:155-326) Alcohol dehydrogenase {Archaeon Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1mx3a1 c.2.1.4 (A:126-318) Transcription corepressor CtbP {Human (Homo sapiens), Ctbp1 [TaxId: 9606]} Back     information, alignment and structure
>d2gf3a1 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]} Back     information, alignment and structure
>d1yovb1 c.111.1.2 (B:12-437) UBA3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3c96a1 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2gv8a1 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d2d59a1 c.2.1.8 (A:4-142) Hypothetical protein PH1109 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1cdoa2 c.2.1.1 (A:165-339) Alcohol dehydrogenase {Cod (Gadus callarias) [TaxId: 8053]} Back     information, alignment and structure
>d1ihua1 c.37.1.10 (A:1-296) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ygya1 c.2.1.4 (A:99-282) Phosphoglycerate dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2f5va1 c.3.1.2 (A:43-354,A:553-619) Pyranose 2-oxidase {White-rot fungus (Peniophora sp. SG) [TaxId: 204723]} Back     information, alignment and structure
>d1fcda1 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]} Back     information, alignment and structure
>d1i8ta1 c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mutase, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d2bisa1 c.87.1.8 (A:1-437) Glycogen synthase 1, GlgA {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d2gqfa1 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein HI0933 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1aoga2 c.3.1.5 (A:170-286) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1y81a1 c.2.1.8 (A:6-121) Hypothetical protein PF0725 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1m6ya2 c.66.1.23 (A:2-114,A:216-294) TM0872, methyltransferase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1gesa1 c.3.1.5 (A:3-146,A:263-335) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rp0a1 c.3.1.6 (A:7-284) Thiazole biosynthetic enzyme Thi4 {Thale cress(Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2naca1 c.2.1.4 (A:148-335) Formate dehydrogenase {Pseudomonas sp., strain 101 [TaxId: 306]} Back     information, alignment and structure
>d1sc6a1 c.2.1.4 (A:108-295) Phosphoglycerate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1y8ca_ c.66.1.43 (A:) Putative methyltransferase CAC2371 {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d1q1ra1 c.3.1.5 (A:2-114,A:248-319) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2v5za1 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1d7ya1 c.3.1.5 (A:5-115,A:237-308) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1nhpa1 c.3.1.5 (A:1-119,A:243-321) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1cjca2 c.4.1.1 (A:6-106,A:332-460) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1pjza_ c.66.1.36 (A:) Thiopurine S-methyltransferase {Pseudomonas syringae [TaxId: 317]} Back     information, alignment and structure
>d1vdca1 c.3.1.5 (A:1-117,A:244-316) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2i0za1 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1gtma1 c.2.1.7 (A:181-419) Glutamate dehydrogenase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1gdha1 c.2.1.4 (A:101-291) D-glycerate dehydrogenase {Hyphomicrobium methylovorum [TaxId: 84]} Back     information, alignment and structure
>d1v8ba1 c.2.1.4 (A:235-397) S-adenosylhomocystein hydrolase {Plasmodium falciparum, isolate 3D7 [TaxId: 5833]} Back     information, alignment and structure
>d1dxla1 c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1yova1 c.111.1.2 (A:6-534) Amyloid beta precursor protein-binding protein 1, APPBP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wzna1 c.66.1.43 (A:1-251) Hypothetical methyltransferase PH1305 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1pn0a1 c.3.1.2 (A:1-240,A:342-461) Phenol hydroxylase {Soil-living yeast (Trichosporon cutaneum) [TaxId: 5554]} Back     information, alignment and structure
>d3grsa1 c.3.1.5 (A:18-165,A:291-363) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n4wa1 c.3.1.2 (A:9-318,A:451-507) Cholesterol oxidase of GMC family {Streptomyces sp. [TaxId: 1931]} Back     information, alignment and structure
>d1b26a1 c.2.1.7 (A:179-412) Glutamate dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2fyta1 c.66.1.6 (A:238-548) Protein arginine N-methyltransferase 3, PRMT3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kifa1 c.4.1.2 (A:1-194,A:288-339) D-aminoacid oxidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2blna2 c.65.1.1 (A:1-203) Polymyxin resistance protein ArnA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1w4xa1 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Back     information, alignment and structure
