Citrus Sinensis ID: 036482
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 177 | ||||||
| 356514074 | 151 | PREDICTED: uncharacterized protein LOC10 | 0.841 | 0.986 | 0.709 | 8e-63 | |
| 357497261 | 148 | Copper transport protein ATOX1-like prot | 0.836 | 1.0 | 0.707 | 9e-63 | |
| 449457029 | 155 | PREDICTED: heavy metal-associated isopre | 0.875 | 1.0 | 0.701 | 1e-61 | |
| 449457031 | 148 | PREDICTED: heavy metal-associated isopre | 0.836 | 1.0 | 0.689 | 3e-60 | |
| 225441939 | 134 | PREDICTED: uncharacterized protein LOC10 | 0.751 | 0.992 | 0.721 | 2e-55 | |
| 297741749 | 162 | unnamed protein product [Vitis vinifera] | 0.740 | 0.808 | 0.724 | 7e-55 | |
| 224089855 | 120 | predicted protein [Populus trichocarpa] | 0.615 | 0.908 | 0.853 | 1e-49 | |
| 255543272 | 686 | pentatricopeptide repeat-containing prot | 0.615 | 0.158 | 0.862 | 7e-47 | |
| 147807422 | 110 | hypothetical protein VITISV_012851 [Viti | 0.615 | 0.990 | 0.792 | 5e-44 | |
| 186511137 | 166 | metal ion binding protein [Arabidopsis t | 0.830 | 0.885 | 0.453 | 4e-37 |
| >gi|356514074|ref|XP_003525732.1| PREDICTED: uncharacterized protein LOC100795167 [Glycine max] | Back alignment and taxonomy information |
|---|
Score = 244 bits (624), Expect = 8e-63, Method: Compositional matrix adjust.
Identities = 117/165 (70%), Positives = 137/165 (83%), Gaps = 16/165 (9%)
Query: 13 DMFGWRLGKTQLPNAMAIVELMVHMDCEGCEKRIRRAISKIDVFNQFDVQFSFDFIITGV 72
+MFGWR K +LP A++IVEL VHMDC+GCE+RIRRAISK++ G+
Sbjct: 3 NMFGWRPRKNKLPKALSIVELKVHMDCQGCEERIRRAISKLN----------------GI 46
Query: 73 DSLDIDMDKQKVTVTGYVDERKVLKVVRRTGRKAEFWPFPYDSEYYPYASTYLDESTFRS 132
DSLDIDMD+QKVTVTGYV++ KVL++VRRTGRKAE+WPFPYDSEYYPYAS YLDESTF S
Sbjct: 47 DSLDIDMDQQKVTVTGYVEKGKVLRIVRRTGRKAEYWPFPYDSEYYPYASEYLDESTFAS 106
Query: 133 SYNYYQHGFNESVHGYFPDQAYETVPDDTVHLFSEDNVHAYCTIM 177
SYNYY+HG+NESV+GYFPDQAY TV D+TV LFS+DNVHA CTIM
Sbjct: 107 SYNYYRHGYNESVYGYFPDQAYCTVQDETVFLFSDDNVHAPCTIM 151
|
Source: Glycine max Species: Glycine max Genus: Glycine Family: Fabaceae Order: Fabales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|357497261|ref|XP_003618919.1| Copper transport protein ATOX1-like protein [Medicago truncatula] gi|355493934|gb|AES75137.1| Copper transport protein ATOX1-like protein [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|449457029|ref|XP_004146251.1| PREDICTED: heavy metal-associated isoprenylated plant protein 26-like isoform 1 [Cucumis sativus] gi|449495523|ref|XP_004159866.1| PREDICTED: heavy metal-associated isoprenylated plant protein 26-like isoform 1 [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|449457031|ref|XP_004146252.1| PREDICTED: heavy metal-associated isoprenylated plant protein 26-like isoform 2 [Cucumis sativus] gi|449495525|ref|XP_004159867.1| PREDICTED: heavy metal-associated isoprenylated plant protein 26-like isoform 2 [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|225441939|ref|XP_002262627.1| PREDICTED: uncharacterized protein LOC100248113 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|297741749|emb|CBI32881.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|224089855|ref|XP_002308838.1| predicted protein [Populus trichocarpa] gi|222854814|gb|EEE92361.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|255543272|ref|XP_002512699.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223548660|gb|EEF50151.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|147807422|emb|CAN70758.1| hypothetical protein VITISV_012851 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|186511137|ref|NP_001118849.1| metal ion binding protein [Arabidopsis thaliana] gi|332646062|gb|AEE79583.1| metal ion binding protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 177 | ||||||
| TAIR|locus:4515103273 | 166 | AT3G56891 [Arabidopsis thalian | 0.734 | 0.783 | 0.438 | 1.4e-30 | |
| TAIR|locus:1005716648 | 178 | AT2G18196 [Arabidopsis thalian | 0.757 | 0.752 | 0.384 | 3.3e-24 | |
| TAIR|locus:4010713877 | 183 | AT4G10465 [Arabidopsis thalian | 0.751 | 0.726 | 0.407 | 7e-22 | |
| TAIR|locus:2157457 | 149 | HIPP21 "heavy metal associated | 0.666 | 0.791 | 0.357 | 4.6e-18 | |
| TAIR|locus:2202265 | 159 | AT1G06330 "AT1G06330" [Arabido | 0.553 | 0.616 | 0.395 | 5.8e-18 | |
| TAIR|locus:2029914 | 141 | AT1G29100 "AT1G29100" [Arabido | 0.706 | 0.886 | 0.350 | 9.5e-18 | |