>d1y0pa2 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d1ve3a1 c.66.1.43 (A:2-227) Hypothetical protein PH0226 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2cvza2 c.2.1.6 (A:2-157) Hydroxyisobutyrate dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1f06a1 c.2.1.3 (A:1-118,A:269-320) Diaminopimelic acid dehydrogenase (DAPDH) {Corynebacterium glutamicum [TaxId: 1718]} Back     information, alignment and structure
>d1rzua_ c.87.1.8 (A:) Glycogen synthase 1, GlgA {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1pn3a_ c.87.1.5 (A:) TDP-epi-vancosaminyltransferase GtfA {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d2i76a2 c.2.1.6 (A:2-154) Hypothetical protein TM1727 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2csua1 c.2.1.8 (A:1-129) Acetate-CoA ligase alpha chain, AcdA, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1lqta2 c.4.1.1 (A:2-108,A:325-456) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2bw0a2 c.65.1.1 (A:1-203) 10-formyltetrahydrofolate dehydrogenase domain 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oria_ c.66.1.6 (A:) Protein arginine N-methyltransferase 1, PRMT1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1trba1 c.3.1.5 (A:1-118,A:245-316) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3etja2 c.30.1.1 (A:1-78) N5-carboxyaminoimidazole ribonucleotide synthetase PurK (AIRC), N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1v59a1 c.3.1.5 (A:1-160,A:283-355) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2gv8a2 c.3.1.5 (A:181-287) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d1d4ca2 c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella putrefaciens [TaxId: 24]} Back     information, alignment and structure
>d1iuka_ c.2.1.8 (A:) Hypothetical protein TT1466 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1iira_ c.87.1.5 (A:) UDP-glucosyltransferase GtfB {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bzga1 c.66.1.36 (A:17-245) Thiopurine S-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pvva2 c.78.1.1 (A:151-313) Ornithine transcarbamoylase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1fl2a2 c.3.1.5 (A:326-451) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rrva_ c.87.1.5 (A:) TDP-vancosaminyltransferase GftD {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d1m6ia2 c.3.1.5 (A:264-400) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3coxa1 c.3.1.2 (A:5-318,A:451-506) Cholesterol oxidase of GMC family {Brevibacterium sterolicum [TaxId: 1702]} Back     information, alignment and structure
>d1ebda1 c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1feca2 c.3.1.5 (A:170-286) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d1iowa1 c.30.1.2 (A:1-96) D-Ala-D-Ala ligase, N-domain {Escherichia coli, gene ddlB [TaxId: 562]} Back     information, alignment and structure
>d1jg1a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1lvla1 c.3.1.5 (A:1-150,A:266-335) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d3lada1 c.3.1.5 (A:1-158,A:278-348) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d2gh1a1 c.66.1.49 (A:13-293) Methyltransferase BC2162 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1xhca1 c.3.1.5 (A:1-103,A:226-289) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1nvmb1 c.2.1.3 (B:1-131,B:287-312) Acetaldehyde dehydrogenase (acylating) {Pseudomonas sp. [TaxId: 306]} Back     information, alignment and structure
>d2gmha1 c.3.1.2 (A:4-236,A:336-482) Electron transfer flavoprotein-ubiquinone oxidoreductase, EFT-QO {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1vdca2 c.3.1.5 (A:118-243) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1mo9a1 c.3.1.5 (A:2-192,A:314-383) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d2nu7a1 c.2.1.8 (A:2-120) Succinyl-CoA synthetase, alpha-chain, N-terminal (CoA-binding) domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1l7da1 c.2.1.4 (A:144-326) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]} Back     information, alignment and structure
>d1vl5a_ c.66.1.41 (A:) Hypothetical protein BH2331 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d2bs2a2 c.3.1.4 (A:1-250,A:372-457) Fumarate reductase {Wolinella succinogenes [TaxId: 844]} Back     information, alignment and structure
>d1yb2a1 c.66.1.13 (A:6-255) Hypothetical protein Ta0852 {Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d2cl5a1 c.66.1.1 (A:3-216) Catechol O-methyltransferase, COMT {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1pjca1 c.2.1.4 (A:136-303) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]} Back     information, alignment and structure