| TAIR|locus:2026336 | 152 | HIPP20 "heavy metal associated | 0.740 | 0.861 | 0.345 | 2.3e-16 | |
| TAIR|locus:2101343 | 140 | AT3G48970 "AT3G48970" [Arabido | 0.723 | 0.914 | 0.354 | 2e-15 | |
| TAIR|locus:2017759 | 152 | HIPP22 "heavy metal associated | 0.734 | 0.855 | 0.339 | 5.4e-15 | |
| TAIR|locus:2135277 | 158 | AT4G39700 [Arabidopsis thalian | 0.757 | 0.848 | 0.325 | 1.8e-14 |
| TAIR|locus:4515103273 AT3G56891 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 337 (123.7 bits), Expect = 1.4e-30, P = 1.4e-30
Identities = 71/162 (43%), Positives = 106/162 (65%)
Query: 14 MFGWRLGKTQLPNAMAIVELMVHMDCEGCEKRIRRAISKIDVFNQFDVQFSFDFIITGVD 73
MF W G ++LP A++IVEL+V MDC+GCEK++RRAISK+D GVD
Sbjct: 1 MFDWIHGNSRLPIALSIVELLVDMDCKGCEKKVRRAISKLD----------------GVD 44
Query: 74 SLDIDMDKQKVTVTGYVDERKVLKVVRRTGRKAEFWPFPYDS---EYYPYASTYLDES-- 128
+++ID+D+QKVTVTGYVD +VLK+V+RTGR AE+WPFPY+ +YY Y S +L++S
Sbjct: 45 TVEIDVDRQKVTVTGYVDREEVLKMVKRTGRTAEYWPFPYNGYYGDYYTYPSQHLEQSDQ 104
Query: 129 ------TFRSSYNYY-----QHGFNESVHGYFPDQAYETVPD 159
++ Y++Y Q+ N +++GY+P + + P+
Sbjct: 105 KIYQTISYSGKYDFYDVDDFQNTNNSTINGYYPSSSQKVQPN 146
|
|
| TAIR|locus:1005716648 AT2G18196 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:4010713877 AT4G10465 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2157457 HIPP21 "heavy metal associated isoprenylated plant protein 21" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2202265 AT1G06330 "AT1G06330" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2029914 AT1G29100 "AT1G29100" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2026336 HIPP20 "heavy metal associated isoprenylated plant protein 20" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2101343 AT3G48970 "AT3G48970" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2017759 HIPP22 "heavy metal associated isoprenylated plant protein 22" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2135277 AT4G39700 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| GSVIVG00010080001 | SubName- Full=Chromosome chr8 scaffold_1853, whole genome shotgun sequence; Flags- Fragment; (132 aa) | |||||||
(Vitis vinifera) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 177 | |||
| cd00371 | 63 | cd00371, HMA, Heavy-metal-associated domain (HMA) | 2e-12 | |
| pfam00403 | 62 | pfam00403, HMA, Heavy-metal-associated domain | 2e-11 | |
| PLN02957 | 238 | PLN02957, PLN02957, copper, zinc superoxide dismut | 2e-07 | |
| COG2608 | 71 | COG2608, CopZ, Copper chaperone [Inorganic ion tra | 2e-07 |
| >gnl|CDD|238219 cd00371, HMA, Heavy-metal-associated domain (HMA) is a conserved domain of approximately 30 amino acid residues found in a number of proteins that transport or detoxify heavy metals, for example, the CPx-type heavy metal ATPases and copper chaperones | Back alignment and domain information |
|---|
Score = 58.8 bits (143), Expect = 2e-12
Identities = 22/79 (27%), Positives = 36/79 (45%), Gaps = 19/79 (24%)
Query: 32 ELMVH-MDCEGCEKRIRRAISKIDVFNQFDVQFSFDFIITGVDSLDIDMDKQKVTVTGY- 89
EL V M C GC +I +A+ K+ GV+S+++D++ K TV
Sbjct: 1 ELSVEGMTCAGCVSKIEKALEKLP----------------GVESVEVDLETGKATVEYDP 44
Query: 90 -VDERKVLKVVRRTGRKAE 107
V ++L+ + G KA
Sbjct: 45 EVSPEELLEAIEDAGYKAR 63
|
HMA domain contains two cysteine residues that are important in binding and transfer of metal ions, such as copper, cadmium, cobalt and zinc. In the case of copper, stoichiometry of binding is one Cu+ ion per binding domain. Repeats of the HMA domain in copper chaperone has been associated with Menkes/Wilson disease due to binding of multiple copper ions. Length = 63 |
| >gnl|CDD|215902 pfam00403, HMA, Heavy-metal-associated domain | Back alignment and domain information |
|---|
| >gnl|CDD|215516 PLN02957, PLN02957, copper, zinc superoxide dismutase | Back alignment and domain information |
|---|
| >gnl|CDD|225328 COG2608, CopZ, Copper chaperone [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 177 | |||
| KOG1603 | 73 | consensus Copper chaperone [Inorganic ion transpor | 99.55 | |
| PF00403 | 62 | HMA: Heavy-metal-associated domain; InterPro: IPR0 | 99.41 | |
| COG2608 | 71 | CopZ Copper chaperone [Inorganic ion transport and | 99.25 | |
| KOG4656 | 247 | consensus Copper chaperone for superoxide dismutas | 98.9 | |
| PLN02957 | 238 | copper, zinc superoxide dismutase | 98.36 | |
| PRK10671 | 834 | copA copper exporting ATPase; Provisional | 98.21 | |
| TIGR00003 | 68 | copper ion binding protein. This model describes a | 97.86 | |
| COG2217 | 713 | ZntA Cation transport ATPase [Inorganic ion transp | 97.6 | |
| PRK10671 | 834 | copA copper exporting ATPase; Provisional | 96.87 | |
| KOG0207 | 951 | consensus Cation transport ATPase [Inorganic ion t | 96.82 | |
| PRK11033 | 741 | zntA zinc/cadmium/mercury/lead-transporting ATPase | 96.32 | |
| KOG0207 | 951 | consensus Cation transport ATPase [Inorganic ion t | 95.55 | |
| TIGR02052 | 92 | MerP mercuric transport protein periplasmic compon | 93.59 | |
| cd00371 | 63 | HMA Heavy-metal-associated domain (HMA) is a conse | 86.55 | |
| PRK13748 | 561 | putative mercuric reductase; Provisional | 82.68 |
| >KOG1603 consensus Copper chaperone [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
Probab=99.55 E-value=3.6e-14 Score=100.49 Aligned_cols=70 Identities=49% Similarity=0.939 Sum_probs=64.8
Q ss_pred CceEEEEEEeccchhHHHHHHHHHhhhccccccccccccccccCCceEEEEecCCcEEEEEecCCHHHHHHHHHHcC-Cc
Q 036482 27 AMAIVELMVHMDCEGCEKRIRRAISKIDVFNQFDVQFSFDFIITGVDSLDIDMDKQKVTVTGYVDERKVLKVVRRTG-RK 105 (177)
Q Consensus 27 ~~qtv~~~V~M~C~gC~~kV~kaL~~l~~~~~~~~~~~~~~~~~GV~sV~vd~~~~kVtVtg~vd~~kll~~l~ktG-~~ 105 (177)
.+++.+++|.|+|+||+.+|++.|+.+ +||.++.+|..+++|||.|.+++.+|++.|++.| ++
T Consensus 3 ~~~~~v~kv~~~C~gc~~kV~~~l~~~----------------~GV~~v~id~~~~kvtV~g~~~p~~vl~~l~k~~~k~ 66 (73)
T KOG1603|consen 3 PIKTVVLKVNMHCEGCARKVKRVLQKL----------------KGVESVDIDIKKQKVTVKGNVDPVKLLKKLKKTGGKR 66 (73)
T ss_pred CccEEEEEECcccccHHHHHHHHhhcc----------------CCeEEEEecCCCCEEEEEEecCHHHHHHHHHhcCCCc
Confidence 356788899999999999999999999 9999999999999999999999999999999998 88
Q ss_pred eEEccCC
Q 036482 106 AEFWPFP 112 (177)
Q Consensus 106 ae~~p~p 112 (177)
+++|..|
T Consensus 67 ~~~~~~p 73 (73)
T KOG1603|consen 67 AELWKVP 73 (73)
T ss_pred eEEecCC
Confidence 8888543
|
|
| >PF00403 HMA: Heavy-metal-associated domain; InterPro: IPR006121 Proteins that transport heavy metals in micro-organisms and mammals share similarities in their sequences and structures | Back alignment and domain information |
|---|
| >COG2608 CopZ Copper chaperone [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >KOG4656 consensus Copper chaperone for superoxide dismutase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PLN02957 copper, zinc superoxide dismutase | Back alignment and domain information |
|---|
| >PRK10671 copA copper exporting ATPase; Provisional | Back alignment and domain information |
|---|
| >TIGR00003 copper ion binding protein | Back alignment and domain information |
|---|
| >COG2217 ZntA Cation transport ATPase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK10671 copA copper exporting ATPase; Provisional | Back alignment and domain information |
|---|
| >KOG0207 consensus Cation transport ATPase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK11033 zntA zinc/cadmium/mercury/lead-transporting ATPase; Provisional | Back alignment and domain information |
|---|
| >KOG0207 consensus Cation transport ATPase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR02052 MerP mercuric transport protein periplasmic component | Back alignment and domain information |
|---|
| >cd00371 HMA Heavy-metal-associated domain (HMA) is a conserved domain of approximately 30 amino acid residues found in a number of proteins that transport or detoxify heavy metals, for example, the CPx-type heavy metal ATPases and copper chaperones | Back alignment and domain information |
|---|
| >PRK13748 putative mercuric reductase; Provisional | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 177 | |||
| 2crl_A | 98 | Copper chaperone for superoxide dismutase; SOD1, f | 6e-26 | |
| 3iwl_A | 68 | Copper transport protein ATOX1; beta-alpha-beta-BE | 6e-21 | |
| 1cc8_A | 73 | Protein (metallochaperone ATX1); copper transport, | 3e-20 | |
| 1qup_A | 222 | Superoxide dismutase 1 copper chaperone; two domai | 5e-18 | |
| 1jk9_B | 249 | CCS, copper chaperone for superoxide dismutase; pr | 5e-16 | |
| 2k2p_A | 85 | Uncharacterized protein ATU1203; putative metal-bi | 4e-10 | |
| 2xmm_A | 64 | SSR2857 protein, ATX1; metal transport, copper hom | 8e-09 | |
| 2roe_A | 66 | Heavy metal binding protein; NMR {Thermus thermoph | 3e-07 | |
| 3fry_A | 73 | Probable copper-exporting P-type ATPase A; transpo | 3e-05 | |
| 1yg0_A | 66 | COP associated protein; open-faced beta-sandwich, | 4e-05 | |
| 2kyz_A | 67 | Heavy metal binding protein; structural genomics, | 6e-05 | |
| 2l3m_A | 71 | Copper-ION-binding protein; structural genomics, c | 8e-05 | |
| 2aj0_A | 71 | Probable cadmium-transporting ATPase; ferrodoxin-l | 3e-04 | |
| 2qif_A | 69 | Copper chaperone COPZ; tetranuclear Cu(I) cluster; | 8e-04 |
| >2crl_A Copper chaperone for superoxide dismutase; SOD1, familial ALS, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 98 | Back alignment and structure |
|---|
Score = 94.1 bits (234), Expect = 6e-26
Identities = 16/83 (19%), Positives = 35/83 (42%), Gaps = 16/83 (19%)
Query: 27 AMAIVELMVHMDCEGCEKRIRRAISKIDVFNQFDVQFSFDFIITGVDSLDIDMDKQKVTV 86
+ +E V M C+ C +R+++ + GV +++ ++ Q V V
Sbjct: 17 TLCTLEFAVQMTCQSCVDAVRKSLQGVA----------------GVQDVEVHLEDQMVLV 60
Query: 87 TGYVDERKVLKVVRRTGRKAEFW 109
+ ++V ++ TGR+A
Sbjct: 61 HTTLPSQEVQALLEGTGRQAVLK 83
|
| >3iwl_A Copper transport protein ATOX1; beta-alpha-beta-BETA-alpha-beta, cisplatin, platinum, chaperone, ION transport, metal-binding, metal transport; HET: TCE; 1.60A {Homo sapiens} PDB: 1fe4_A* 1fee_A* 1tl4_A 1tl5_A 2k1r_B 1fe0_A* 3iwx_A 3cjk_A Length = 68 | Back alignment and structure |
|---|
| >1cc8_A Protein (metallochaperone ATX1); copper transport, mercury coordination, metal transport; 1.02A {Saccharomyces cerevisiae} SCOP: d.58.17.1 PDB: 1cc7_A 1fd8_A 1fes_A 2ggp_A 3k7r_A Length = 73 | Back alignment and structure |
|---|
| >1qup_A Superoxide dismutase 1 copper chaperone; two domains, beta-alpha-beta-BETA-alpha-beta and beta barrel; 1.80A {Saccharomyces cerevisiae} SCOP: b.1.8.1 d.58.17.1 Length = 222 | Back alignment and structure |
|---|
| >1jk9_B CCS, copper chaperone for superoxide dismutase; protein-protein complex, heterodimer, metallochaperone, amyotrophic lateral sclerosis; 2.90A {Saccharomyces cerevisiae} SCOP: b.1.8.1 d.58.17.1 Length = 249 | Back alignment and structure |
|---|
| >2k2p_A Uncharacterized protein ATU1203; putative metal-binding domain ATU1203, ontario centre for ST proteomics, structural genomics; NMR {Agrobacterium tumefaciens str} Length = 85 | Back alignment and structure |
|---|
| >2xmm_A SSR2857 protein, ATX1; metal transport, copper homeostasis, chaperone, P-type atpas; 1.65A {Synechocystis SP} PDB: 2xmv_A 1sb6_A 2xmj_A 2xmk_A 2xmt_A 2xmu_A Length = 64 | Back alignment and structure |
|---|
| >2roe_A Heavy metal binding protein; NMR {Thermus thermophilus} PDB: 2rog_A Length = 66 | Back alignment and structure |
|---|
| >3fry_A Probable copper-exporting P-type ATPase A; transport protein, metal binding domain, domain SWAP, ATP-BI cell membrane, copper transport; HET: CIT; 2.00A {Archaeoglobus fulgidus} Length = 73 | Back alignment and structure |
|---|
| >1yg0_A COP associated protein; open-faced beta-sandwich, missing C-terminal beta-sheet, Met transport; NMR {Helicobacter pylori} Length = 66 | Back alignment and structure |
|---|
| >2kyz_A Heavy metal binding protein; structural genomics, PSI-biology, protein structure initiative, joint for structural genomics, JCSG; NMR {Thermotoga maritima} Length = 67 | Back alignment and structure |
|---|
| >2l3m_A Copper-ION-binding protein; structural genomics, center for structural genomics of infec diseases, csgid, metal binding protein; NMR {Bacillus anthracis} Length = 71 | Back alignment and structure |
|---|
| >2aj0_A Probable cadmium-transporting ATPase; ferrodoxin-like fold, beta-alpha-beta-BETA-alpha-beta, metal binding protein, hydrolase; NMR {Listeria monocytogenes} PDB: 2aj1_A Length = 71 | Back alignment and structure |
|---|
| >2qif_A Copper chaperone COPZ; tetranuclear Cu(I) cluster; 1.50A {Bacillus subtilis} SCOP: d.58.17.1 PDB: 3i9z_A 1k0v_A 1p8g_A Length = 69 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 177 | |||
| 3iwl_A | 68 | Copper transport protein ATOX1; beta-alpha-beta-BE | 99.56 | |
| 1cc8_A | 73 | Protein (metallochaperone ATX1); copper transport, | 99.45 | |
| 4a4j_A | 69 | Pacszia, cation-transporting ATPase PACS; hydrolas | 99.43 | |
| 3dxs_X | 74 | Copper-transporting ATPase RAN1; CXXC motif, ferre | 99.42 | |
| 2crl_A | 98 | Copper chaperone for superoxide dismutase; SOD1, f | 99.31 | |
| 3fry_A | 73 | Probable copper-exporting P-type ATPase A; transpo | 99.29 | |
| 2xmm_A | 64 | SSR2857 protein, ATX1; metal transport, copper hom | 99.28 | |
| 2l3m_A | 71 | Copper-ION-binding protein; structural genomics, c | 99.28 | |
| 2k2p_A | 85 | Uncharacterized protein ATU1203; putative metal-bi | 99.27 | |
| 2roe_A | 66 | Heavy metal binding protein; NMR {Thermus thermoph | 99.23 | |
| 2xmw_A | 71 | PACS-N, cation-transporting ATPase PACS; hydrolase | 99.21 | |
| 1osd_A | 72 | MERP, hypothetical protein MERP; mercury resistanc | 99.2 | |
| 1aw0_A | 72 | Menkes copper-transporting ATPase; copper-binding | 99.2 | |
| 1opz_A | 76 | Potential copper-transporting ATPase; mutation, fo | 99.2 | |
| 2qif_A | 69 | Copper chaperone COPZ; tetranuclear Cu(I) cluster; | 99.19 | |
| 1mwy_A | 73 | ZNTA; open-faced beta-sandwich fold, beta-alpha-be | 99.15 | |
| 3cjk_B | 75 | Copper-transporting ATPase 1; HAH1, ATP7B, menkes | 99.15 | |
| 1kvi_A | 79 | Copper-transporting ATPase 1; menkes, Cu-protein, | 99.15 | |
| 1fvq_A | 72 | Copper-transporting ATPase; APO-CCC2A, hydrolase; | 99.14 | |
| 1q8l_A | 84 | Copper-transporting ATPase 1; metal binding protei | 99.13 | |
| 1y3j_A | 77 | Copper-transporting ATPase 1; ferrodoxin-like fold | 99.11 | |
| 1cpz_A | 68 | Protein (COPZ); copper chaperone, metal transport, | 99.11 | |
| 2g9o_A | 90 | Copper-transporting ATPase 1; menkes disease, solu | 99.1 | |
| 2ldi_A | 71 | Zinc-transporting ATPase; metal homeostasis, metal | 99.09 | |
| 2kt2_A | 69 | Mercuric reductase; nmera, MERA, HMA domain, mercu | 99.09 | |
| 1jww_A | 80 | Potential copper-transporting ATPase; beta-alpha-b | 99.08 | |
| 1yg0_A | 66 | COP associated protein; open-faced beta-sandwich, | 99.07 | |
| 1yjr_A | 75 | Copper-transporting ATPase 1; metallochaperone, pr | 99.05 | |
| 2ew9_A | 149 | Copper-transporting ATPase 2; copper trafficking, | 99.01 | |
| 2kkh_A | 95 | Putative heavy metal transporter; zinc transport, | 99.01 | |
| 2ofg_X | 111 | Zinc-transporting ATPase; ferredoxin-like fold, be | 99.0 | |
| 1qup_A | 222 | Superoxide dismutase 1 copper chaperone; two domai | 98.99 | |
| 1p6t_A | 151 | Potential copper-transporting ATPase; COPA, P-type | 98.96 | |
| 2aj0_A | 71 | Probable cadmium-transporting ATPase; ferrodoxin-l | 98.92 | |
| 2kyz_A | 67 | Heavy metal binding protein; structural genomics, | 98.9 | |
| 2rop_A | 202 | Copper-transporting ATPase 2; wilson protein, mobi | 98.87 | |
| 2ew9_A | 149 | Copper-transporting ATPase 2; copper trafficking, | 98.84 | |
| 1jk9_B | 249 | CCS, copper chaperone for superoxide dismutase; pr | 98.83 | |
| 1p6t_A | 151 | Potential copper-transporting ATPase; COPA, P-type | 98.55 | |
| 2rop_A | 202 | Copper-transporting ATPase 2; wilson protein, mobi | 98.44 | |
| 3j09_A | 723 | COPA, copper-exporting P-type ATPase A; copper tra | 98.27 |
| >3iwl_A Copper transport protein ATOX1; beta-alpha-beta-BETA-alpha-beta, cisplatin, platinum, chaperone, ION transport, metal-binding, metal transport; HET: TCE; 1.60A {Homo sapiens} SCOP: d.58.17.1 PDB: 1fe4_A* 1fee_A* 1tl4_A 1tl5_A 2k1r_B 1fe0_A* 3iwx_A 3cjk_A | Back alignment and structure |
|---|
Probab=99.56 E-value=2.5e-14 Score=95.40 Aligned_cols=67 Identities=28% Similarity=0.593 Sum_probs=62.2
Q ss_pred ceEEEEEEeccchhHHHHHHHHHhhhccccccccccccccccCCceEEEEecCCcEEEEEecCCHHHHHHHHHHcCCceE
Q 036482 28 MAIVELMVHMDCEGCEKRIRRAISKIDVFNQFDVQFSFDFIITGVDSLDIDMDKQKVTVTGYVDERKVLKVVRRTGRKAE 107 (177)
Q Consensus 28 ~qtv~~~V~M~C~gC~~kV~kaL~~l~~~~~~~~~~~~~~~~~GV~sV~vd~~~~kVtVtg~vd~~kll~~l~ktG~~ae 107 (177)
|++++|.|+|+|.+|+.+|+++|+++ +|| ++.+|+.+++++|++.+++++|+++|+++||+++
T Consensus 1 m~~~~~~vgm~C~~C~~~i~~~l~~~----------------~gV-~v~v~~~~~~~~v~~~~~~~~i~~~i~~~Gy~~~ 63 (68)
T 3iwl_A 1 MPKHEFSVDMTCGGCAEAVSRVLNKL----------------GGV-KYDIDLPNKKVCIESEHSMDTLLATLKKTGKTVS 63 (68)
T ss_dssp -CEEEEEECCCSHHHHHHHHHHHHHH----------------CSE-EEEEETTTTEEEEEESSCHHHHHHHHHTTCSCEE
T ss_pred CceEEEEECcCcHHHHHHHHHHHHcC----------------CCe-EEEEEcCCCEEEEEecCCHHHHHHHHHHcCCceE
Confidence 45678888999999999999999999 999 9999999999999999999999999999999999
Q ss_pred EccC
Q 036482 108 FWPF 111 (177)
Q Consensus 108 ~~p~ 111 (177)
+|+.
T Consensus 64 ~~~~ 67 (68)
T 3iwl_A 64 YLGL 67 (68)
T ss_dssp EEEC
T ss_pred ecCC
Confidence 8753
|
| >1cc8_A Protein (metallochaperone ATX1); copper transport, mercury coordination, metal transport; 1.02A {Saccharomyces cerevisiae} SCOP: d.58.17.1 PDB: 1cc7_A 1fd8_A 1fes_A 2ggp_A 3k7r_A | Back alignment and structure |
|---|
| >4a4j_A Pacszia, cation-transporting ATPase PACS; hydrolase, copper homeostasis, zinc homeostasis, ATX1, metal-transporting atpases; 1.25A {Synechocystis} PDB: 4a48_A 2gcf_A 2xmw_A | Back alignment and structure |
|---|
| >3dxs_X Copper-transporting ATPase RAN1; CXXC motif, ferredoxin-like fold, ATP- binding, ethylene signaling pathway, hydrolase, ION transport; 1.70A {Arabidopsis thaliana} SCOP: d.58.17.0 | Back alignment and structure |
|---|
| >2crl_A Copper chaperone for superoxide dismutase; SOD1, familial ALS, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3fry_A Probable copper-exporting P-type ATPase A; transport protein, metal binding domain, domain SWAP, ATP-BI cell membrane, copper transport; HET: CIT; 2.00A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >2xmm_A SSR2857 protein, ATX1; metal transport, copper homeostasis, chaperone, P-type atpas; 1.65A {Synechocystis SP} PDB: 2xmv_A 1sb6_A 2xmj_A 2xmk_A 2xmt_A 2xmu_A | Back alignment and structure |
|---|
| >2l3m_A Copper-ION-binding protein; structural genomics, center for structural genomics of infec diseases, csgid, metal binding protein; NMR {Bacillus anthracis} | Back alignment and structure |
|---|
| >2k2p_A Uncharacterized protein ATU1203; putative metal-binding domain ATU1203, ontario centre for ST proteomics, structural genomics; NMR {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >2roe_A Heavy metal binding protein; NMR {Thermus thermophilus} PDB: 2rog_A | Back alignment and structure |
|---|
| >2xmw_A PACS-N, cation-transporting ATPase PACS; hydrolase, Cu(I)-binding, trafficking; 1.80A {Synechocystis SP} PDB: 2gcf_A | Back alignment and structure |
|---|
| >1osd_A MERP, hypothetical protein MERP; mercury resistance, metal binding protein, perisplasm, structural genomics; 2.00A {Cupriavidus metallidurans} SCOP: d.58.17.1 PDB: 1afi_A 1afj_A 2hqi_A | Back alignment and structure |
|---|
| >1aw0_A Menkes copper-transporting ATPase; copper-binding domain, hydrolase; NMR {Homo sapiens} SCOP: d.58.17.1 PDB: 2aw0_A | Back alignment and structure |
|---|
| >1opz_A Potential copper-transporting ATPase; mutation, folding, abbab fold, hydrolase; NMR {Bacillus subtilis} SCOP: d.58.17.1 PDB: 1oq3_A 1oq6_A | Back alignment and structure |
|---|
| >2qif_A Copper chaperone COPZ; tetranuclear Cu(I) cluster; 1.50A {Bacillus subtilis} SCOP: d.58.17.1 PDB: 3i9z_A 1k0v_A 1p8g_A | Back alignment and structure |
|---|
| >1mwy_A ZNTA; open-faced beta-sandwich fold, beta-alpha-beta-BETA-alpha- beta, hydrolase; NMR {Escherichia coli} SCOP: d.58.17.1 PDB: 1mwz_A | Back alignment and structure |
|---|
| >3cjk_B Copper-transporting ATPase 1; HAH1, ATP7B, menkes disease, metal homeostasis, chaperone, ION transport, metal- binding, alternative splicing; 1.80A {Homo sapiens} PDB: 2k1r_A | Back alignment and structure |
|---|
| >1kvi_A Copper-transporting ATPase 1; menkes, Cu-protein, hydrolase; NMR {Homo sapiens} SCOP: d.58.17.1 PDB: 1kvj_A | Back alignment and structure |
|---|
| >1fvq_A Copper-transporting ATPase; APO-CCC2A, hydrolase; NMR {Saccharomyces cerevisiae} SCOP: d.58.17.1 PDB: 1fvs_A 2ggp_B | Back alignment and structure |
|---|
| >1q8l_A Copper-transporting ATPase 1; metal binding protein; NMR {Homo sapiens} SCOP: d.58.17.1 PDB: 1s6o_A 1s6u_A | Back alignment and structure |
|---|
| >1y3j_A Copper-transporting ATPase 1; ferrodoxin-like fold, beta-alpha-beta-BETA-alpha-beta structure, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 1y3k_A | Back alignment and structure |
|---|
| >1cpz_A Protein (COPZ); copper chaperone, metal transport, gene regulation; NMR {Enterococcus hirae} SCOP: d.58.17.1 | Back alignment and structure |
|---|
| >2g9o_A Copper-transporting ATPase 1; menkes disease, solution structure, structural genomics, structural proteomics in europe, spine, hydrolase; NMR {Homo sapiens} PDB: 2ga7_A | Back alignment and structure |
|---|
| >2ldi_A Zinc-transporting ATPase; metal homeostasis, metallochaperones, hydrolase; NMR {Synechocystis SP} | Back alignment and structure |
|---|
| >2kt2_A Mercuric reductase; nmera, MERA, HMA domain, mercuric resist metal-binding, oxidoreductase; NMR {Pseudomonas aeruginosa} PDB: 2kt3_A | Back alignment and structure |
|---|
| >1jww_A Potential copper-transporting ATPase; beta-alpha-beta-BETA-alpha-beta, hydrolase; NMR {Bacillus subtilis} SCOP: d.58.17.1 PDB: 2voy_A 1kqk_A | Back alignment and structure |
|---|
| >1yg0_A COP associated protein; open-faced beta-sandwich, missing C-terminal beta-sheet, Met transport; NMR {Helicobacter pylori} | Back alignment and structure |
|---|
| >1yjr_A Copper-transporting ATPase 1; metallochaperone, protein-protein interaction, copper(I), metal homeostasis, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 1yjt_A 1yju_A 1yjv_A | Back alignment and structure |
|---|
| >2ew9_A Copper-transporting ATPase 2; copper trafficking, ferrodoxin-like fold, structural genomics, structural proteomics in europe, spine, hydrolase; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2kkh_A Putative heavy metal transporter; zinc transport, metal binding, metal selectivity, ferredoxin fold, ATP-binding, hydrolase; NMR {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1qup_A Superoxide dismutase 1 copper chaperone; two domains, beta-alpha-beta-BETA-alpha-beta and beta barrel; 1.80A {Saccharomyces cerevisiae} SCOP: b.1.8.1 d.58.17.1 | Back alignment and structure |
|---|
| >1p6t_A Potential copper-transporting ATPase; COPA, P-type ATPase, water-soluble region, beta-alpha-beta- beta-alpha-beta fold; NMR {Bacillus subtilis} SCOP: d.58.17.1 d.58.17.1 PDB: 2rml_A | Back alignment and structure |
|---|
| >2aj0_A Probable cadmium-transporting ATPase; ferrodoxin-like fold, beta-alpha-beta-BETA-alpha-beta, metal binding protein, hydrolase; NMR {Listeria monocytogenes} PDB: 2aj1_A | Back alignment and structure |
|---|
| >2kyz_A Heavy metal binding protein; structural genomics, PSI-biology, protein structure initiative, joint for structural genomics, JCSG; NMR {Thermotoga maritima} | Back alignment and structure |
|---|
| >2rop_A Copper-transporting ATPase 2; wilson protein, mobility, protein-protein interaction, alternative splicing, ATP-binding, copper transport cytoplasm; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ew9_A Copper-transporting ATPase 2; copper trafficking, ferrodoxin-like fold, structural genomics, structural proteomics in europe, spine, hydrolase; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1jk9_B CCS, copper chaperone for superoxide dismutase; protein-protein complex, heterodimer, metallochaperone, amyotrophic lateral sclerosis; 2.90A {Saccharomyces cerevisiae} SCOP: b.1.8.1 d.58.17.1 | Back alignment and structure |
|---|
| >1p6t_A Potential copper-transporting ATPase; COPA, P-type ATPase, water-soluble region, beta-alpha-beta- beta-alpha-beta fold; NMR {Bacillus subtilis} SCOP: d.58.17.1 d.58.17.1 PDB: 2rml_A | Back alignment and structure |
|---|
| >2rop_A Copper-transporting ATPase 2; wilson protein, mobility, protein-protein interaction, alternative splicing, ATP-binding, copper transport cytoplasm; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3j09_A COPA, copper-exporting P-type ATPase A; copper transporter, adenosine triphosph archaeal proteins, cation transport proteins; 10.00A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 177 | ||||
| d1cc8a_ | 72 | d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX | 2e-15 | |
| d1fe0a_ | 66 | d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX | 2e-14 | |
| d1qupa2 | 72 | d.58.17.1 (A:2-73) Copper chaperone for superoxide | 1e-13 | |
| d1sb6a_ | 64 | d.58.17.1 (A:) Copper chaperone {Synechocystis sp. | 5e-10 | |
| d1osda_ | 72 | d.58.17.1 (A:) Mercuric ion binding protein MerP { | 2e-09 | |
| d1cpza_ | 68 | d.58.17.1 (A:) Copper chaperone {Enterococcus hira | 3e-08 | |
| d2ggpb1 | 72 | d.58.17.1 (B:1-72) Copper transporter domain ccc2a | 5e-08 | |
| d2qifa1 | 69 | d.58.17.1 (A:1-69) Copper chaperone {Bacillus subt | 1e-07 | |
| d1p6ta1 | 72 | d.58.17.1 (A:1-72) Potential copper-translocating | 2e-07 | |
| d1kvja_ | 79 | d.58.17.1 (A:) Menkes copper-transporting ATPase { | 3e-07 | |
| d1p6ta2 | 79 | d.58.17.1 (A:73-151) Potential copper-translocatin | 4e-07 | |
| d1mwza_ | 73 | d.58.17.1 (A:) Metal ion-transporting ATPase ZntA, | 2e-06 | |
| d2aw0a_ | 72 | d.58.17.1 (A:) Menkes copper-transporting ATPase { | 3e-06 | |
| d1q8la_ | 84 | d.58.17.1 (A:) Menkes copper-transporting ATPase { | 2e-05 |
| >d1cc8a_ d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 72 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Ferredoxin-like superfamily: HMA, heavy metal-associated domain family: HMA, heavy metal-associated domain domain: ATX1 metallochaperone protein (ATOX1) species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]
Score = 65.2 bits (159), Expect = 2e-15
Identities = 16/79 (20%), Positives = 35/79 (44%), Gaps = 15/79 (18%)
Query: 28 MAIVELMVHMDCEGCEKRIRRAISKIDVFNQFDVQFSFDFIITGVDSLDIDMDKQKVTVT 87
+ + V M C GC + + ++K++ V +DI ++KQ V V
Sbjct: 3 IKHYQFNVVMTCSGCSGAVNKVLTKLE---------------PDVSKIDISLEKQLVDVY 47
Query: 88 GYVDERKVLKVVRRTGRKA 106
+ +L+ +++TG++
Sbjct: 48 TTLPYDFILEKIKKTGKEV 66
|
| >d1fe0a_ d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX1) {Human (Homo sapiens), HAH1 [TaxId: 9606]} Length = 66 | Back information, alignment and structure |
|---|
| >d1qupa2 d.58.17.1 (A:2-73) Copper chaperone for superoxide dismutase, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 72 | Back information, alignment and structure |
|---|
| >d1sb6a_ d.58.17.1 (A:) Copper chaperone {Synechocystis sp. pcc 6803, Scatx1 [TaxId: 1148]} Length = 64 | Back information, alignment and structure |
|---|
| >d1osda_ d.58.17.1 (A:) Mercuric ion binding protein MerP {Ralstonia metallidurans CH34 [TaxId: 266264]} Length = 72 | Back information, alignment and structure |
|---|
| >d1cpza_ d.58.17.1 (A:) Copper chaperone {Enterococcus hirae [TaxId: 1354]} Length = 68 | Back information, alignment and structure |
|---|
| >d2ggpb1 d.58.17.1 (B:1-72) Copper transporter domain ccc2a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 72 | Back information, alignment and structure |
|---|
| >d2qifa1 d.58.17.1 (A:1-69) Copper chaperone {Bacillus subtilis, CopZ [TaxId: 1423]} Length = 69 | Back information, alignment and structure |
|---|
| >d1p6ta1 d.58.17.1 (A:1-72) Potential copper-translocating P-type ATPase CopA (YvgX) {Bacillus subtilis [TaxId: 1423]} Length = 72 | Back information, alignment and structure |
|---|
| >d1kvja_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} Length = 79 | Back information, alignment and structure |
|---|
| >d1p6ta2 d.58.17.1 (A:73-151) Potential copper-translocating P-type ATPase CopA (YvgX) {Bacillus subtilis [TaxId: 1423]} Length = 79 | Back information, alignment and structure |
|---|
| >d1mwza_ d.58.17.1 (A:) Metal ion-transporting ATPase ZntA, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 73 | Back information, alignment and structure |
|---|
| >d2aw0a_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} Length = 72 | Back information, alignment and structure |
|---|
| >d1q8la_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} Length = 84 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 177 | |||
| d1cc8a_ | 72 | ATX1 metallochaperone protein (ATOX1) {Baker's yea | 99.67 | |
| d1fe0a_ | 66 | ATX1 metallochaperone protein (ATOX1) {Human (Homo | 99.67 | |
| d1qupa2 | 72 | Copper chaperone for superoxide dismutase, N-termi | 99.63 | |
| d1sb6a_ | 64 | Copper chaperone {Synechocystis sp. pcc 6803, Scat | 99.53 | |
| d1osda_ | 72 | Mercuric ion binding protein MerP {Ralstonia metal | 99.5 | |
| d2qifa1 | 69 | Copper chaperone {Bacillus subtilis, CopZ [TaxId: | 99.47 | |
| d2ggpb1 | 72 | Copper transporter domain ccc2a {Baker's yeast (Sa | 99.47 | |
| d1cpza_ | 68 | Copper chaperone {Enterococcus hirae [TaxId: 1354] | 99.45 | |
| d2aw0a_ | 72 | Menkes copper-transporting ATPase {Human (Homo sap | 99.44 | |
| d1kvja_ | 79 | Menkes copper-transporting ATPase {Human (Homo sap | 99.44 | |
| d1q8la_ | 84 | Menkes copper-transporting ATPase {Human (Homo sap | 99.4 | |
| d1p6ta1 | 72 | Potential copper-translocating P-type ATPase CopA | 99.4 | |
| d1p6ta2 | 79 | Potential copper-translocating P-type ATPase CopA | 99.39 | |
| d1mwza_ | 73 | Metal ion-transporting ATPase ZntA, N-terminal dom | 99.35 |
| >d1cc8a_ d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Ferredoxin-like superfamily: HMA, heavy metal-associated domain family: HMA, heavy metal-associated domain domain: ATX1 metallochaperone protein (ATOX1) species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]
Probab=99.67 E-value=1.4e-16 Score=110.35 Aligned_cols=66 Identities=24% Similarity=0.528 Sum_probs=62.6
Q ss_pred CceEEEEEEeccchhHHHHHHHHHhhhccccccccccccccccCCceEEEEecCCcEEEEEecCCHHHHHHHHHHcCCce
Q 036482 27 AMAIVELMVHMDCEGCEKRIRRAISKIDVFNQFDVQFSFDFIITGVDSLDIDMDKQKVTVTGYVDERKVLKVVRRTGRKA 106 (177)
Q Consensus 27 ~~qtv~~~V~M~C~gC~~kV~kaL~~l~~~~~~~~~~~~~~~~~GV~sV~vd~~~~kVtVtg~vd~~kll~~l~ktG~~a 106 (177)
+++|++|+|+|+|.+|+.+|+++|++++ +||.++.+|+.+++|+|.|.+++++|+++|+++||++
T Consensus 2 ~~kt~~f~V~MtC~~C~~~Ie~~L~~l~---------------~gV~~v~v~~~~~~v~V~~~~~~~~i~~~i~~~G~~~ 66 (72)
T d1cc8a_ 2 EIKHYQFNVVMTCSGCSGAVNKVLTKLE---------------PDVSKIDISLEKQLVDVYTTLPYDFILEKIKKTGKEV 66 (72)
T ss_dssp CCEEEEEEECCCSHHHHHHHHHHHHTTT---------------TSEEEEEEETTTTEEEEEESSCHHHHHHHHHTTSSCE
T ss_pred CcEEEEEEECcCcHHHHHHHHHHHHcCc---------------CceEEEEEECCCCEEEEeecCCHHHHHHHHHHHCCcc
Confidence 5789999999999999999999999992 4999999999999999999999999999999999998
Q ss_pred E
Q 036482 107 E 107 (177)
Q Consensus 107 e 107 (177)
.
T Consensus 67 ~ 67 (72)
T d1cc8a_ 67 R 67 (72)
T ss_dssp E
T ss_pred C
Confidence 6
|
| >d1fe0a_ d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX1) {Human (Homo sapiens), HAH1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qupa2 d.58.17.1 (A:2-73) Copper chaperone for superoxide dismutase, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1sb6a_ d.58.17.1 (A:) Copper chaperone {Synechocystis sp. pcc 6803, Scatx1 [TaxId: 1148]} | Back information, alignment and structure |
|---|
| >d1osda_ d.58.17.1 (A:) Mercuric ion binding protein MerP {Ralstonia metallidurans CH34 [TaxId: 266264]} | Back information, alignment and structure |
|---|
| >d2qifa1 d.58.17.1 (A:1-69) Copper chaperone {Bacillus subtilis, CopZ [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2ggpb1 d.58.17.1 (B:1-72) Copper transporter domain ccc2a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1cpza_ d.58.17.1 (A:) Copper chaperone {Enterococcus hirae [TaxId: 1354]} | Back information, alignment and structure |
|---|
| >d2aw0a_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kvja_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1q8la_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p6ta1 d.58.17.1 (A:1-72) Potential copper-translocating P-type ATPase CopA (YvgX) {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1p6ta2 d.58.17.1 (A:73-151) Potential copper-translocating P-type ATPase CopA (YvgX) {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1mwza_ d.58.17.1 (A:) Metal ion-transporting ATPase ZntA, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|