>d1ojta1 c.3.1.5 (A:117-275,A:401-470) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d2esra1 c.66.1.46 (A:28-179) Putative methyltransferase SPy1538 {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d2nxca1 c.66.1.39 (A:1-254) PrmA-like protein TTHA0656 (TT0836) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1trba2 c.3.1.5 (A:119-244) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2b3ta1 c.66.1.30 (A:2-275) N5-glutamine methyltransferase, HemK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2igta1 c.66.1.51 (A:1-309) Putative methyltransferase Atu0340 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1nt2a_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2i6ga1 c.66.1.44 (A:1-198) Putative methyltransferase TehB {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2dt5a2 c.2.1.12 (A:78-203) Transcriptional repressor Rex, C-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1tqha_ c.69.1.29 (A:) Carboxylesterase Est {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1h6va1 c.3.1.5 (A:10-170,A:293-366) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1qo8a2 c.3.1.4 (A:103-359,A:506-565) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d1dl5a1 c.66.1.7 (A:1-213) Protein-L-isoaspartyl O-methyltransferase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1onfa1 c.3.1.5 (A:1-153,A:271-376) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1dusa_ c.66.1.4 (A:) Hypothetical protein MJ0882 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1fl2a1 c.3.1.5 (A:212-325,A:452-521) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xkla_ c.69.1.20 (A:) Salicylic acid-binding protein 2 (SABP2) {Common tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1euca1 c.2.1.8 (A:1-130) Succinyl-CoA synthetase, alpha-chain, N-terminal (CoA-binding) domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1fmta2 c.65.1.1 (A:1-206) Methionyl-tRNAfmet formyltransferase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1k92a1 c.26.2.1 (A:1-188) Argininosuccinate synthetase, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ps9a2 c.3.1.1 (A:466-627) 2,4-dienoyl-CoA reductase, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kdga1 c.3.1.2 (A:215-512,A:694-755) Flavoprotein domain of flavocytochrome cellobiose dehydrogenase (CDH), FAD-binding domain {Fungus (Phanerochaete chrysosporium) [TaxId: 5306]} Back     information, alignment and structure
>d1l3ia_ c.66.1.22 (A:) Precorrin-6Y methyltransferase (CbiT) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1imja_ c.69.1.23 (A:) Ccg1/TafII250-interacting factor B (Cib) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p3y1_ c.34.1.1 (1:) MrsD {Bacillus sp. hil-y85/54728 [TaxId: 69002]} Back     information, alignment and structure
>d1p5ja_ c.79.1.1 (A:) L-serine dehydratase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jbqa_ c.79.1.1 (A:) Cystathionine beta-synthase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i1na_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j20a1 c.26.2.1 (A:1-165) Argininosuccinate synthetase, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1b7go1 c.2.1.3 (O:1-138,O:301-340) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1m6ia1 c.3.1.5 (A:128-263,A:401-477) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oi7a1 c.2.1.8 (A:1-121) Succinyl-CoA synthetase, alpha-chain, N-terminal (CoA-binding) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ri5a_ c.66.1.34 (A:) mRNA cap (Guanine N-7) methyltransferase {Fungus (Encephalitozoon cuniculi) [TaxId: 6035]} Back     information, alignment and structure
>d3c70a1 c.69.1.20 (A:2-257) Hydroxynitrile lyase {Rubber tree (Hevea brasiliensis) [TaxId: 3981]} Back     information, alignment and structure
>d2iw1a1 c.87.1.8 (A:2-371) Lipopolysaccharide core biosynthesis protein RfaG {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1w4xa2 c.3.1.5 (A:155-389) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Back     information, alignment and structure
>d1vkza2 c.30.1.1 (A:4-93) Glycinamide ribonucleotide synthetase (GAR-syn), N-domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2bhsa1 c.79.1.1 (A:2-293) O-acetylserine sulfhydrylase (Cysteine synthase) {Escherichia coli, isoform B (CysM) [TaxId: 562]} Back     information, alignment and structure
>d1g6q1_ c.66.1.6 (1:) Arginine methyltransferase, HMT1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1xxla_ c.66.1.41 (A:) Hypothetical protein YcgJ {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1neka2 c.3.1.4 (A:1-235,A:356-450) Succinate dehydogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3bswa1 b.81.1.8 (A:3-195) Acetyltransferase PglD {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1gpea1 c.3.1.2 (A:1-328,A:525-587) Glucose oxidase {Penicillium amagasakiense [TaxId: 63559]} Back     information, alignment and structure
>d1im8a_ c.66.1.14 (A:) Hypothetical protein HI0319 (YecO) {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1wg8a2 c.66.1.23 (A:5-108,A:207-284) TM0872, methyltransferase domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nkva_ c.66.1.21 (A:) Hypothetical Protein YjhP {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fhpa1 c.66.1.46 (A:1-182) Putative methylase EF2452 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure