Citrus Sinensis ID: 036519

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-----
MENNEKKASASSKLAHCLVLSYPAQGHMNPLLQFSKRLEHNGIKVTLVTTYFISKSLHRDPSSSISIPLETISDGYDEGRSAQAETDQAYVDRFWQIGVQTLTELVERMNDVDCIVYDSFLPWALDVAKKFGLTGAAFLTQSCTVASIYHYVNKGLIKLPLTGDQVFLPGLPPLDPQDTPSFINDPASYPAFFDMILTRQFSNIDKADWILCNTFYELEKEVIKESEQSKLPENFSDETTQKGLVVNWCPQLGVLAHEATGCFLTHCGWNSTIEALRLGVPMLAMPLWTDQSTNSKYVMDVWKMGLKVPADEKGIVRREAIAHCIGEILEGDKWRNFAKEAVAKGGSSDKNIDDFVANLISSKSL
cccccccccccccccEEEEEEcccccccHHHHHHHHHHHHcccEEEEEEcccccccccccccccccccEEEcccccccccccccccHHHHHHHHHHHHHHHHHHHHHHcccccEEEEcccccHHHHHHHHHcccEEEEcccccHHHHHHHHHHHcccccccccccccccccccccccccccccccccccHHHHHHHHHHHHccHHHHHHHHHccccccHHHHHHHHHHccccccccccccccccEEccccHHHHHHcccccEEEEEccccHHHHHHHccccEEcccccccccHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHccHHHHHHHHHHHccccHHHHHHHHHHHHHHHcccc
cccHHccccccccccEEEEEEccccccHHHHHHHHHHHHHcccEEEEEEccccHHHHHHccccccccEEEEcccccccccccccccHHHHHHHHHHHcHHHHHHHHHHcccccEEEEcccHHHHHHHHHHccccEEEEEccHHHHHHHHHHHHccccccccccccccccccccccccccccEEEEccccHHHHHHHHHHHHHHHHHHHHHHccccHEEEccHHcccHHHHccccHHHHHcccccEEccccHHHHHccccEEEEEEcccccHHHHHHHccccEEEccccccccccHHHHHHHHccEEEEcccccccEcHHHHHHHHHHHHccHHHHHHHHHHHHcccccHHHHHHHHHHHHccccc
mennekkasasskLAHCLVlsypaqghmnpllqFSKRLEHNGIKVTLVTTYFISkslhrdpsssisipletisdgydegrsaqaetDQAYVDRFWQIGVQTLTELVERmndvdcivydsflPWALDVAKKFGLTGAAFLTQSCTVASIYHYVNKGliklpltgdqvflpglppldpqdtpsfindpasypafFDMILTRQfsnidkadwILCNTFYELEKEVIKEseqsklpenfsdettqkglvvnwcpqlgvlaheatgcflthcgwnsTIEALRLgvpmlamplwtdqstnskYVMDVWKmglkvpadekgiVRREAIAHCIGEILEGDKWRNFAKEAVakggssdknIDDFVANLISSKSL
MENNEKKASASSKLAHCLVLSYPAQGHMNPLLQFSKRLEHNGIKVTLVTTYFISKslhrdpsssisiPLETISDGYDEGRSAQAETDQAYVDRFWQIGVQTLTELVERMNDVDCIVYDSFLPWALDVAKKFGLTGAAFLTQSCTVASIYHYVNKGLIKLPLTGDQVFLPGLPPLDPQDTPSFINDPASYPAFFDMILTRQFSNIDKADWILCNTFYELEKEVIKeseqsklpenfsdettqkgLVVNWCPQLGVLAHEATGCFLTHCGWNSTIEALRLGVPMLAMPLWTDQSTNSKYVMDVWKMGLkvpadekgiVRREAIAHCIGeilegdkwrNFAKEAvakggssdknidDFVANLISSKSL
MENNEKKASASSKLAHCLVLSYPAQGHMNPLLQFSKRLEHNGIKVTLVTTYFISKSLHRDPSSSISIPLETISDGYDEGRSAQAETDQAYVDRFWQIGVQTLTELVERMNDVDCIVYDSFLPWALDVAKKFGLTGAAFLTQSCTVASIYHYVNKGLIKLPLTGDQVFLPGLPPLDPQDTPSFINDPASYPAFFDMILTRQFSNIDKADWILCNTFYELEKEVIKESEQSKLPENFSDETTQKGLVVNWCPQLGVLAHEATGCFLTHCGWNSTIEALRLGVPMLAMPLWTDQSTNSKYVMDVWKMGLKVPADEKGIVRREAIAHCIGEILEGDKWRNFAKEAVAKGGSSDKNIDDFVANLISSKSL
*************LAHCLVLSYPAQGHMNPLLQFSKRLEHNGIKVTLVTTYFISKS*******************************QAYVDRFWQIGVQTLTELVERMNDVDCIVYDSFLPWALDVAKKFGLTGAAFLTQSCTVASIYHYVNKGLIKLPLTGDQVFLPGLPPL******SFINDPASYPAFFDMILTRQFSNIDKADWILCNTFYELEKEVI******************KGLVVNWCPQLGVLAHEATGCFLTHCGWNSTIEALRLGVPMLAMPLWTDQSTNSKYVMDVWKMGLKVPADEKGIVRREAIAHCIGEILEGDKWRNFAKEAV***********************
*****************LVLSYPAQGHMNPLLQFSKRLEHNGIKVTLVTTYFISK**********SIPLETISDGYDEGRSAQAETDQAYVDRFWQIGVQTLTELVERMNDVDCIVYDSFLPWALDVAKKFGLTGAAFLTQSCTVASIYHYVNKGLIKLPLTGDQVFLPGLPPLDPQDTPSFINDPASYPAFFDMILTRQFSNIDKADWILCNTFYELEKEVIKESEQSKLPENFSDETTQKGLVVNWCPQLGVLAHEATGCFLTHCGWNSTIEALRLGVPMLAMPLWTDQSTNSKYVMDVWKMGLKVPADEKGIVRREAIAHCIGEILEGDKWRNFAKE****GGSSDKNIDDFVANLISSK**
************KLAHCLVLSYPAQGHMNPLLQFSKRLEHNGIKVTLVTTYFISKSLHRDPSSSISIPLETISDGYDEGRSAQAETDQAYVDRFWQIGVQTLTELVERMNDVDCIVYDSFLPWALDVAKKFGLTGAAFLTQSCTVASIYHYVNKGLIKLPLTGDQVFLPGLPPLDPQDTPSFINDPASYPAFFDMILTRQFSNIDKADWILCNTFYELEKEVIKESEQSKLPENFSDETTQKGLVVNWCPQLGVLAHEATGCFLTHCGWNSTIEALRLGVPMLAMPLWTDQSTNSKYVMDVWKMGLKVPADEKGIVRREAIAHCIGEILEGDKWRNFAKEAVAKGGSSDKNIDDFVANLISSKSL
************KLAHCLVLSYPAQGHMNPLLQFSKRLEHNGIKVTLVTTYFISKSLHRDPSSSISIPLETISDGYDEGRSAQAETDQAYVDRFWQIGVQTLTELVERMNDVDCIVYDSFLPWALDVAKKFGLTGAAFLTQSCTVASIYHYVNKGLIKLPLTGDQVFLPGLPPLDPQDTPSFINDPASYPAFFDMILTRQFSNIDKADWILCNTFYELEKEVIKESEQSKLPENFSDETTQKGLVVNWCPQLGVLAHEATGCFLTHCGWNSTIEALRLGVPMLAMPLWTDQSTNSKYVMDVWKMGLKVPADEKGIVRREAIAHCIGEILEGDKWRNFAKEAVAKGGSSDKNIDDFVANLIS****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MENNEKKASASSKLAHCLVLSYPAQGHMNPLLQFSKRLEHNGIKVTLVTTYFISKSLHRDPSSSISIPLETISDGYDEGRSAQAETDQAYVDRFWQIGVQTLTELVERMNDVDCIVYDSFLPWALDVAKKFGLTGAAFLTQSCTVASIYHYVNKGLIKLPLTGDQVFLPGLPPLDPQDTPSFINDPASYPAFFDMILTRQFSNIDKADWILCNTFYELEKEVIKESEQSKLPENFSDETTQKGLVVNWCPQLGVLAHEATGCFLTHCGWNSTIEALRLGVPMLAMPLWTDQSTNSKYVMDVWKMGLKVPADEKGIVRREAIAHCIGEILEGDKWRNFAKEAVAKGGSSDKNIDDFVANLISSKSL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query365 2.2.26 [Sep-21-2011]
O22822449 UDP-glycosyltransferase 7 yes no 0.539 0.438 0.446 2e-44
Q9SYK9453 UDP-glycosyltransferase 7 no no 0.372 0.300 0.541 3e-44
O22820449 UDP-glycosyltransferase 7 no no 0.534 0.434 0.436 1e-43
P0C7P7453 UDP-glycosyltransferase 7 no no 0.372 0.300 0.527 4e-43
Q9SKC5456 UDP-glycosyltransferase 7 no no 0.380 0.304 0.509 7e-43
Q9SKC1457 UDP-glycosyltransferase 7 no no 0.375 0.299 0.536 1e-41
Q6X1C0460 Crocetin glucosyltransfer N/A no 0.369 0.293 0.489 6e-38
O48676460 UDP-glycosyltransferase 7 no no 0.375 0.297 0.466 3e-36
Q41819 471 Indole-3-acetate beta-glu N/A no 0.556 0.430 0.380 2e-35
Q9ZVY5455 UDP-glycosyltransferase 7 no no 0.345 0.276 0.437 4e-32
>sp|O22822|U74F2_ARATH UDP-glycosyltransferase 74F2 OS=Arabidopsis thaliana GN=UGT74F2 PE=1 SV=1 Back     alignment and function desciption
 Score =  180 bits (456), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 95/213 (44%), Positives = 131/213 (61%), Gaps = 16/213 (7%)

Query: 13  KLAHCLVLSYPAQGHMNPLLQFSKRLEHNGIKVTLVTTYFISKSLHRDPSSSISIPLETI 72
           K  H L + YP QGH+ P  QF KRL   G+K TL  T F+  S++ D S  ISI   TI
Sbjct: 4   KRGHVLAVPYPTQGHITPFRQFCKRLHFKGLKTTLALTTFVFNSINPDLSGPISIA--TI 61

Query: 73  SDGYDEGRSAQAETDQAYVDRFWQIGVQTLTELVERM----NDVDCIVYDSFLPWALDVA 128
           SDGYD G    A++   Y+  F   G +T+ +++++     N + CIVYD+FLPWALDVA
Sbjct: 62  SDGYDHGGFETADSIDDYLKDFKTSGSKTIADIIQKHQTSDNPITCIVYDAFLPWALDVA 121

Query: 129 KKFGLTGAAFLTQSCTVASIYH--YVNKGLIKLPLTGDQVFLPGLPPLDPQDTPSFINDP 186
           ++FGL    F TQ C V  +Y+  Y+N G ++LP+         LP L+ QD PSF +  
Sbjct: 122 REFGLVATPFFTQPCAVNYVYYLSYINNGSLQLPIE-------ELPFLELQDLPSFFSVS 174

Query: 187 ASYPAFFDMILTRQFSNIDKADWILCNTFYELE 219
            SYPA+F+M+L +QF N +KAD++L N+F ELE
Sbjct: 175 GSYPAYFEMVL-QQFINFEKADFVLVNSFQELE 206
Glycosyltransferase that glucosylates benzoic acid and derivatives. Substrate preference is benzoic acid > salicylic acid (SA) > 3-hydroxybenzoic acid > 4-hydroxybenzoic acid. Catalyzes the formation of both SA 2-O-beta-D-glucoside (SAG) and SA glucose ester (SGE). Has high affinity for the tryptophan precursor anthranilate. Catalyzes the formation of anthranilate glucose ester. Is the major source of this activity in the plant.
Arabidopsis thaliana (taxid: 3702)
EC: 2EC: .EC: 4EC: .EC: 1EC: .EC: -
>sp|Q9SYK9|U74E2_ARATH UDP-glycosyltransferase 74E2 OS=Arabidopsis thaliana GN=UGT74E2 PE=1 SV=1 Back     alignment and function description
>sp|O22820|U74F1_ARATH UDP-glycosyltransferase 74F1 OS=Arabidopsis thaliana GN=UGT74F1 PE=1 SV=1 Back     alignment and function description
>sp|P0C7P7|U74E1_ARATH UDP-glycosyltransferase 74E1 OS=Arabidopsis thaliana GN=UGT74E1 PE=3 SV=1 Back     alignment and function description
>sp|Q9SKC5|U74D1_ARATH UDP-glycosyltransferase 74D1 OS=Arabidopsis thaliana GN=UGT74D1 PE=1 SV=1 Back     alignment and function description
>sp|Q9SKC1|U74C1_ARATH UDP-glycosyltransferase 74C1 OS=Arabidopsis thaliana GN=UGT74C1 PE=2 SV=1 Back     alignment and function description
>sp|Q6X1C0|GLT2_CROSA Crocetin glucosyltransferase 2 OS=Crocus sativus GN=GLT2 PE=1 SV=1 Back     alignment and function description
>sp|O48676|U74B1_ARATH UDP-glycosyltransferase 74B1 OS=Arabidopsis thaliana GN=UGT74B1 PE=1 SV=1 Back     alignment and function description
>sp|Q41819|IABG_MAIZE Indole-3-acetate beta-glucosyltransferase OS=Zea mays GN=IAGLU PE=1 SV=1 Back     alignment and function description
>sp|Q9ZVY5|U75B2_ARATH UDP-glycosyltransferase 75B2 OS=Arabidopsis thaliana GN=UGT75B2 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query365
296086886413 unnamed protein product [Vitis vinifera] 0.934 0.825 0.476 2e-95
242199344 468 UDP-glucosyltransferase family 1 protein 0.605 0.472 0.718 8e-87
147851962 1122 hypothetical protein VITISV_017236 [Viti 0.712 0.231 0.494 3e-73
224129334459 predicted protein [Populus trichocarpa] 0.564 0.448 0.646 7e-71
225468356456 PREDICTED: UDP-glycosyltransferase 74E2 0.561 0.449 0.615 6e-70
359480385456 PREDICTED: UDP-glycosyltransferase 74E2- 0.561 0.449 0.605 7e-69
82658820401 UDP-glucosyltransferase [Ixeris dentata 0.945 0.860 0.375 9e-68
359480393456 PREDICTED: UDP-glycosyltransferase 74E2 0.561 0.449 0.596 2e-66
255583381458 UDP-glucosyltransferase, putative [Ricin 0.578 0.460 0.587 6e-64
356546201455 PREDICTED: UDP-glycosyltransferase 74E1- 0.580 0.465 0.533 3e-63
>gi|296086886|emb|CBI33059.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  355 bits (911), Expect = 2e-95,   Method: Compositional matrix adjust.
 Identities = 193/405 (47%), Positives = 248/405 (61%), Gaps = 64/405 (15%)

Query: 15  AHCLVLSYPAQGHMNPLLQFSKRLEHNGIKVTLVTTYFISKSLHRDPSSSISIPLETISD 74
           AHC+VL YP+QGH+NP+LQFSKRL HNG KVTL  T FISKS   D   S  I +ETISD
Sbjct: 10  AHCIVLPYPSQGHINPMLQFSKRLVHNGAKVTLAATRFISKSFVGD---SGPITIETISD 66

Query: 75  GYDEGRSAQAETDQAYVDRFWQIGVQTLTELVERMND----VDCIVYDSFLPWALDVAKK 130
           GYDEG SAQAE+D AY++RF  +G +TL  L+E++      VDC+VYD+FLPWALDVAK+
Sbjct: 67  GYDEGGSAQAESDGAYLERFRVVGSETLGSLIEKLKSSGCPVDCVVYDAFLPWALDVAKQ 126

Query: 131 FGLTGAAFLTQSCTVASIYHYVNKGLIKLPLTGDQVFLPGLPPLDPQDTPSFINDPASYP 190
            GL GA F TQSCTV  IY++V++G++KLPL+  +V +PGL PL   D PSF+    SYP
Sbjct: 127 LGLVGAVFFTQSCTVNDIYYHVHQGMLKLPLSEPEVVVPGLFPLQACDLPSFVYLYGSYP 186

Query: 191 AFFDMILTRQFSNIDKADWILCNTFYELEKEVIK--------ESEQSKLPENFSDETTQ- 241
           AFFDM++  QFSNI+K DW+ CNTFY+LE++V+          +    LP  + D+    
Sbjct: 187 AFFDMVVN-QFSNIEKVDWVFCNTFYKLEEKVVDWMAKICPLRTIGPTLPSVYLDKRLGD 245

Query: 242 ------------KGLVVNWCPQL--GVLAHEATGCFLT---------------------- 265
                        G  + W      G + + +   FL                       
Sbjct: 246 DKDYGLNMLKPVTGACMEWLDSKPNGSVVYASNAYFLVVVRESEQAKLPQNFKEETAEKG 305

Query: 266 -HCGWNSTIEALRLGVPMLAMPLWTDQSTNSKYVMDVWKMGLKVPADEKGIVRREAIAHC 324
               W   +EAL LGVPM+  PLWTDQ TN+K+V DVW +GL+  AD KGIVRRE +  C
Sbjct: 306 LVVSWCPQLEALSLGVPMVVAPLWTDQPTNAKFVEDVWGIGLRARADHKGIVRREVLEDC 365

Query: 325 IGEILEGD----------KWRNFAKEAVAKGGSSDKNIDDFVANL 359
           IG+++  D          KW+N A+EAV +GGSSDK ID+FVA L
Sbjct: 366 IGKVMGSDGLKEIKNNAMKWKNLAREAVDEGGSSDKCIDEFVAKL 410

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|242199344|gb|ACS87993.1| UDP-glucosyltransferase family 1 protein [Citrus sinensis] Back     alignment and taxonomy information
>gi|147851962|emb|CAN80193.1| hypothetical protein VITISV_017236 [Vitis vinifera] Back     alignment and taxonomy information
>gi|224129334|ref|XP_002320558.1| predicted protein [Populus trichocarpa] gi|222861331|gb|EEE98873.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|225468356|ref|XP_002273866.1| PREDICTED: UDP-glycosyltransferase 74E2 isoform 1 [Vitis vinifera] Back     alignment and taxonomy information
>gi|359480385|ref|XP_003632443.1| PREDICTED: UDP-glycosyltransferase 74E2-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|82658820|gb|ABB88579.1| UDP-glucosyltransferase [Ixeris dentata var. albiflora] Back     alignment and taxonomy information
>gi|359480393|ref|XP_002269003.2| PREDICTED: UDP-glycosyltransferase 74E2 [Vitis vinifera] Back     alignment and taxonomy information
>gi|255583381|ref|XP_002532451.1| UDP-glucosyltransferase, putative [Ricinus communis] gi|223527841|gb|EEF29937.1| UDP-glucosyltransferase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|356546201|ref|XP_003541519.1| PREDICTED: UDP-glycosyltransferase 74E1-like [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query365
TAIR|locus:2043949449 UGT74F2 "UDP-glucosyltransfera 0.539 0.438 0.446 4.5e-82
TAIR|locus:2044044449 UGT74F1 "UDP-glycosyltransfera 0.545 0.443 0.439 9.4e-82
TAIR|locus:2031983453 UGT74E2 "AT1G05680" [Arabidops 0.372 0.300 0.541 2.2e-78
TAIR|locus:2045268457 AT2G31790 [Arabidopsis thalian 0.375 0.299 0.530 1.4e-74
TAIR|locus:2045238456 UGT74D1 "UDP-glucosyl transfer 0.380 0.304 0.509 5.9e-74
TAIR|locus:2032387460 UGT74B1 "UDP-glucosyl transfer 0.375 0.297 0.466 8.7e-69
TAIR|locus:2130215479 UGT84A3 "AT4G15490" [Arabidops 0.356 0.271 0.450 9.5e-55
TAIR|locus:2130359474 IAGLU "indole-3-acetate beta-D 0.4 0.308 0.409 6.8e-54
TAIR|locus:2201031469 UGT75B1 "UDP-glucosyltransfera 0.424 0.330 0.407 1.3e-53
TAIR|locus:2130205490 UGT84A1 "AT4G15480" [Arabidops 0.364 0.271 0.424 9.1e-53
TAIR|locus:2043949 UGT74F2 "UDP-glucosyltransferase 74F2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 448 (162.8 bits), Expect = 4.5e-82, Sum P(2) = 4.5e-82
 Identities = 95/213 (44%), Positives = 131/213 (61%)

Query:    13 KLAHCLVLSYPAQGHMNPLLQFSKRLEHNGIKVTLVTTYFISKSLHRDPSSSISIPLETI 72
             K  H L + YP QGH+ P  QF KRL   G+K TL  T F+  S++ D S  ISI   TI
Sbjct:     4 KRGHVLAVPYPTQGHITPFRQFCKRLHFKGLKTTLALTTFVFNSINPDLSGPISIA--TI 61

Query:    73 SDGYDEGRSAQAETDQAYVDRFWQIGVQTLTELVERM----NDVDCIVYDSFLPWALDVA 128
             SDGYD G    A++   Y+  F   G +T+ +++++     N + CIVYD+FLPWALDVA
Sbjct:    62 SDGYDHGGFETADSIDDYLKDFKTSGSKTIADIIQKHQTSDNPITCIVYDAFLPWALDVA 121

Query:   129 KKFGLTGAAFLTQSCTVASIYH--YVNKGLIKLPLTGDQVFLPGLPPLDPQDTPSFINDP 186
             ++FGL    F TQ C V  +Y+  Y+N G ++LP+         LP L+ QD PSF +  
Sbjct:   122 REFGLVATPFFTQPCAVNYVYYLSYINNGSLQLPIEE-------LPFLELQDLPSFFSVS 174

Query:   187 ASYPAFFDMILTRQFSNIDKADWILCNTFYELE 219
              SYPA+F+M+L +QF N +KAD++L N+F ELE
Sbjct:   175 GSYPAYFEMVL-QQFINFEKADFVLVNSFQELE 206
GO:0005737 "cytoplasm" evidence=ISM
GO:0008152 "metabolic process" evidence=IEA
GO:0008194 "UDP-glycosyltransferase activity" evidence=ISS
GO:0016757 "transferase activity, transferring glycosyl groups" evidence=ISS
GO:0016758 "transferase activity, transferring hexosyl groups" evidence=IEA;ISS
GO:0018874 "benzoate metabolic process" evidence=IDA
GO:0035251 "UDP-glucosyltransferase activity" evidence=IDA;TAS
GO:0052639 "salicylic acid glucosyltransferase (ester-forming) activity" evidence=IDA
GO:0052640 "salicylic acid glucosyltransferase (glucoside-forming) activity" evidence=IDA
GO:0052641 "benzoic acid glucosyltransferase activity" evidence=IDA
GO:0009696 "salicylic acid metabolic process" evidence=IMP
GO:0046482 "para-aminobenzoic acid metabolic process" evidence=RCA;IDA
GO:0080002 "UDP-glucose:4-aminobenzoate acylglucosyltransferase activity" evidence=IDA
GO:0010167 "response to nitrate" evidence=RCA
GO:0015706 "nitrate transport" evidence=RCA
TAIR|locus:2044044 UGT74F1 "UDP-glycosyltransferase 74 F1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2031983 UGT74E2 "AT1G05680" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2045268 AT2G31790 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2045238 UGT74D1 "UDP-glucosyl transferase 74D1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2032387 UGT74B1 "UDP-glucosyl transferase 74B1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2130215 UGT84A3 "AT4G15490" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2130359 IAGLU "indole-3-acetate beta-D-glucosyltransferase" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2201031 UGT75B1 "UDP-glucosyltransferase 75B1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2130205 UGT84A1 "AT4G15480" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer2.4.10.766

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
fgenesh4_pm.C_LG_XIV000523
hypothetical protein (459 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query365
PLN02173449 PLN02173, PLN02173, UDP-glucosyl transferase famil 5e-57
PLN02173449 PLN02173, PLN02173, UDP-glucosyl transferase famil 2e-47
PLN02555480 PLN02555, PLN02555, limonoid glucosyltransferase 5e-41
PLN02152455 PLN02152, PLN02152, indole-3-acetate beta-glucosyl 9e-39
PLN02448459 PLN02448, PLN02448, UDP-glycosyltransferase family 2e-38
PLN02555 480 PLN02555, PLN02555, limonoid glucosyltransferase 6e-37
PLN02863477 PLN02863, PLN02863, UDP-glucoronosyl/UDP-glucosyl 8e-27
PLN02210456 PLN02210, PLN02210, UDP-glucosyl transferase 5e-26
PLN03007482 PLN03007, PLN03007, UDP-glucosyltransferase family 2e-25
PLN02410451 PLN02410, PLN02410, UDP-glucoronosyl/UDP-glucosyl 2e-25
PLN02167475 PLN02167, PLN02167, UDP-glycosyltransferase family 2e-24
PLN02554481 PLN02554, PLN02554, UDP-glycosyltransferase family 2e-22
PLN02562448 PLN02562, PLN02562, UDP-glycosyltransferase 9e-22
PLN02152455 PLN02152, PLN02152, indole-3-acetate beta-glucosyl 3e-21
PLN02992481 PLN02992, PLN02992, coniferyl-alcohol glucosyltran 3e-21
PLN02534491 PLN02534, PLN02534, UDP-glycosyltransferase 6e-21
PLN00164480 PLN00164, PLN00164, glucosyltransferase; Provision 3e-20
PLN03004451 PLN03004, PLN03004, UDP-glycosyltransferase 1e-19
PLN02207468 PLN02207, PLN02207, UDP-glycosyltransferase 9e-19
PLN02670472 PLN02670, PLN02670, transferase, transferring glyc 3e-18
PLN02210456 PLN02210, PLN02210, UDP-glucosyl transferase 4e-18
PLN03015470 PLN03015, PLN03015, UDP-glucosyl transferase 5e-18
PLN02448459 PLN02448, PLN02448, UDP-glycosyltransferase family 9e-18
cd03784401 cd03784, GT1_Gtf_like, This family includes the Gt 1e-16
PLN02562448 PLN02562, PLN02562, UDP-glycosyltransferase 1e-14
pfam00201500 pfam00201, UDPGT, UDP-glucoronosyl and UDP-glucosy 3e-14
PLN02764453 PLN02764, PLN02764, glycosyltransferase family pro 3e-12
COG1819406 COG1819, COG1819, Glycosyl transferases, related t 1e-10
TIGR01426392 TIGR01426, MGT, glycosyltransferase, MGT family 1e-10
PLN02208442 PLN02208, PLN02208, glycosyltransferase family pro 2e-10
PLN00414446 PLN00414, PLN00414, glycosyltransferase family pro 6e-09
PLN02410451 PLN02410, PLN02410, UDP-glucoronosyl/UDP-glucosyl 8e-09
PLN03007 482 PLN03007, PLN03007, UDP-glucosyltransferase family 6e-08
PHA03392507 PHA03392, egt, ecdysteroid UDP-glucosyltransferase 8e-07
PLN02534 491 PLN02534, PLN02534, UDP-glycosyltransferase 2e-06
PLN02670 472 PLN02670, PLN02670, transferase, transferring glyc 7e-06
PLN02863 477 PLN02863, PLN02863, UDP-glucoronosyl/UDP-glucosyl 2e-05
PLN02992 481 PLN02992, PLN02992, coniferyl-alcohol glucosyltran 0.004
>gnl|CDD|177830 PLN02173, PLN02173, UDP-glucosyl transferase family protein Back     alignment and domain information 
 Score =  191 bits (487), Expect = 5e-57
 Identities = 92/210 (43%), Positives = 133/210 (63%), Gaps = 16/210 (7%)

Query: 16  HCLVLSYPAQGHMNPLLQFSKRLEHNGIKVTLVTTYFISKSLHRDPSSSISIPLETISDG 75
           H L + +P+QGH+ P+ QF KRL   G K T   T FI  ++H DPSS ISI   TISDG
Sbjct: 7   HVLAVPFPSQGHITPIRQFCKRLHSKGFKTTHTLTTFIFNTIHLDPSSPISIA--TISDG 64

Query: 76  YDEGRSAQAETDQAYVDRFWQIGVQTLTELVERM----NDVDCIVYDSFLPWALDVAKKF 131
           YD+G  + A +   Y+  F   G +T+ +++ +     N + CIVYDSF+PWALD+A++F
Sbjct: 65  YDQGGFSSAGSVPEYLQNFKTFGSKTVADIIRKHQSTDNPITCIVYDSFMPWALDLAREF 124

Query: 132 GLTGAAFLTQSCTVASIYH--YVNKGLIKLPLTGDQVFLPGLPPLDPQDTPSFINDPASY 189
           GL  A F TQSC V  I +  Y+N G + LP+         LP L+ QD P+F+    S+
Sbjct: 125 GLAAAPFFTQSCAVNYINYLSYINNGSLTLPIK-------DLPLLELQDLPTFVTPTGSH 177

Query: 190 PAFFDMILTRQFSNIDKADWILCNTFYELE 219
            A+F+M+L +QF+N DKAD++L N+F++L+
Sbjct: 178 LAYFEMVL-QQFTNFDKADFVLVNSFHDLD 206

Length = 449
>gnl|CDD|177830 PLN02173, PLN02173, UDP-glucosyl transferase family protein Back     alignment and domain information
>gnl|CDD|178170 PLN02555, PLN02555, limonoid glucosyltransferase Back     alignment and domain information
>gnl|CDD|177813 PLN02152, PLN02152, indole-3-acetate beta-glucosyltransferase Back     alignment and domain information
>gnl|CDD|215247 PLN02448, PLN02448, UDP-glycosyltransferase family protein Back     alignment and domain information
>gnl|CDD|178170 PLN02555, PLN02555, limonoid glucosyltransferase Back     alignment and domain information
>gnl|CDD|215465 PLN02863, PLN02863, UDP-glucoronosyl/UDP-glucosyl transferase family protein Back     alignment and domain information
>gnl|CDD|215127 PLN02210, PLN02210, UDP-glucosyl transferase Back     alignment and domain information
>gnl|CDD|178584 PLN03007, PLN03007, UDP-glucosyltransferase family protein Back     alignment and domain information
>gnl|CDD|178032 PLN02410, PLN02410, UDP-glucoronosyl/UDP-glucosyl transferase family protein Back     alignment and domain information
>gnl|CDD|215112 PLN02167, PLN02167, UDP-glycosyltransferase family protein Back     alignment and domain information
>gnl|CDD|215304 PLN02554, PLN02554, UDP-glycosyltransferase family protein Back     alignment and domain information
>gnl|CDD|215305 PLN02562, PLN02562, UDP-glycosyltransferase Back     alignment and domain information
>gnl|CDD|177813 PLN02152, PLN02152, indole-3-acetate beta-glucosyltransferase Back     alignment and domain information
>gnl|CDD|178572 PLN02992, PLN02992, coniferyl-alcohol glucosyltransferase Back     alignment and domain information
>gnl|CDD|215293 PLN02534, PLN02534, UDP-glycosyltransferase Back     alignment and domain information
>gnl|CDD|215084 PLN00164, PLN00164, glucosyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|178581 PLN03004, PLN03004, UDP-glycosyltransferase Back     alignment and domain information
>gnl|CDD|177857 PLN02207, PLN02207, UDP-glycosyltransferase Back     alignment and domain information
>gnl|CDD|178275 PLN02670, PLN02670, transferase, transferring glycosyl groups Back     alignment and domain information
>gnl|CDD|215127 PLN02210, PLN02210, UDP-glucosyl transferase Back     alignment and domain information
>gnl|CDD|178589 PLN03015, PLN03015, UDP-glucosyl transferase Back     alignment and domain information
>gnl|CDD|215247 PLN02448, PLN02448, UDP-glycosyltransferase family protein Back     alignment and domain information
>gnl|CDD|99960 cd03784, GT1_Gtf_like, This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin Back     alignment and domain information
>gnl|CDD|215305 PLN02562, PLN02562, UDP-glycosyltransferase Back     alignment and domain information
>gnl|CDD|201077 pfam00201, UDPGT, UDP-glucoronosyl and UDP-glucosyl transferase Back     alignment and domain information
>gnl|CDD|178364 PLN02764, PLN02764, glycosyltransferase family protein Back     alignment and domain information
>gnl|CDD|224732 COG1819, COG1819, Glycosyl transferases, related to UDP-glucuronosyltransferase [Carbohydrate transport and metabolism / Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|233407 TIGR01426, MGT, glycosyltransferase, MGT family Back     alignment and domain information
>gnl|CDD|177858 PLN02208, PLN02208, glycosyltransferase family protein Back     alignment and domain information
>gnl|CDD|177807 PLN00414, PLN00414, glycosyltransferase family protein Back     alignment and domain information
>gnl|CDD|178032 PLN02410, PLN02410, UDP-glucoronosyl/UDP-glucosyl transferase family protein Back     alignment and domain information
>gnl|CDD|178584 PLN03007, PLN03007, UDP-glucosyltransferase family protein Back     alignment and domain information
>gnl|CDD|223071 PHA03392, egt, ecdysteroid UDP-glucosyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|215293 PLN02534, PLN02534, UDP-glycosyltransferase Back     alignment and domain information
>gnl|CDD|178275 PLN02670, PLN02670, transferase, transferring glycosyl groups Back     alignment and domain information
>gnl|CDD|215465 PLN02863, PLN02863, UDP-glucoronosyl/UDP-glucosyl transferase family protein Back     alignment and domain information
>gnl|CDD|178572 PLN02992, PLN02992, coniferyl-alcohol glucosyltransferase Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 365
PLN02555480 limonoid glucosyltransferase 100.0
PLN02173449 UDP-glucosyl transferase family protein 100.0
PLN02410451 UDP-glucoronosyl/UDP-glucosyl transferase family p 100.0
PLN02562448 UDP-glycosyltransferase 100.0
PLN02210456 UDP-glucosyl transferase 100.0
PLN02152455 indole-3-acetate beta-glucosyltransferase 100.0
PLN02863477 UDP-glucoronosyl/UDP-glucosyl transferase family p 100.0
PLN02448459 UDP-glycosyltransferase family protein 100.0
PLN02208442 glycosyltransferase family protein 100.0
PLN02554481 UDP-glycosyltransferase family protein 100.0
PLN02992481 coniferyl-alcohol glucosyltransferase 100.0
PLN02207468 UDP-glycosyltransferase 100.0
PLN02764453 glycosyltransferase family protein 100.0
PLN00164480 glucosyltransferase; Provisional 100.0
PLN02670472 transferase, transferring glycosyl groups 100.0
PLN02534491 UDP-glycosyltransferase 100.0
PLN03007482 UDP-glucosyltransferase family protein 100.0
PLN03004451 UDP-glycosyltransferase 100.0
PLN00414446 glycosyltransferase family protein 100.0
PLN02167475 UDP-glycosyltransferase family protein 100.0
PLN03015470 UDP-glucosyl transferase 100.0
cd03784401 GT1_Gtf_like This family includes the Gtfs, a grou 100.0
TIGR01426392 MGT glycosyltransferase, MGT family. This model de 100.0
COG1819406 Glycosyl transferases, related to UDP-glucuronosyl 100.0
PF00201500 UDPGT: UDP-glucoronosyl and UDP-glucosyl transfera 100.0
PHA03392507 egt ecdysteroid UDP-glucosyltransferase; Provision 100.0
KOG1192496 consensus UDP-glucuronosyl and UDP-glucosyl transf 99.97
PRK12446352 undecaprenyldiphospho-muramoylpentapeptide beta-N- 99.95
COG0707357 MurG UDP-N-acetylglucosamine:LPS N-acetylglucosami 99.94
PF13528318 Glyco_trans_1_3: Glycosyl transferase family 1 99.93
TIGR00661321 MJ1255 conserved hypothetical protein. This model 99.93
PRK00726357 murG undecaprenyldiphospho-muramoylpentapeptide be 99.86
cd03785350 GT1_MurG MurG is an N-acetylglucosaminyltransferas 99.78
TIGR01133348 murG undecaprenyldiphospho-muramoylpentapeptide be 99.76
TIGR00215385 lpxB lipid-A-disaccharide synthase. Lipid-A precur 99.71
PRK13609380 diacylglycerol glucosyltransferase; Provisional 99.64
PRK00025380 lpxB lipid-A-disaccharide synthase; Reviewed 99.63
COG4671400 Predicted glycosyl transferase [General function p 99.62
TIGR03590279 PseG pseudaminic acid biosynthesis-associated prot 99.54
PF03033139 Glyco_transf_28: Glycosyltransferase family 28 N-t 99.54
PF04101167 Glyco_tran_28_C: Glycosyltransferase family 28 C-t 99.53
PRK13608391 diacylglycerol glucosyltransferase; Provisional 99.48
TIGR03492396 conserved hypothetical protein. This protein famil 99.45
COG3980318 spsG Spore coat polysaccharide biosynthesis protei 99.35
cd03823359 GT1_ExpE7_like This family is most closely related 99.26
PLN02605382 monogalactosyldiacylglycerol synthase 99.24
cd03814364 GT1_like_2 This family is most closely related to 99.22
cd03800398 GT1_Sucrose_synthase This family is most closely r 99.04
PLN02871465 UDP-sulfoquinovose:DAG sulfoquinovosyltransferase 99.03
cd03808359 GT1_cap1E_like This family is most closely related 99.03
cd03801374 GT1_YqgM_like This family is most closely related 99.01
cd03794394 GT1_wbuB_like This family is most closely related 98.99
cd04962371 GT1_like_5 This family is most closely related to 98.99
PRK10307412 putative glycosyl transferase; Provisional 98.96
cd03817374 GT1_UGDG_like This family is most closely related 98.96
cd03798377 GT1_wlbH_like This family is most closely related 98.82
cd03816415 GT1_ALG1_like This family is most closely related 98.82
cd03825365 GT1_wcfI_like This family is most closely related 98.81
cd03786363 GT1_UDP-GlcNAc_2-Epimerase Bacterial members of th 98.81
PRK14089347 ipid-A-disaccharide synthase; Provisional 98.8
cd03820348 GT1_amsD_like This family is most closely related 98.8
cd03805392 GT1_ALG2_like This family is most closely related 98.78
PF04007335 DUF354: Protein of unknown function (DUF354); Inte 98.77
PRK05749425 3-deoxy-D-manno-octulosonic-acid transferase; Revi 98.75
TIGR00236365 wecB UDP-N-acetylglucosamine 2-epimerase. Epimeras 98.75
cd03818396 GT1_ExpC_like This family is most closely related 98.75
cd03795357 GT1_like_4 This family is most closely related to 98.72
cd03819355 GT1_WavL_like This family is most closely related 98.69
TIGR03449405 mycothiol_MshA UDP-N-acetylglucosamine: 1L-myo-ino 98.66
cd03796398 GT1_PIG-A_like This family is most closely related 98.57
cd03802335 GT1_AviGT4_like This family is most closely relate 98.55
cd03821375 GT1_Bme6_like This family is most closely related 98.55
cd03822366 GT1_ecORF704_like This family is most closely rela 98.53
cd03807365 GT1_WbnK_like This family is most closely related 98.47
cd03799355 GT1_amsK_like This is a family of GT1 glycosyltran 98.47
cd03811353 GT1_WabH_like This family is most closely related 98.45
TIGR02472439 sucr_P_syn_N sucrose-phosphate synthase, putative, 98.44
COG0381383 WecB UDP-N-acetylglucosamine 2-epimerase [Cell env 98.4
TIGR02468 1050 sucrsPsyn_pln sucrose phosphate synthase/possible 98.39
cd04951360 GT1_WbdM_like This family is most closely related 98.39
PRK09922359 UDP-D-galactose:(glucosyl)lipopolysaccharide-1,6-D 98.33
PRK15179694 Vi polysaccharide biosynthesis protein TviE; Provi 98.31
cd04955363 GT1_like_6 This family is most closely related to 98.31
TIGR03087397 stp1 sugar transferase, PEP-CTERM/EpsH1 system ass 98.25
TIGR03088374 stp2 sugar transferase, PEP-CTERM/EpsH1 system ass 98.24
cd03812358 GT1_CapH_like This family is most closely related 98.22
PLN02275371 transferase, transferring glycosyl groups 98.14
COG1519419 KdtA 3-deoxy-D-manno-octulosonic-acid transferase 98.11
PLN02846462 digalactosyldiacylglycerol synthase 98.01
KOG3349170 consensus Predicted glycosyltransferase [General f 97.99
cd03792372 GT1_Trehalose_phosphorylase Trehalose phosphorylas 97.97
cd03809365 GT1_mtfB_like This family is most closely related 97.92
PRK01021608 lpxB lipid-A-disaccharide synthase; Reviewed 97.83
TIGR03568365 NeuC_NnaA UDP-N-acetyl-D-glucosamine 2-epimerase, 97.82
PRK00654466 glgA glycogen synthase; Provisional 97.75
PRK15427406 colanic acid biosynthesis glycosyltransferase WcaL 97.73
PF00534172 Glycos_transf_1: Glycosyl transferases group 1; In 97.69
PLN023161036 synthase/transferase 97.68
cd05844367 GT1_like_7 Glycosyltransferases catalyze the trans 97.65
PRK15484380 lipopolysaccharide 1,2-N-acetylglucosaminetransfer 97.65
cd04946407 GT1_AmsK_like This family is most closely related 97.57
cd03791476 GT1_Glycogen_synthase_DULL1_like This family is mo 97.52
cd01635229 Glycosyltransferase_GTB_type Glycosyltransferases 97.49
PF02684373 LpxB: Lipid-A-disaccharide synthetase; InterPro: I 97.39
cd03806419 GT1_ALG11_like This family is most closely related 97.3
cd03804351 GT1_wbaZ_like This family is most closely related 97.18
COG0763381 LpxB Lipid A disaccharide synthetase [Cell envelop 97.14
COG1817346 Uncharacterized protein conserved in archaea [Func 97.08
cd03813475 GT1_like_3 This family is most closely related to 97.05
PF13477139 Glyco_trans_4_2: Glycosyl transferase 4-like 96.93
TIGR02149388 glgA_Coryne glycogen synthase, Corynebacterium fam 96.91
cd04949372 GT1_gtfA_like This family is most closely related 96.57
PF13692135 Glyco_trans_1_4: Glycosyl transferases group 1; PD 96.54
cd04950373 GT1_like_1 Glycosyltransferases catalyze the trans 96.46
PRK09814333 beta-1,6-galactofuranosyltransferase; Provisional 96.46
COG5017161 Uncharacterized conserved protein [Function unknow 96.45
PF1352492 Glyco_trans_1_2: Glycosyl transferases group 1 96.43
COG4370412 Uncharacterized protein conserved in bacteria [Fun 96.4
PF13844468 Glyco_transf_41: Glycosyl transferase family 41; P 96.38
TIGR02470784 sucr_synth sucrose synthase. This model represents 96.22
PF02350346 Epimerase_2: UDP-N-acetylglucosamine 2-epimerase; 96.2
TIGR02918500 accessory Sec system glycosylation protein GtfA. M 95.83
PF13579160 Glyco_trans_4_4: Glycosyl transferase 4-like domai 95.82
PLN00142815 sucrose synthase 95.66
PHA01633335 putative glycosyl transferase group 1 95.29
PLN02949463 transferase, transferring glycosyl groups 95.15
PRK15490578 Vi polysaccharide biosynthesis protein TviE; Provi 95.06
PRK14098489 glycogen synthase; Provisional 94.86
PF13439177 Glyco_transf_4: Glycosyltransferase Family 4; PDB: 94.57
COG1618179 Predicted nucleotide kinase [Nucleotide transport 94.48
TIGR00715256 precor6x_red precorrin-6x reductase. This enzyme w 94.26
PF01975196 SurE: Survival protein SurE; InterPro: IPR002828 T 94.25
PRK10017426 colanic acid biosynthesis protein; Provisional 94.04
PHA01630331 putative group 1 glycosyl transferase 94.04
TIGR02095473 glgA glycogen/starch synthases, ADP-glucose type. 93.79
PF12000171 Glyco_trans_4_3: Gkycosyl transferase family 4 gro 93.64
PF08660170 Alg14: Oligosaccharide biosynthesis protein Alg14 92.97
PLN02501794 digalactosyldiacylglycerol synthase 91.15
TIGR02095 473 glgA glycogen/starch synthases, ADP-glucose type. 91.04
PLN00142 815 sucrose synthase 90.98
PRK13932257 stationary phase survival protein SurE; Provisiona 90.56
PRK02261137 methylaspartate mutase subunit S; Provisional 90.5
TIGR02470 784 sucr_synth sucrose synthase. This model represents 90.32
PF02951119 GSH-S_N: Prokaryotic glutathione synthetase, N-ter 90.27
TIGR03713519 acc_sec_asp1 accessory Sec system protein Asp1. Th 90.11
PF02441129 Flavoprotein: Flavoprotein; InterPro: IPR003382 Th 88.91
PLN02939977 transferase, transferring glycosyl groups 88.91
cd02067119 B12-binding B12 binding domain (B12-BD). This doma 88.29
TIGR02400456 trehalose_OtsA alpha,alpha-trehalose-phosphate syn 87.91
PRK10125405 putative glycosyl transferase; Provisional 86.84
PF02571249 CbiJ: Precorrin-6x reductase CbiJ/CobK; InterPro: 86.52
KOG4626966 consensus O-linked N-acetylglucosamine transferase 86.05
TIGR02919438 accessory Sec system glycosyltransferase GtfB. Mem 85.84
PRK08057248 cobalt-precorrin-6x reductase; Reviewed 85.61
COG0003322 ArsA Predicted ATPase involved in chromosome parti 85.61
PRK13934266 stationary phase survival protein SurE; Provisiona 84.84
COG0496252 SurE Predicted acid phosphatase [General function 84.81
PRK13933253 stationary phase survival protein SurE; Provisiona 84.4
TIGR02015422 BchY chlorophyllide reductase subunit Y. This mode 83.92
COG4088261 Predicted nucleotide kinase [Nucleotide transport 83.91
PRK05973237 replicative DNA helicase; Provisional 83.23
PRK10916348 ADP-heptose:LPS heptosyltransferase II; Provisiona 82.99
PF04413186 Glycos_transf_N: 3-Deoxy-D-manno-octulosonic-acid 82.47
cd05844367 GT1_like_7 Glycosyltransferases catalyze the trans 82.42
PLN03063 797 alpha,alpha-trehalose-phosphate synthase (UDP-form 82.39
TIGR01285432 nifN nitrogenase molybdenum-iron cofactor biosynth 82.37
smart0085190 MGS MGS-like domain. This domain composes the whol 82.13
PF0214295 MGS: MGS-like domain This is a subfamily of this f 81.79
PRK07313182 phosphopantothenoylcysteine decarboxylase; Validat 81.58
PRK10422352 lipopolysaccharide core biosynthesis protein; Prov 81.32
PF1214679 Hydrolase_4: Putative lysophospholipase; InterPro: 81.15
cd01980416 Chlide_reductase_Y Chlide_reductase_Y : Y subunit 80.87
PRK05647200 purN phosphoribosylglycinamide formyltransferase; 80.72
>PLN02555 limonoid glucosyltransferase Back     alignment and domain information 
Probab=100.00  E-value=4.6e-55  Score=409.26  Aligned_cols=353  Identities=38%  Similarity=0.694  Sum_probs=271.3

Q ss_pred             hccCCCCcEEEEEcCCCCCChHHHHHHHHHHHhCCCeEEEEeCccccccccCCC-------C--CCCCeeEEEcCCCCCC
Q 036519            8 ASASSKLAHCLVLSYPAQGHMNPLLQFSKRLEHNGIKVTLVTTYFISKSLHRDP-------S--SSISIPLETISDGYDE   78 (365)
Q Consensus         8 ~~~~~~~~~il~~~~~~~GH~~p~l~la~~L~~~Gh~Vt~~~~~~~~~~v~~~~-------~--~~~gi~~~~l~~~~~~   78 (365)
                      |.+...+.||+++|+|++||++|++.||+.|+.+|..|||++|+.+...+.+..       .  +...+.|..+|+++|+
T Consensus         1 ~~~~~~~~HVv~~PfpaqGHi~Pml~lA~~La~~G~~vT~v~T~~~~~~~~~a~~~~~~~~~~~~~~~i~~~~~pdglp~   80 (480)
T PLN02555          1 MESESSLVHVMLVSFPGQGHVNPLLRLGKLLASKGLLVTFVTTESWGKKMRQANKIQDGVLKPVGDGFIRFEFFEDGWAE   80 (480)
T ss_pred             CCCCCCCCEEEEECCcccccHHHHHHHHHHHHhCCCeEEEEeccchhhhhhccccccccccccCCCCeEEEeeCCCCCCC
Confidence            445566789999999999999999999999999999999999998766554200       0  1123677778888876


Q ss_pred             CCCCCcCCHHHHHHHHHHHhHHHHHHHHHhcC---C-CcEEEEcCCCccHHHHHHHhCCceEEEecccHHHHHHHHHhhc
Q 036519           79 GRSAQAETDQAYVDRFWQIGVQTLTELVERMN---D-VDCIVYDSFLPWALDVAKKFGLTGAAFLTQSCTVASIYHYVNK  154 (365)
Q Consensus        79 ~~~~~~~~~~~~~~~~~~~~~~~l~~ll~~~~---~-pD~vv~D~~~~~a~~~A~~~giP~v~~~~~~~~~~~~~~~~~~  154 (365)
                       +.+...++..++..+.....+.++++++++.   + ++|||+|.+++|+..+|+++|||.+.|++++++..+.+++...
T Consensus        81 -~~~~~~~~~~~~~~~~~~~~~~l~~~l~~~~~~~~pv~ciV~D~~~~wa~~vA~~~gIP~~~F~t~~a~~~~~~~~~~~  159 (480)
T PLN02555         81 -DDPRRQDLDLYLPQLELVGKREIPNLVKRYAEQGRPVSCLINNPFIPWVCDVAEELGIPSAVLWVQSCACFSAYYHYYH  159 (480)
T ss_pred             -CcccccCHHHHHHHHHHhhhHHHHHHHHHHhccCCCceEEEECCcchHHHHHHHHcCCCeEEeecccHHHHHHHHHHhh
Confidence             3333334555566666566777888887642   3 4999999999999999999999999999999999998877755


Q ss_pred             ccccCCC---CCCccccCCCCCCCCCCCCCccCCCCCchhHHHHHHHhhhhccccchhHhHhhHhhhhhhh---------
Q 036519          155 GLIKLPL---TGDQVFLPGLPPLDPQDTPSFINDPASYPAFFDMILTRQFSNIDKADWILCNTFYELEKEV---------  222 (365)
Q Consensus       155 ~~~~~~~---~~~~~~~pg~p~~~~~~lp~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~---------  222 (365)
                      +..++..   ...++.+||+|+++..++|.++........++..+ ........+++.+++|+|.+||..+         
T Consensus       160 ~~~~~~~~~~~~~~~~iPglp~l~~~dlp~~~~~~~~~~~~~~~~-~~~~~~~~~a~~vlvNTf~eLE~~~~~~l~~~~~  238 (480)
T PLN02555        160 GLVPFPTETEPEIDVQLPCMPLLKYDEIPSFLHPSSPYPFLRRAI-LGQYKNLDKPFCILIDTFQELEKEIIDYMSKLCP  238 (480)
T ss_pred             cCCCcccccCCCceeecCCCCCcCHhhCcccccCCCCchHHHHHH-HHHHHhcccCCEEEEEchHHHhHHHHHHHhhCCC
Confidence            5333222   12346799999999999998775322223333333 3333444555667777777776543         


Q ss_pred             -----------------------------------------------------------------------hCchh----
Q 036519          223 -----------------------------------------------------------------------IKESE----  227 (365)
Q Consensus       223 -----------------------------------------------------------------------~~~~~----  227 (365)
                                                                                             +|...    
T Consensus       239 v~~iGPl~~~~~~~~~~~~~~~~~~~~~~~~wLd~~~~~sVvyvsfGS~~~~~~~q~~ela~~l~~~~~~flW~~~~~~~  318 (480)
T PLN02555        239 IKPVGPLFKMAKTPNSDVKGDISKPADDCIEWLDSKPPSSVVYISFGTVVYLKQEQIDEIAYGVLNSGVSFLWVMRPPHK  318 (480)
T ss_pred             EEEeCcccCccccccccccccccccchhHHHHHhCCCCCceeEEEeccccCCCHHHHHHHHHHHHhcCCeEEEEEecCcc
Confidence                                                                                   34321    


Q ss_pred             -----hCCCCcccccccCCCCeEEeecchhhhhcccccccccccCChhhHHHHHHcCCCeeeccccCchhhHHHHHHhHh
Q 036519          228 -----QSKLPENFSDETTQKGLVVNWCPQLGVLAHEATGCFLTHCGWNSTIEALRLGVPMLAMPLWTDQSTNSKYVMDVW  302 (365)
Q Consensus       228 -----~~~~p~~~~~~~~~~~~~~~~~p~~~~L~~~~~~~~I~hgG~gs~~eal~~GvP~v~~P~~~DQ~~nA~~v~~~~  302 (365)
                           .+.+|+++.++.++|+++++|+||.+||.|.++++||||||+||++||+++|||||++|++.||+.||+++++.|
T Consensus       319 ~~~~~~~~lp~~~~~~~~~~g~v~~W~PQ~~iL~H~~v~~FvtH~G~nS~~Eai~~GVP~l~~P~~~DQ~~Na~~~~~~~  398 (480)
T PLN02555        319 DSGVEPHVLPEEFLEKAGDKGKIVQWCPQEKVLAHPSVACFVTHCGWNSTMEALSSGVPVVCFPQWGDQVTDAVYLVDVF  398 (480)
T ss_pred             cccchhhcCChhhhhhcCCceEEEecCCHHHHhCCCccCeEEecCCcchHHHHHHcCCCEEeCCCccccHHHHHHHHHHh
Confidence                 124677887778889999999999999999999999999999999999999999999999999999999999999


Q ss_pred             cceeEecCC--CCCcccHHHHHHHHHHHhcCH---HHHHHHHHH-------HHcCCCcHHHHHHHHHHHHhc
Q 036519          303 KMGLKVPAD--EKGIVRREAIAHCIGEILEGD---KWRNFAKEA-------VAKGGSSDKNIDDFVANLISS  362 (365)
Q Consensus       303 G~G~~~~~~--~~~~~~~~~l~~~i~~ll~~~---~~~~~a~~~-------~~~~g~s~~~~~~~~~~i~~~  362 (365)
                      |+|+.+...  .++.+++++|.++|+++|.++   ++|+||+++       .++||||++++++||+.|.++
T Consensus       399 gvGv~l~~~~~~~~~v~~~~v~~~v~~vm~~~~g~~~r~ra~~l~~~a~~A~~egGSS~~~l~~~v~~i~~~  470 (480)
T PLN02555        399 KTGVRLCRGEAENKLITREEVAECLLEATVGEKAAELKQNALKWKEEAEAAVAEGGSSDRNFQEFVDKLVRK  470 (480)
T ss_pred             CceEEccCCccccCcCcHHHHHHHHHHHhcCchHHHHHHHHHHHHHHHHHHhcCCCcHHHHHHHHHHHHHhc
Confidence            999999531  123689999999999999653   566666554       556899999999999999865

>PLN02173 UDP-glucosyl transferase family protein Back     alignment and domain information
>PLN02410 UDP-glucoronosyl/UDP-glucosyl transferase family protein Back     alignment and domain information
>PLN02562 UDP-glycosyltransferase Back     alignment and domain information
>PLN02210 UDP-glucosyl transferase Back     alignment and domain information
>PLN02152 indole-3-acetate beta-glucosyltransferase Back     alignment and domain information
>PLN02863 UDP-glucoronosyl/UDP-glucosyl transferase family protein Back     alignment and domain information
>PLN02448 UDP-glycosyltransferase family protein Back     alignment and domain information
>PLN02208 glycosyltransferase family protein Back     alignment and domain information
>PLN02554 UDP-glycosyltransferase family protein Back     alignment and domain information
>PLN02992 coniferyl-alcohol glucosyltransferase Back     alignment and domain information
>PLN02207 UDP-glycosyltransferase Back     alignment and domain information
>PLN02764 glycosyltransferase family protein Back     alignment and domain information
>PLN00164 glucosyltransferase; Provisional Back     alignment and domain information
>PLN02670 transferase, transferring glycosyl groups Back     alignment and domain information
>PLN02534 UDP-glycosyltransferase Back     alignment and domain information
>PLN03007 UDP-glucosyltransferase family protein Back     alignment and domain information
>PLN03004 UDP-glycosyltransferase Back     alignment and domain information
>PLN00414 glycosyltransferase family protein Back     alignment and domain information
>PLN02167 UDP-glycosyltransferase family protein Back     alignment and domain information
>PLN03015 UDP-glucosyl transferase Back     alignment and domain information
>cd03784 GT1_Gtf_like This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin Back     alignment and domain information
>TIGR01426 MGT glycosyltransferase, MGT family Back     alignment and domain information
>COG1819 Glycosyl transferases, related to UDP-glucuronosyltransferase [Carbohydrate transport and metabolism / Signal transduction mechanisms] Back     alignment and domain information
>PF00201 UDPGT: UDP-glucoronosyl and UDP-glucosyl transferase; InterPro: IPR002213 UDP glycosyltransferases (UGT) are a superfamily of enzymes that catalyzes the addition of the glycosyl group from a UTP-sugar to a small hydrophobic molecule Back     alignment and domain information
>PHA03392 egt ecdysteroid UDP-glucosyltransferase; Provisional Back     alignment and domain information
>KOG1192 consensus UDP-glucuronosyl and UDP-glucosyl transferase [Carbohydrate transport and metabolism; Energy production and conversion] Back     alignment and domain information
>PRK12446 undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase; Reviewed Back     alignment and domain information
>COG0707 MurG UDP-N-acetylglucosamine:LPS N-acetylglucosamine transferase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PF13528 Glyco_trans_1_3: Glycosyl transferase family 1 Back     alignment and domain information
>TIGR00661 MJ1255 conserved hypothetical protein Back     alignment and domain information
>PRK00726 murG undecaprenyldiphospho-muramoylpentapeptide beta-N- acetylglucosaminyltransferase; Provisional Back     alignment and domain information
>cd03785 GT1_MurG MurG is an N-acetylglucosaminyltransferase, the last enzyme involved in the intracellular phase of peptidoglycan biosynthesis Back     alignment and domain information
>TIGR01133 murG undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase Back     alignment and domain information
>TIGR00215 lpxB lipid-A-disaccharide synthase Back     alignment and domain information
>PRK13609 diacylglycerol glucosyltransferase; Provisional Back     alignment and domain information
>PRK00025 lpxB lipid-A-disaccharide synthase; Reviewed Back     alignment and domain information
>COG4671 Predicted glycosyl transferase [General function prediction only] Back     alignment and domain information
>TIGR03590 PseG pseudaminic acid biosynthesis-associated protein PseG Back     alignment and domain information
>PF03033 Glyco_transf_28: Glycosyltransferase family 28 N-terminal domain; InterPro: IPR004276 The biosynthesis of disaccharides, oligosaccharides and polysaccharides involves the action of hundreds of different glycosyltransferases Back     alignment and domain information
>PF04101 Glyco_tran_28_C: Glycosyltransferase family 28 C-terminal domain; InterPro: IPR007235 The biosynthesis of disaccharides, oligosaccharides and polysaccharides involves the action of hundreds of different glycosyltransferases Back     alignment and domain information
>PRK13608 diacylglycerol glucosyltransferase; Provisional Back     alignment and domain information
>TIGR03492 conserved hypothetical protein Back     alignment and domain information
>COG3980 spsG Spore coat polysaccharide biosynthesis protein, predicted glycosyltransferase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>cd03823 GT1_ExpE7_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>PLN02605 monogalactosyldiacylglycerol synthase Back     alignment and domain information
>cd03814 GT1_like_2 This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03800 GT1_Sucrose_synthase This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>PLN02871 UDP-sulfoquinovose:DAG sulfoquinovosyltransferase Back     alignment and domain information
>cd03808 GT1_cap1E_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03801 GT1_YqgM_like This family is most closely related to the GT1 family of glycosyltransferases and named after YqgM in Bacillus licheniformis about which little is known Back     alignment and domain information
>cd03794 GT1_wbuB_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd04962 GT1_like_5 This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>PRK10307 putative glycosyl transferase; Provisional Back     alignment and domain information
>cd03817 GT1_UGDG_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03798 GT1_wlbH_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03816 GT1_ALG1_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03825 GT1_wcfI_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03786 GT1_UDP-GlcNAc_2-Epimerase Bacterial members of the UDP-N-Acetylglucosamine (GlcNAc) 2-Epimerase family are known to catalyze the reversible interconversion of UDP-GlcNAc and UDP-N-acetylmannosamine (UDP-ManNAc) Back     alignment and domain information
>PRK14089 ipid-A-disaccharide synthase; Provisional Back     alignment and domain information
>cd03820 GT1_amsD_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03805 GT1_ALG2_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>PF04007 DUF354: Protein of unknown function (DUF354); InterPro: IPR007152 Members of this family are around 350 amino acids in length Back     alignment and domain information
>PRK05749 3-deoxy-D-manno-octulosonic-acid transferase; Reviewed Back     alignment and domain information
>TIGR00236 wecB UDP-N-acetylglucosamine 2-epimerase Back     alignment and domain information
>cd03818 GT1_ExpC_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03795 GT1_like_4 This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03819 GT1_WavL_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>TIGR03449 mycothiol_MshA UDP-N-acetylglucosamine: 1L-myo-inositol-1-phosphate 1-alpha-D-N-acetylglucosaminyltransferase Back     alignment and domain information
>cd03796 GT1_PIG-A_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03802 GT1_AviGT4_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03821 GT1_Bme6_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03822 GT1_ecORF704_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03807 GT1_WbnK_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03799 GT1_amsK_like This is a family of GT1 glycosyltransferases found specifically in certain bacteria Back     alignment and domain information
>cd03811 GT1_WabH_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>TIGR02472 sucr_P_syn_N sucrose-phosphate synthase, putative, glycosyltransferase domain Back     alignment and domain information
>COG0381 WecB UDP-N-acetylglucosamine 2-epimerase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>TIGR02468 sucrsPsyn_pln sucrose phosphate synthase/possible sucrose phosphate phosphatase, plant Back     alignment and domain information
>cd04951 GT1_WbdM_like This family is most closely related to the GT1 family of glycosyltransferases and is named after WbdM in Escherichia coli Back     alignment and domain information
>PRK09922 UDP-D-galactose:(glucosyl)lipopolysaccharide-1,6-D-galactosyltransferase; Provisional Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>cd04955 GT1_like_6 This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>TIGR03087 stp1 sugar transferase, PEP-CTERM/EpsH1 system associated Back     alignment and domain information
>TIGR03088 stp2 sugar transferase, PEP-CTERM/EpsH1 system associated Back     alignment and domain information
>cd03812 GT1_CapH_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>PLN02275 transferase, transferring glycosyl groups Back     alignment and domain information
>COG1519 KdtA 3-deoxy-D-manno-octulosonic-acid transferase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PLN02846 digalactosyldiacylglycerol synthase Back     alignment and domain information
>KOG3349 consensus Predicted glycosyltransferase [General function prediction only] Back     alignment and domain information
>cd03792 GT1_Trehalose_phosphorylase Trehalose phosphorylase (TP) reversibly catalyzes trehalose synthesis and degradation from alpha-glucose-1-phosphate (alpha-Glc-1-P) and glucose Back     alignment and domain information
>cd03809 GT1_mtfB_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>PRK01021 lpxB lipid-A-disaccharide synthase; Reviewed Back     alignment and domain information
>TIGR03568 NeuC_NnaA UDP-N-acetyl-D-glucosamine 2-epimerase, UDP-hydrolysing Back     alignment and domain information
>PRK00654 glgA glycogen synthase; Provisional Back     alignment and domain information
>PRK15427 colanic acid biosynthesis glycosyltransferase WcaL; Provisional Back     alignment and domain information
>PF00534 Glycos_transf_1: Glycosyl transferases group 1; InterPro: IPR001296 The biosynthesis of disaccharides, oligosaccharides and polysaccharides involves the action of hundreds of different glycosyltransferases Back     alignment and domain information
>PLN02316 synthase/transferase Back     alignment and domain information
>cd05844 GT1_like_7 Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds Back     alignment and domain information
>PRK15484 lipopolysaccharide 1,2-N-acetylglucosaminetransferase; Provisional Back     alignment and domain information
>cd04946 GT1_AmsK_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03791 GT1_Glycogen_synthase_DULL1_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd01635 Glycosyltransferase_GTB_type Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds Back     alignment and domain information
>PF02684 LpxB: Lipid-A-disaccharide synthetase; InterPro: IPR003835 The biosynthesis of disaccharides, oligosaccharides and polysaccharides involves the action of hundreds of different glycosyltransferases Back     alignment and domain information
>cd03806 GT1_ALG11_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03804 GT1_wbaZ_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>COG0763 LpxB Lipid A disaccharide synthetase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>COG1817 Uncharacterized protein conserved in archaea [Function unknown] Back     alignment and domain information
>cd03813 GT1_like_3 This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>PF13477 Glyco_trans_4_2: Glycosyl transferase 4-like Back     alignment and domain information
>TIGR02149 glgA_Coryne glycogen synthase, Corynebacterium family Back     alignment and domain information
>cd04949 GT1_gtfA_like This family is most closely related to the GT1 family of glycosyltransferases and is named after gtfA in Streptococcus gordonii, where it plays a role in the O-linked glycosylation of GspB, a cell surface glycoprotein involved in platelet binding Back     alignment and domain information
>PF13692 Glyco_trans_1_4: Glycosyl transferases group 1; PDB: 3OY2_A 3OY7_B 2Q6V_A 2HY7_A 3CV3_A 3CUY_A Back     alignment and domain information
>cd04950 GT1_like_1 Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds Back     alignment and domain information
>PRK09814 beta-1,6-galactofuranosyltransferase; Provisional Back     alignment and domain information
>COG5017 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13524 Glyco_trans_1_2: Glycosyl transferases group 1 Back     alignment and domain information
>COG4370 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF13844 Glyco_transf_41: Glycosyl transferase family 41; PDB: 3PE4_C 3PE3_D 3TAX_C 2XGO_A 2JLB_B 2XGM_A 2VSY_B 2XGS_B 2VSN_A Back     alignment and domain information
>TIGR02470 sucr_synth sucrose synthase Back     alignment and domain information
>PF02350 Epimerase_2: UDP-N-acetylglucosamine 2-epimerase; InterPro: IPR003331 UDP-N-acetylglucosamine 2-epimerase 5 Back     alignment and domain information
>TIGR02918 accessory Sec system glycosylation protein GtfA Back     alignment and domain information
>PF13579 Glyco_trans_4_4: Glycosyl transferase 4-like domain; PDB: 3C4Q_B 3C4V_A 3C48_B 1Z2T_A Back     alignment and domain information
>PLN00142 sucrose synthase Back     alignment and domain information
>PHA01633 putative glycosyl transferase group 1 Back     alignment and domain information
>PLN02949 transferase, transferring glycosyl groups Back     alignment and domain information
>PRK15490 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>PRK14098 glycogen synthase; Provisional Back     alignment and domain information
>PF13439 Glyco_transf_4: Glycosyltransferase Family 4; PDB: 2JJM_E 3MBO_C 2GEJ_A 2GEK_A Back     alignment and domain information
>COG1618 Predicted nucleotide kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>TIGR00715 precor6x_red precorrin-6x reductase Back     alignment and domain information
>PF01975 SurE: Survival protein SurE; InterPro: IPR002828 This entry represents a SurE-like structural domain with a 3-layer alpha/bete/alpha topology that bears some topological similarity to the N-terminal domain of the glutaminase/asparaginase family Back     alignment and domain information
>PRK10017 colanic acid biosynthesis protein; Provisional Back     alignment and domain information
>PHA01630 putative group 1 glycosyl transferase Back     alignment and domain information
>TIGR02095 glgA glycogen/starch synthases, ADP-glucose type Back     alignment and domain information
>PF12000 Glyco_trans_4_3: Gkycosyl transferase family 4 group; InterPro: IPR022623 This presumed domain is functionally uncharacterised and found in bacteria Back     alignment and domain information
>PF08660 Alg14: Oligosaccharide biosynthesis protein Alg14 like; InterPro: IPR013969 Alg14 is involved dolichol-linked oligosaccharide biosynthesis and anchors the catalytic subunit Alg13 to the ER membrane [] Back     alignment and domain information
>PLN02501 digalactosyldiacylglycerol synthase Back     alignment and domain information
>TIGR02095 glgA glycogen/starch synthases, ADP-glucose type Back     alignment and domain information
>PLN00142 sucrose synthase Back     alignment and domain information
>PRK13932 stationary phase survival protein SurE; Provisional Back     alignment and domain information
>PRK02261 methylaspartate mutase subunit S; Provisional Back     alignment and domain information
>TIGR02470 sucr_synth sucrose synthase Back     alignment and domain information
>PF02951 GSH-S_N: Prokaryotic glutathione synthetase, N-terminal domain; InterPro: IPR004215 Prokaryotic glutathione synthetase 6 Back     alignment and domain information
>TIGR03713 acc_sec_asp1 accessory Sec system protein Asp1 Back     alignment and domain information
>PF02441 Flavoprotein: Flavoprotein; InterPro: IPR003382 This entry contains a diverse range of flavoprotein enzymes, including epidermin biosynthesis protein, EpiD, which has been shown to be a flavoprotein that binds FMN [] Back     alignment and domain information
>PLN02939 transferase, transferring glycosyl groups Back     alignment and domain information
>cd02067 B12-binding B12 binding domain (B12-BD) Back     alignment and domain information
>TIGR02400 trehalose_OtsA alpha,alpha-trehalose-phosphate synthase [UDP-forming] Back     alignment and domain information
>PRK10125 putative glycosyl transferase; Provisional Back     alignment and domain information
>PF02571 CbiJ: Precorrin-6x reductase CbiJ/CobK; InterPro: IPR003723 Cobalamin (vitamin B12) is a structurally complex cofactor, consisting of a modified tetrapyrrole with a centrally chelated cobalt Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>TIGR02919 accessory Sec system glycosyltransferase GtfB Back     alignment and domain information
>PRK08057 cobalt-precorrin-6x reductase; Reviewed Back     alignment and domain information
>COG0003 ArsA Predicted ATPase involved in chromosome partitioning [Cell division and chromosome partitioning] Back     alignment and domain information
>PRK13934 stationary phase survival protein SurE; Provisional Back     alignment and domain information
>COG0496 SurE Predicted acid phosphatase [General function prediction only] Back     alignment and domain information
>PRK13933 stationary phase survival protein SurE; Provisional Back     alignment and domain information
>TIGR02015 BchY chlorophyllide reductase subunit Y Back     alignment and domain information
>COG4088 Predicted nucleotide kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK05973 replicative DNA helicase; Provisional Back     alignment and domain information
>PRK10916 ADP-heptose:LPS heptosyltransferase II; Provisional Back     alignment and domain information
>PF04413 Glycos_transf_N: 3-Deoxy-D-manno-octulosonic-acid transferase (kdotransferase); InterPro: IPR007507 This is a domain found in proteins that transfer activated sugars to a variety of substrates, including glycogen, fructose-6-phosphate and lipopolysaccharides Back     alignment and domain information
>cd05844 GT1_like_7 Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds Back     alignment and domain information
>PLN03063 alpha,alpha-trehalose-phosphate synthase (UDP-forming); Provisional Back     alignment and domain information
>TIGR01285 nifN nitrogenase molybdenum-iron cofactor biosynthesis protein NifN Back     alignment and domain information
>smart00851 MGS MGS-like domain Back     alignment and domain information
>PF02142 MGS: MGS-like domain This is a subfamily of this family; InterPro: IPR011607 This domain composes the whole protein of methylglyoxal synthetase and the domain is also found in carbamoyl phosphate synthetase (CPS) where it forms a regulatory domain that binds to the allosteric effector ornithine Back     alignment and domain information
>PRK07313 phosphopantothenoylcysteine decarboxylase; Validated Back     alignment and domain information
>PRK10422 lipopolysaccharide core biosynthesis protein; Provisional Back     alignment and domain information
>PF12146 Hydrolase_4: Putative lysophospholipase; InterPro: IPR022742 This domain is found in bacteria and eukaryotes and is approximately 110 amino acids in length Back     alignment and domain information
>cd01980 Chlide_reductase_Y Chlide_reductase_Y : Y subunit of chlorophyllide (chlide) reductase (BchY) Back     alignment and domain information
>PRK05647 purN phosphoribosylglycinamide formyltransferase; Reviewed Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query365
2pq6_A482 Crystal Structure Of Medicago Truncatula Ugt85h2- I 2e-23
2c1x_A456 Structure And Activity Of A Flavonoid 3-O Glucosylt 3e-22
2vce_A480 Characterization And Engineering Of The Bifunctiona 4e-21
2acw_A465 Crystal Structure Of Medicago Truncatula Ugt71g1 Co 1e-18
2acv_A463 Crystal Structure Of Medicago Truncatula Ugt71g1 Le 1e-18
3hbf_A454 Structure Of Ugt78g1 Complexed With Myricetin And U 1e-16
2iya_A424 The Crystal Structure Of Macrolide Glycosyltransfer 3e-07
2o6l_A170 Crystal Structure Of The Udp-Glucuronic Acid Bindin 2e-06
2iyf_A430 The Crystal Structure Of Macrolide Glycosyltransfer 4e-04
>pdb|2PQ6|A Chain A, Crystal Structure Of Medicago Truncatula Ugt85h2- Insights Into The Structural Basis Of A Multifunctional (Iso) Flavonoid Glycosyltransferase Length = 482 Back     alignment and structure 
Iteration: 1

 Score =  106 bits (265), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 49/136 (36%), Positives = 81/136 (59%), Gaps = 14/136 (10%)
Query: 235 FSDETTQKGLVVNWCPQLGVLAHEATGCFLTHCGWNSTIEALRLGVPMLAMPLWTDQSTN 294
           F++E   +GL+ +WCPQ  VL H + G FLTHCGWNST E++  GVPML  P + DQ T+
Sbjct: 347 FTNEIADRGLIASWCPQDKVLNHPSIGGFLTHCGWNSTTESICAGVPMLCWPFFADQPTD 406
Query: 295 SKYVMDVWKMGLKVPADEKGIVRREAIAHCIGEILEGDKWRNF----------AKEAVAK 344
            +++ + W++G+++  +    V+RE +A  I E++ GDK +            A+E    
Sbjct: 407 CRFICNEWEIGMEIDTN----VKREELAKLINEVIAGDKGKKMKQKAMELKKKAEENTRP 462
Query: 345 GGSSDKNIDDFVANLI 360
           GG S  N++  + +++
Sbjct: 463 GGCSYMNLNKVIKDVL 478
>pdb|2C1X|A Chain A, Structure And Activity Of A Flavonoid 3-O Glucosyltransferase Reveals The Basis For Plant Natural Product Modification Length = 456 Back     alignment and structure
>pdb|2VCE|A Chain A, Characterization And Engineering Of The Bifunctional N- And O-glucosyltransferase Involved In Xenobiotic Metabolism In Plants Length = 480 Back     alignment and structure
>pdb|2ACW|A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1 Complexed With Udp-Glucose Length = 465 Back     alignment and structure
>pdb|2ACV|A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1 Length = 463 Back     alignment and structure
>pdb|3HBF|A Chain A, Structure Of Ugt78g1 Complexed With Myricetin And Udp Length = 454 Back     alignment and structure
>pdb|2IYA|A Chain A, The Crystal Structure Of Macrolide Glycosyltransferases: A Blueprint For Antibiotic Engineering Length = 424 Back     alignment and structure
>pdb|2O6L|A Chain A, Crystal Structure Of The Udp-Glucuronic Acid Binding Domain Of The Human Drug Metabolizing Udp-Glucuronosyltransferase 2b7 Length = 170 Back     alignment and structure
>pdb|2IYF|A Chain A, The Crystal Structure Of Macrolide Glycosyltransferases: A Blueprint For Antibiotic Engineering Length = 430 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query365
2pq6_A482 UDP-glucuronosyl/UDP-glucosyltransferase; glycosyl 9e-73
2pq6_A482 UDP-glucuronosyl/UDP-glucosyltransferase; glycosyl 1e-64
2c1x_A456 UDP-glucose flavonoid 3-O glycosyltransferase; WIN 3e-72
2c1x_A456 UDP-glucose flavonoid 3-O glycosyltransferase; WIN 3e-70
3hbf_A454 Flavonoid 3-O-glucosyltransferase; glycosyltransfe 5e-70
3hbf_A454 Flavonoid 3-O-glucosyltransferase; glycosyltransfe 4e-68
2vch_A480 Hydroquinone glucosyltransferase; glycosyltransfer 2e-64
2vch_A 480 Hydroquinone glucosyltransferase; glycosyltransfer 3e-58
2acv_A463 Triterpene UDP-glucosyl transferase UGT71G1; glyco 7e-60
2acv_A463 Triterpene UDP-glucosyl transferase UGT71G1; glyco 6e-53
3otg_A412 CALG1; calicheamicin, TDP, structural genomics, PS 2e-18
2o6l_A170 UDP-glucuronosyltransferase 2B7; drug metabolism, 4e-17
3rsc_A415 CALG2; TDP, enediyne, structural genomics, PSI-2, 4e-17
3ia7_A402 CALG4; glycosysltransferase, calicheamicin, enediy 3e-16
2yjn_A441 ERYCIII, glycosyltransferase; transferase, cytochr 5e-16
2iya_A424 OLEI, oleandomycin glycosyltransferase; carbohydra 8e-16
2iya_A424 OLEI, oleandomycin glycosyltransferase; carbohydra 2e-07
2iyf_A430 OLED, oleandomycin glycosyltransferase; antibiotic 2e-15
2iyf_A430 OLED, oleandomycin glycosyltransferase; antibiotic 2e-08
3h4t_A404 Glycosyltransferase GTFA, glycosyltransferase; van 7e-14
4fzr_A398 SSFS6; structural genomics, PSI-biology, protein s 2e-13
3oti_A398 CALG3; calicheamicin, TDP, structural genomics, PS 1e-12
3tsa_A391 SPNG, NDP-rhamnosyltransferase; glycosyltransferas 4e-12
2p6p_A384 Glycosyl transferase; X-RAY-diffraction,urdamycina 1e-11
1iir_A415 Glycosyltransferase GTFB; rossmann fold; 1.80A {Am 4e-09
1rrv_A416 Glycosyltransferase GTFD; GT-B, glycosyltransferas 5e-08
1qzv_F154 Plant photosystem I: subunit PSAF; photosynthesis, 6e-04
>2pq6_A UDP-glucuronosyl/UDP-glucosyltransferase; glycosylation, isoflavonoid, uridine diphosphate glycosyltransferase; 2.10A {Medicago truncatula} SCOP: c.87.1.10 Length = 482 Back     alignment and structure
 Score =  232 bits (595), Expect = 9e-73
 Identities = 51/243 (20%), Positives = 93/243 (38%), Gaps = 27/243 (11%)

Query: 8   ASASSKLAHCLVLSYPAQGHMNPLLQFSKRLEHNGIKVTLVTTYFISKSLHRDPSSSIS- 66
            + +++  H +++ YP QGH+NPL + +K L   G  +T V T +  K L +        
Sbjct: 2   GNFANRKPHVVMIPYPVQGHINPLFKLAKLLHLRGFHITFVNTEYNHKRLLKSRGPKAFD 61

Query: 67  ----IPLETISDGYDEG--RSAQAETDQAYVDRFWQIGVQTLTELVERMND------VDC 114
                  E+I DG          ++          +  ++   EL+ R+N       V C
Sbjct: 62  GFTDFNFESIPDGLTPMEGDGDVSQDVPTLCQSVRKNFLKPYCELLTRLNHSTNVPPVTC 121

Query: 115 IVYDSFLPWALDVAKKFGLTGAAFLTQSCTVASIYHYVNKGLIK--LPLTGDQV------ 166
           +V D  + + +  A++F L    + + S        +    + +  +P   +        
Sbjct: 122 LVSDCCMSFTIQAAEEFELPNVLYFSSSACSLLNVMHFRSFVERGIIPFKDESYLTNGCL 181

Query: 167 -----FLPGLPPLDPQDTPSFINDPASYPAFFDMILTRQFSNIDKADWILCNTFYELEKE 221
                ++PGL     +D   FI          +  +      ++K   IL NTF ELE +
Sbjct: 182 ETKVDWIPGLKNFRLKDIVDFIRTTNPNDIMLEFFI-EVADRVNKDTTILLNTFNELESD 240

Query: 222 VIK 224
           VI 
Sbjct: 241 VIN 243
>2pq6_A UDP-glucuronosyl/UDP-glucosyltransferase; glycosylation, isoflavonoid, uridine diphosphate glycosyltransferase; 2.10A {Medicago truncatula} SCOP: c.87.1.10 Length = 482 Back     alignment and structure
>2c1x_A UDP-glucose flavonoid 3-O glycosyltransferase; WINE, catalysis, glycosylation; HET: UDP B3P; 1.9A {Vitis vinifera} SCOP: c.87.1.10 PDB: 2c1z_A* 2c9z_A* Length = 456 Back     alignment and structure
>2c1x_A UDP-glucose flavonoid 3-O glycosyltransferase; WINE, catalysis, glycosylation; HET: UDP B3P; 1.9A {Vitis vinifera} SCOP: c.87.1.10 PDB: 2c1z_A* 2c9z_A* Length = 456 Back     alignment and structure
>3hbf_A Flavonoid 3-O-glucosyltransferase; glycosyltransferase, GT-B fold, GT1, phenylpropanoid metabolism; HET: UDP MYC; 2.10A {Medicago truncatula} PDB: 3hbj_A* Length = 454 Back     alignment and structure
>3hbf_A Flavonoid 3-O-glucosyltransferase; glycosyltransferase, GT-B fold, GT1, phenylpropanoid metabolism; HET: UDP MYC; 2.10A {Medicago truncatula} PDB: 3hbj_A* Length = 454 Back     alignment and structure
>2vch_A Hydroquinone glucosyltransferase; glycosyltransferase, N-glucosyltransferase, UDP-glucose- dependent, plant glycosyltransferase; HET: UDP; 1.45A {Arabidopsis thaliana} SCOP: c.87.1.10 PDB: 2vce_A* 2vg8_A* Length = 480 Back     alignment and structure
>2vch_A Hydroquinone glucosyltransferase; glycosyltransferase, N-glucosyltransferase, UDP-glucose- dependent, plant glycosyltransferase; HET: UDP; 1.45A {Arabidopsis thaliana} SCOP: c.87.1.10 PDB: 2vce_A* 2vg8_A* Length = 480 Back     alignment and structure
>2acv_A Triterpene UDP-glucosyl transferase UGT71G1; glycosyltransferase; HET: UDP; 2.00A {Medicago truncatula} SCOP: c.87.1.10 PDB: 2acw_A* Length = 463 Back     alignment and structure
>2acv_A Triterpene UDP-glucosyl transferase UGT71G1; glycosyltransferase; HET: UDP; 2.00A {Medicago truncatula} SCOP: c.87.1.10 PDB: 2acw_A* Length = 463 Back     alignment and structure
>3otg_A CALG1; calicheamicin, TDP, structural genomics, PSI-2, protein STRU initiative, center for eukaryotic structural genomics, CESG fold; HET: TYD; 2.08A {Micromonospora echinospora} PDB: 3oth_A* Length = 412 Back     alignment and structure
>2o6l_A UDP-glucuronosyltransferase 2B7; drug metabolism, rossman, MAD, enzyme, nucleotide binding, sugar,UDP-glucuronosyltransferase, UGT; 1.80A {Homo sapiens} Length = 170 Back     alignment and structure
>3rsc_A CALG2; TDP, enediyne, structural genomics, PSI-2, protein structure initiative, center for eukaryotic structural genomics; HET: TYD C0T; 2.19A {Micromonospora echinospora} PDB: 3iaa_A* Length = 415 Back     alignment and structure
>3ia7_A CALG4; glycosysltransferase, calicheamicin, enediyne, transf; 1.91A {Micromonospora echinospora} Length = 402 Back     alignment and structure
>2yjn_A ERYCIII, glycosyltransferase; transferase, cytochrome P450; 3.09A {Saccharopolyspora erythraea} Length = 441 Back     alignment and structure
>2iya_A OLEI, oleandomycin glycosyltransferase; carbohydrate, glycosylation, enzyme, macrolide; HET: UDP ZIO; 1.7A {Streptomyces antibioticus} Length = 424 Back     alignment and structure
>2iya_A OLEI, oleandomycin glycosyltransferase; carbohydrate, glycosylation, enzyme, macrolide; HET: UDP ZIO; 1.7A {Streptomyces antibioticus} Length = 424 Back     alignment and structure
>2iyf_A OLED, oleandomycin glycosyltransferase; antibiotic resistance, glycosylation, enzyme, macrolide, carbohydrate; HET: ERY UDP; 1.7A {Streptomyces antibioticus} Length = 430 Back     alignment and structure
>2iyf_A OLED, oleandomycin glycosyltransferase; antibiotic resistance, glycosylation, enzyme, macrolide, carbohydrate; HET: ERY UDP; 1.7A {Streptomyces antibioticus} Length = 430 Back     alignment and structure
>4fzr_A SSFS6; structural genomics, PSI-biology, protein structure initiati enzyme discovery for natural product biosynthesis, natPro; 2.40A {Streptomyces SP} PDB: 4g2t_A* Length = 398 Back     alignment and structure
>3oti_A CALG3; calicheamicin, TDP, structural genomics, PSI-2, protein STRU initiative, center for eukaryotic structural genomics, CESG fold; HET: TYD C0T; 1.60A {Micromonospora echinospora} PDB: 3d0q_A* 3d0r_A* Length = 398 Back     alignment and structure
>3tsa_A SPNG, NDP-rhamnosyltransferase; glycosyltransferase; HET: GLC; 1.70A {Saccharopolyspora spinosa} PDB: 3uyk_A* 3uyl_A* Length = 391 Back     alignment and structure
>2p6p_A Glycosyl transferase; X-RAY-diffraction,urdamycina-biosynthesis; 1.88A {Streptomyces fradiae} Length = 384 Back     alignment and structure
>1iir_A Glycosyltransferase GTFB; rossmann fold; 1.80A {Amycolatopsis orientalis} SCOP: c.87.1.5 Length = 415 Back     alignment and structure
>1rrv_A Glycosyltransferase GTFD; GT-B, glycosyltransferase, rossmann fold, glycopeptide, VACO antibiotic, transferase-antibiotic complex; HET: OMZ GHP OMY 3FG TYD BGC; 2.00A {Amycolatopsis orientalis} SCOP: c.87.1.5 Length = 416 Back     alignment and structure
>1qzv_F Plant photosystem I: subunit PSAF; photosynthesis,plant photosynthetic reaction center, peripheral antenna; HET: CL1 PQN; 4.44A {Pisum sativum} SCOP: i.5.1.1 Length = 154 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query365
3hbf_A454 Flavonoid 3-O-glucosyltransferase; glycosyltransfe 100.0
2vch_A480 Hydroquinone glucosyltransferase; glycosyltransfer 100.0
2c1x_A456 UDP-glucose flavonoid 3-O glycosyltransferase; WIN 100.0
2pq6_A482 UDP-glucuronosyl/UDP-glucosyltransferase; glycosyl 100.0
2acv_A463 Triterpene UDP-glucosyl transferase UGT71G1; glyco 100.0
4amg_A400 Snogd; transferase, polyketide biosynthesis, GT1 f 100.0
2iya_A424 OLEI, oleandomycin glycosyltransferase; carbohydra 100.0
3rsc_A415 CALG2; TDP, enediyne, structural genomics, PSI-2, 100.0
3ia7_A402 CALG4; glycosysltransferase, calicheamicin, enediy 100.0
3h4t_A404 Glycosyltransferase GTFA, glycosyltransferase; van 100.0
1iir_A415 Glycosyltransferase GTFB; rossmann fold; 1.80A {Am 100.0
2yjn_A441 ERYCIII, glycosyltransferase; transferase, cytochr 100.0
1rrv_A416 Glycosyltransferase GTFD; GT-B, glycosyltransferas 100.0
2p6p_A384 Glycosyl transferase; X-RAY-diffraction,urdamycina 100.0
4fzr_A398 SSFS6; structural genomics, PSI-biology, protein s 100.0
3oti_A398 CALG3; calicheamicin, TDP, structural genomics, PS 100.0
2iyf_A430 OLED, oleandomycin glycosyltransferase; antibiotic 100.0
3tsa_A391 SPNG, NDP-rhamnosyltransferase; glycosyltransferas 100.0
3otg_A412 CALG1; calicheamicin, TDP, structural genomics, PS 100.0
3s2u_A365 UDP-N-acetylglucosamine--N-acetylmuramyl-(pentape 99.98
2o6l_A170 UDP-glucuronosyltransferase 2B7; drug metabolism, 99.85
1f0k_A364 MURG, UDP-N-acetylglucosamine-N-acetylmuramyl- (pe 99.83
3hbm_A282 UDP-sugar hydrolase; PSEG; 1.80A {Campylobacter je 99.59
3c48_A438 Predicted glycosyltransferases; retaining glycosyl 99.38
2jzc_A224 UDP-N-acetylglucosamine transferase subunit ALG13; 99.36
1v4v_A376 UDP-N-acetylglucosamine 2-epimerase; UDP-GLCNAC, t 99.31
2gek_A406 Phosphatidylinositol mannosyltransferase (PIMA); G 99.26
3okp_A394 GDP-mannose-dependent alpha-(1-6)-phosphatidylino 99.2
3fro_A439 GLGA glycogen synthase; glycosyltransferase family 99.18
3dzc_A396 UDP-N-acetylglucosamine 2-epimerase; structural ge 99.16
2r60_A499 Glycosyl transferase, group 1; rossmann-fold; 1.80 99.14
3ot5_A403 UDP-N-acetylglucosamine 2-epimerase; structural ge 99.13
1vgv_A384 UDP-N-acetylglucosamine 2-epimerase; structural ge 99.05
2iuy_A342 Avigt4, glycosyltransferase; antibiotics, family G 99.05
2jjm_A394 Glycosyl transferase, group 1 family protein; anth 98.92
3beo_A375 UDP-N-acetylglucosamine 2-epimerase; UDP-GLCNAC, a 98.9
2iw1_A374 Lipopolysaccharide core biosynthesis protein RFAG; 98.84
2x6q_A416 Trehalose-synthase TRET; biosynthetic protein; 2.2 98.75
3s28_A816 Sucrose synthase 1; glycosyltransferase, sucrose m 98.49
4hwg_A385 UDP-N-acetylglucosamine 2-epimerase; ssgcid, struc 98.44
2qzs_A485 Glycogen synthase; glycosyl-transferase, GT-B fold 98.33
1rzu_A485 Glycogen synthase 1; glycosyl-transferase, GT-B fo 98.25
2f9f_A177 First mannosyl transferase (WBAZ-1); alpha-beta pr 98.11
2hy7_A406 Glucuronosyltransferase GUMK; glycosyltransferases 98.07
3vue_A536 GBSS-I, granule-bound starch synthase 1, chloropla 97.94
2vsy_A568 XCC0866; transferase, glycosyl transferase, GT-B, 97.49
2xci_A374 KDO-transferase, 3-deoxy-D-manno-2-octulosonic aci 97.36
2bfw_A200 GLGA glycogen synthase; glycosyltransferase family 97.35
3oy2_A413 Glycosyltransferase B736L; rossmann fold, GDP-mann 97.29
3rhz_A339 GTF3, nucleotide sugar synthetase-like protein; gl 97.08
3qhp_A166 Type 1 capsular polysaccharide biosynthesis prote 96.95
3q3e_A631 HMW1C-like glycosyltransferase; N-glycosylation; 2 96.29
4gyw_A723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 95.71
2x0d_A413 WSAF; GT4 family, transferase; HET: MSE; 2.28A {Ge 95.16
1psw_A348 ADP-heptose LPS heptosyltransferase II; structural 92.38
2phj_A251 5'-nucleotidase SURE; SURE protein, putative acid 91.76
2wqk_A251 5'-nucleotidase SURE; SURE protein, putative acid 90.34
2x0d_A413 WSAF; GT4 family, transferase; HET: MSE; 2.28A {Ge 89.84
3mc3_A134 DSRE/DSRF-like family protein; structural genomics 89.02
1kjn_A157 MTH0777; hypotethical protein, structural genomics 88.92
3tov_A349 Glycosyl transferase family 9; structural genomics 88.69
1mvl_A209 PPC decarboxylase athal3A; flavoprotein, active si 87.77
1g5t_A196 COB(I)alamin adenosyltransferase; P-loop protein, 87.58
3auf_A229 Glycinamide ribonucleotide transformylase 1; struc 86.85
3pdi_B458 Nitrogenase MOFE cofactor biosynthesis protein NI; 86.17
3zqu_A209 Probable aromatic acid decarboxylase; lyase; HET: 85.93
3qjg_A175 Epidermin biosynthesis protein EPID; structural ge 85.76
2e6c_A244 5'-nucleotidase SURE; SURE protein, cowith mangane 85.68
3rfo_A317 Methionyl-tRNA formyltransferase; structural genom 84.98
1l5x_A280 SurviVal protein E; structural genomics, putative 84.49
3nb0_A725 Glycogen [starch] synthase isoform 2; glycogen syn 84.11
1j9j_A247 Stationary phase surviVal protein; SURE protein, u 84.1
3lqk_A201 Dipicolinate synthase subunit B; flavoprotein, PSI 83.87
2ejb_A189 Probable aromatic acid decarboxylase; phenylacryli 83.45
2yxb_A161 Coenzyme B12-dependent mutase; alpha/beta, structu 83.38
1sbz_A197 Probable aromatic acid decarboxylase; FMN binding, 83.36
2ywr_A216 Phosphoribosylglycinamide formyltransferase; rossm 83.03
1ccw_A137 Protein (glutamate mutase); coenzyme B12, radical 81.83
3t5t_A496 Putative glycosyltransferase; GTB fold, pseudoglyc 81.8
3vot_A425 L-amino acid ligase, BL00235; ATP-grAsp motif, ATP 80.26
1qzu_A206 Hypothetical protein MDS018; alpha-beta sandwich, 80.13
>3hbf_A Flavonoid 3-O-glucosyltransferase; glycosyltransferase, GT-B fold, GT1, phenylpropanoid metabolism; HET: UDP MYC; 2.10A {Medicago truncatula} SCOP: c.87.1.0 PDB: 3hbj_A* Back     alignment and structure
Probab=100.00  E-value=8.9e-57  Score=421.21  Aligned_cols=343  Identities=23%  Similarity=0.384  Sum_probs=270.1

Q ss_pred             CCCcEEEEEcCCCCCChHHHHHHHHHHHhCC--CeEEEEeCccccccccCCC-CCCCCeeEEEcCCCCCCCCCCCcCCHH
Q 036519           12 SKLAHCLVLSYPAQGHMNPLLQFSKRLEHNG--IKVTLVTTYFISKSLHRDP-SSSISIPLETISDGYDEGRSAQAETDQ   88 (365)
Q Consensus        12 ~~~~~il~~~~~~~GH~~p~l~la~~L~~~G--h~Vt~~~~~~~~~~v~~~~-~~~~gi~~~~l~~~~~~~~~~~~~~~~   88 (365)
                      .++.||+++|+|++||++|++.||+.|+++|  +.|||++++.+...+.+.. ...++++|+.+|+++++ +.+...+..
T Consensus        11 ~~~~hvv~~P~p~~GHi~P~l~Lak~L~~~g~~~~vT~~~t~~~~~~~~~~~~~~~~~i~~~~ipdglp~-~~~~~~~~~   89 (454)
T 3hbf_A           11 NNLLHVAVLAFPFGTHAAPLLSLVKKIATEAPKVTFSFFCTTTTNDTLFSRSNEFLPNIKYYNVHDGLPK-GYVSSGNPR   89 (454)
T ss_dssp             -CCCEEEEECCCSSSSHHHHHHHHHHHHHHCTTSEEEEEECHHHHHHSCSSSSCCCTTEEEEECCCCCCT-TCCCCSCTT
T ss_pred             CCCCEEEEEcCCcccHHHHHHHHHHHHHhCCCCEEEEEEeCHHHHHhhhcccccCCCCceEEecCCCCCC-CccccCChH
Confidence            4578999999999999999999999999999  9999999987776665311 11357999999999987 544444433


Q ss_pred             HHHHHHHHHh----HHHHHHHHHhcC-CCcEEEEcCCCccHHHHHHHhCCceEEEecccHHHHHHHHHhhc--cccc--C
Q 036519           89 AYVDRFWQIG----VQTLTELVERMN-DVDCIVYDSFLPWALDVAKKFGLTGAAFLTQSCTVASIYHYVNK--GLIK--L  159 (365)
Q Consensus        89 ~~~~~~~~~~----~~~l~~ll~~~~-~pD~vv~D~~~~~a~~~A~~~giP~v~~~~~~~~~~~~~~~~~~--~~~~--~  159 (365)
                      ..+..+....    .+.+.+++++.. +|||||+|.+++|+..+|+++|||++.|++++++.++.+++...  ....  .
T Consensus        90 ~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~iI~D~~~~w~~~vA~~lgIP~~~f~t~~a~~~~~~~~~~~~~~~~~~~~  169 (454)
T 3hbf_A           90 EPIFLFIKAMQENFKHVIDEAVAETGKNITCLVTDAFFWFGADLAEEMHAKWVPLWTAGPHSLLTHVYTDLIREKTGSKE  169 (454)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEETTCTTHHHHHHHTTCEEEEEECSCHHHHHHHHTHHHHHHTCCHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHhhcCCCCcEEEECCcchHHHHHHHHhCCCEEEEeCccHHHHHHHHhhHHHHhhcCCCc
Confidence            3344444333    334444444322 89999999999999999999999999999999999888776532  1110  0


Q ss_pred             CCCCCccc-cCCCCCCCCCCCCCccCCCCCchhHHHHHHHhhhhccccchhHhHhhHhhhhhhh----------------
Q 036519          160 PLTGDQVF-LPGLPPLDPQDTPSFINDPASYPAFFDMILTRQFSNIDKADWILCNTFYELEKEV----------------  222 (365)
Q Consensus       160 ~~~~~~~~-~pg~p~~~~~~lp~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~----------------  222 (365)
                      ......+. +||+|++..+++|.++.. +....+..++ ....+...+++.+++|++.++|..+                
T Consensus       170 ~~~~~~~~~iPg~p~~~~~dlp~~~~~-~~~~~~~~~~-~~~~~~~~~~~~vl~ns~~eLE~~~~~~~~~~~~~v~~vGP  247 (454)
T 3hbf_A          170 VHDVKSIDVLPGFPELKASDLPEGVIK-DIDVPFATML-HKMGLELPRANAVAINSFATIHPLIENELNSKFKLLLNVGP  247 (454)
T ss_dssp             HTTSSCBCCSTTSCCBCGGGSCTTSSS-CTTSHHHHHH-HHHHHHGGGSSCEEESSCGGGCHHHHHHHHTTSSCEEECCC
T ss_pred             cccccccccCCCCCCcChhhCchhhcc-CCchHHHHHH-HHHHHhhccCCEEEECChhHhCHHHHHHHHhcCCCEEEECC
Confidence            01133444 899999999999998864 3334455555 5556667777788888888887642                


Q ss_pred             ----------------------------------------------------------hCchhh---CCCCcccccccCC
Q 036519          223 ----------------------------------------------------------IKESEQ---SKLPENFSDETTQ  241 (365)
Q Consensus       223 ----------------------------------------------------------~~~~~~---~~~p~~~~~~~~~  241 (365)
                                                                                +|..+.   ..+|+++.++.++
T Consensus       248 l~~~~~~~~~~~~~~~~~wLd~~~~~~vVyvsfGS~~~~~~~~~~el~~~l~~~~~~flw~~~~~~~~~lp~~~~~~~~~  327 (454)
T 3hbf_A          248 FNLTTPQRKVSDEHGCLEWLDQHENSSVVYISFGSVVTPPPHELTALAESLEECGFPFIWSFRGDPKEKLPKGFLERTKT  327 (454)
T ss_dssp             HHHHSCCSCCCCTTCHHHHHHTSCTTCEEEEECCSSCCCCHHHHHHHHHHHHHHCCCEEEECCSCHHHHSCTTHHHHTTT
T ss_pred             cccccccccccchHHHHHHHhcCCCCceEEEecCCCCcCCHHHHHHHHHHHHhCCCeEEEEeCCcchhcCCHhHHhhcCC
Confidence                                                                      233222   2467777777788


Q ss_pred             CCeEEeecchhhhhcccccccccccCChhhHHHHHHcCCCeeeccccCchhhHHHHHHhHhcceeEecCCCCCcccHHHH
Q 036519          242 KGLVVNWCPQLGVLAHEATGCFLTHCGWNSTIEALRLGVPMLAMPLWTDQSTNSKYVMDVWKMGLKVPADEKGIVRREAI  321 (365)
Q Consensus       242 ~~~~~~~~p~~~~L~~~~~~~~I~hgG~gs~~eal~~GvP~v~~P~~~DQ~~nA~~v~~~~G~G~~~~~~~~~~~~~~~l  321 (365)
                      |+++++|+||.++|+|+++++||||||+||++|++++|||||++|++.||+.||+++++.||+|+.++..   .+++++|
T Consensus       328 ~~~vv~w~Pq~~vL~h~~v~~fvtH~G~~S~~Eal~~GvP~i~~P~~~DQ~~Na~~v~~~~g~Gv~l~~~---~~~~~~l  404 (454)
T 3hbf_A          328 KGKIVAWAPQVEILKHSSVGVFLTHSGWNSVLECIVGGVPMISRPFFGDQGLNTILTESVLEIGVGVDNG---VLTKESI  404 (454)
T ss_dssp             TEEEESSCCHHHHHHSTTEEEEEECCCHHHHHHHHHHTCCEEECCCSTTHHHHHHHHHTTSCSEEECGGG---SCCHHHH
T ss_pred             ceEEEeeCCHHHHHhhcCcCeEEecCCcchHHHHHHcCCCEecCcccccHHHHHHHHHHhhCeeEEecCC---CCCHHHH
Confidence            9999999999999999998889999999999999999999999999999999999999966999999865   8999999


Q ss_pred             HHHHHHHhcCH---HHHHHHHHHH-------HcCCCcHHHHHHHHHHHH
Q 036519          322 AHCIGEILEGD---KWRNFAKEAV-------AKGGSSDKNIDDFVANLI  360 (365)
Q Consensus       322 ~~~i~~ll~~~---~~~~~a~~~~-------~~~g~s~~~~~~~~~~i~  360 (365)
                      +++|+++|+|+   +||++|++++       ++||||++++++|++.|.
T Consensus       405 ~~av~~ll~~~~~~~~r~~a~~l~~~~~~a~~~gGsS~~~l~~~v~~i~  453 (454)
T 3hbf_A          405 KKALELTMSSEKGGIMRQKIVKLKESAFKAVEQNGTSAMDFTTLIQIVT  453 (454)
T ss_dssp             HHHHHHHHSSHHHHHHHHHHHHHHHHHHHHTSTTSHHHHHHHHHHHHHT
T ss_pred             HHHHHHHHCCChHHHHHHHHHHHHHHHHHhhccCCCHHHHHHHHHHHHh
Confidence            99999999887   7999998763       358999999999999885
>2vch_A Hydroquinone glucosyltransferase; glycosyltransferase, N-glucosyltransferase, UDP-glucose- dependent, plant glycosyltransferase; HET: UDP; 1.45A {Arabidopsis thaliana} SCOP: c.87.1.10 PDB: 2vce_A* 2vg8_A* Back     alignment and structure
>2c1x_A UDP-glucose flavonoid 3-O glycosyltransferase; WINE, catalysis, glycosylation; HET: UDP B3P; 1.9A {Vitis vinifera} SCOP: c.87.1.10 PDB: 2c1z_A* 2c9z_A* Back     alignment and structure
>2pq6_A UDP-glucuronosyl/UDP-glucosyltransferase; glycosylation, isoflavonoid, uridine diphosphate glycosyltransferase; 2.10A {Medicago truncatula} SCOP: c.87.1.10 Back     alignment and structure
>2acv_A Triterpene UDP-glucosyl transferase UGT71G1; glycosyltransferase; HET: UDP; 2.00A {Medicago truncatula} SCOP: c.87.1.10 PDB: 2acw_A* Back     alignment and structure
>4amg_A Snogd; transferase, polyketide biosynthesis, GT1 family, nogalamyci; HET: MLY; 2.59A {Streptomyces nogalater} PDB: 4an4_A* 4amb_A* Back     alignment and structure
>2iya_A OLEI, oleandomycin glycosyltransferase; carbohydrate, glycosylation, enzyme, macrolide; HET: UDP ZIO; 1.7A {Streptomyces antibioticus} Back     alignment and structure
>3rsc_A CALG2; TDP, enediyne, structural genomics, PSI-2, protein structure initiative, center for eukaryotic structural genomics; HET: TYD C0T; 2.19A {Micromonospora echinospora} PDB: 3iaa_A* Back     alignment and structure
>3ia7_A CALG4; glycosysltransferase, calicheamicin, enediyne, transf; 1.91A {Micromonospora echinospora} Back     alignment and structure
>3h4t_A Glycosyltransferase GTFA, glycosyltransferase; vancomycin, teicoplanin, ORF1, natural products, antibiotic; HET: UDP; 1.15A {Amycolatopsis orientalis} SCOP: c.87.1.5 PDB: 3h4i_A* 1pn3_A* 1pnv_A* Back     alignment and structure
>1iir_A Glycosyltransferase GTFB; rossmann fold; 1.80A {Amycolatopsis orientalis} SCOP: c.87.1.5 Back     alignment and structure
>2yjn_A ERYCIII, glycosyltransferase; transferase, cytochrome P450; 3.09A {Saccharopolyspora erythraea} Back     alignment and structure
>1rrv_A Glycosyltransferase GTFD; GT-B, glycosyltransferase, rossmann fold, glycopeptide, VACO antibiotic, transferase-antibiotic complex; HET: OMZ GHP OMY 3FG TYD BGC; 2.00A {Amycolatopsis orientalis} SCOP: c.87.1.5 Back     alignment and structure
>2p6p_A Glycosyl transferase; X-RAY-diffraction,urdamycina-biosynthesis; 1.88A {Streptomyces fradiae} Back     alignment and structure
>4fzr_A SSFS6; structural genomics, PSI-biology, protein structure initiati enzyme discovery for natural product biosynthesis, natPro; 2.40A {Streptomyces SP} PDB: 4g2t_A* Back     alignment and structure
>3oti_A CALG3; calicheamicin, TDP, structural genomics, PSI-2, protein STRU initiative, center for eukaryotic structural genomics, CESG fold; HET: TYD C0T; 1.60A {Micromonospora echinospora} PDB: 3d0q_A* 3d0r_A* Back     alignment and structure
>2iyf_A OLED, oleandomycin glycosyltransferase; antibiotic resistance, glycosylation, enzyme, macrolide, carbohydrate; HET: ERY UDP; 1.7A {Streptomyces antibioticus} Back     alignment and structure
>3tsa_A SPNG, NDP-rhamnosyltransferase; glycosyltransferase; HET: GLC; 1.70A {Saccharopolyspora spinosa} PDB: 3uyk_A* 3uyl_A* Back     alignment and structure
>3otg_A CALG1; calicheamicin, TDP, structural genomics, PSI-2, protein STRU initiative, center for eukaryotic structural genomics, CESG fold; HET: TYD; 2.08A {Micromonospora echinospora} PDB: 3oth_A* Back     alignment and structure
>3s2u_A UDP-N-acetylglucosamine--N-acetylmuramyl-(pentape pyrophosphoryl-undecaprenol N-acetylglucosamine...; N-acetylglucosaminyl transferase; HET: UD1; 2.23A {Pseudomonas aeruginosa} Back     alignment and structure
>2o6l_A UDP-glucuronosyltransferase 2B7; drug metabolism, rossman, MAD, enzyme, nucleotide binding, sugar,UDP-glucuronosyltransferase, UGT; 1.80A {Homo sapiens} Back     alignment and structure
>1f0k_A MURG, UDP-N-acetylglucosamine-N-acetylmuramyl- (pentapeptide) pyrophosphoryl-undecaprenol...; rossmann fold, transferase; 1.90A {Escherichia coli} SCOP: c.87.1.2 PDB: 1nlm_A* Back     alignment and structure
>3hbm_A UDP-sugar hydrolase; PSEG; 1.80A {Campylobacter jejuni subsp} PDB: 3hbn_A* Back     alignment and structure
>3c48_A Predicted glycosyltransferases; retaining glycosyltransferase, beta alpha beta, substrate AS catalysis; 2.10A {Corynebacterium glutamicum} PDB: 3c4v_A* 3c4q_A* Back     alignment and structure
>2jzc_A UDP-N-acetylglucosamine transferase subunit ALG13; rossmann-like fold, endoplasmic reticulum, glycosyltransferase, structural genomics; NMR {Saccharomyces cerevisiae} PDB: 2ks6_A Back     alignment and structure
>1v4v_A UDP-N-acetylglucosamine 2-epimerase; UDP-GLCNAC, two domains, homodimer, riken structural genomics/proteomics initiative, RSGI; HET: MSE; 1.80A {Thermus thermophilus} SCOP: c.87.1.3 Back     alignment and structure
>2gek_A Phosphatidylinositol mannosyltransferase (PIMA); GT4 glycosyltransferase, rossmann fold, complex; HET: GDP; 2.40A {Mycobacterium smegmatis} PDB: 2gej_A* Back     alignment and structure
>3okp_A GDP-mannose-dependent alpha-(1-6)-phosphatidylino monomannoside mannosyltransferase...; GT-B fold, alpha-mannosyltransferase; HET: GDD; 2.00A {Corynebacterium glutamicum} PDB: 3okc_A* 3oka_A* Back     alignment and structure
>3fro_A GLGA glycogen synthase; glycosyltransferase family, UDP/ADP-glucose-glycogen synthas rossman folds, transferase; HET: NHF; 2.50A {Pyrococcus abyssi} SCOP: c.87.1.8 PDB: 2bis_A* 3l01_A* Back     alignment and structure
>3dzc_A UDP-N-acetylglucosamine 2-epimerase; structural genomics, in diseases, isomerase, center for structural genomics of INFE diseases, csgid; 2.35A {Vibrio cholerae} Back     alignment and structure
>2r60_A Glycosyl transferase, group 1; rossmann-fold; 1.80A {Halothermothrix orenii} PDB: 2r66_A* 2r68_A* Back     alignment and structure
>3ot5_A UDP-N-acetylglucosamine 2-epimerase; structural genomics, center for structural genomics of infec diseases, csgid, alpha beta; HET: PGE; 2.20A {Listeria monocytogenes} Back     alignment and structure
>1vgv_A UDP-N-acetylglucosamine 2-epimerase; structural genomics, isomerase; HET: UD1; 2.31A {Escherichia coli} SCOP: c.87.1.3 PDB: 1f6d_A* Back     alignment and structure
>2iuy_A Avigt4, glycosyltransferase; antibiotics, family GT-4, avilamycin A; HET: MES; 2.1A {Streptomyces viridochromogenes} PDB: 2iv3_A* Back     alignment and structure
>2jjm_A Glycosyl transferase, group 1 family protein; anthrax, nucleotide, carbohydrate; 3.10A {Bacillus anthracis} PDB: 3mbo_A* Back     alignment and structure
>3beo_A UDP-N-acetylglucosamine 2-epimerase; UDP-GLCNAC, allosteric, regulation, isomerase; HET: UD1 UDP; 1.70A {Bacillus anthracis} PDB: 1o6c_A Back     alignment and structure
>2iw1_A Lipopolysaccharide core biosynthesis protein RFAG; transferase, lipopolysaccharide biosynthesis, family GT-4, glycosyltransferase, LPS; HET: U2F; 1.5A {Escherichia coli} SCOP: c.87.1.8 PDB: 2iv7_A* Back     alignment and structure
>2x6q_A Trehalose-synthase TRET; biosynthetic protein; 2.20A {Pyrococcus horikoshii} PDB: 2x6r_A 2xa1_A 2xa2_A* 2xa9_A* 2xmp_A* Back     alignment and structure
>3s28_A Sucrose synthase 1; glycosyltransferase, sucrose metabolism, sugar donar complex rossmann fold, GT-B fold, glycosyltansferase, UDP-glucose; HET: UDP LCN NHF; 2.80A {Arabidopsis thaliana} PDB: 3s27_A* 3s29_A* Back     alignment and structure
>4hwg_A UDP-N-acetylglucosamine 2-epimerase; ssgcid, structural genomics, seattle structural genomics center for infectious disease, isomerase; 2.00A {Rickettsia bellii} Back     alignment and structure
>2qzs_A Glycogen synthase; glycosyl-transferase, GT-B fold, rossmann fold, closed-form, ADP and glucose binding, glycogen biosynthesis; HET: GLC ADP 250; 2.20A {Escherichia coli} PDB: 2r4t_A* 2r4u_A* 3guh_A* 3cx4_A* 3cop_A* 3d1j_A Back     alignment and structure
>1rzu_A Glycogen synthase 1; glycosyl-transferase, GT-B fold, rossmann fold, ADP-binding, transferase; HET: ADP; 2.30A {Agrobacterium tumefaciens} SCOP: c.87.1.8 PDB: 1rzv_A Back     alignment and structure
>2f9f_A First mannosyl transferase (WBAZ-1); alpha-beta protein, structural genomics, PSI, protein struct initiative; 1.80A {Archaeoglobus fulgidus} SCOP: c.87.1.8 Back     alignment and structure
>2hy7_A Glucuronosyltransferase GUMK; glycosyltransferases, xanthan, membrane-associated proteins; 1.90A {Xanthomonas campestris} PDB: 2q6v_A* 3cv3_A* 3cuy_A* Back     alignment and structure
>3vue_A GBSS-I, granule-bound starch synthase 1, chloroplastic/amyloplastic; rossmann fold, glycosyltransferase, transferase; 2.70A {Oryza sativa japonica group} PDB: 3vuf_A* Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>2xci_A KDO-transferase, 3-deoxy-D-manno-2-octulosonic acid transferase; KDTA, GSEA, glycosyltransferase superfamily B,; HET: PG4; 2.00A {Aquifex aeolicus} PDB: 2xcu_A* Back     alignment and structure
>2bfw_A GLGA glycogen synthase; glycosyltransferase family 5 UDP/ADP-glucose-glycogen syntha rossman folds, transferase; 1.8A {Pyrococcus abyssi} SCOP: c.87.1.8 Back     alignment and structure
>3oy2_A Glycosyltransferase B736L; rossmann fold, GDP-mannose, sugar, VIRU proteins, viral protein,transferase; 2.31A {Paramecium bursaria chlorella virus NY} PDB: 3oy7_A* Back     alignment and structure
>3rhz_A GTF3, nucleotide sugar synthetase-like protein; glycosyltransferase, transferase; HET: UDP; 1.90A {Streptococcus parasanguinis} PDB: 3qkw_A* Back     alignment and structure
>3qhp_A Type 1 capsular polysaccharide biosynthesis prote (CAPJ); rossmann fold, glycosyltransferase, transferase; 1.50A {Helicobacter pylori} Back     alignment and structure
>3q3e_A HMW1C-like glycosyltransferase; N-glycosylation; 2.10A {Actinobacillus pleuropneumoniae serovaorganism_taxid} PDB: 3q3h_A* 3q3i_A Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>2x0d_A WSAF; GT4 family, transferase; HET: MSE; 2.28A {Geobacillus stearothermophilus} PDB: 2x0f_A* 2x0e_A* Back     alignment and structure
>1psw_A ADP-heptose LPS heptosyltransferase II; structural genomics, NYSGXRC, LPS biosynthetic pathway, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.87.1.7 Back     alignment and structure
>2wqk_A 5'-nucleotidase SURE; SURE protein, putative acid phosphatase, structural genomics, 3-D structure, mixed alpha/beta protein, NPPSFA; 1.50A {Aquifex aeolicus} Back     alignment and structure
>2x0d_A WSAF; GT4 family, transferase; HET: MSE; 2.28A {Geobacillus stearothermophilus} PDB: 2x0f_A* 2x0e_A* Back     alignment and structure
>3mc3_A DSRE/DSRF-like family protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MLY MSE; 1.49A {Sulfolobus solfataricus} Back     alignment and structure
>1kjn_A MTH0777; hypotethical protein, structural genomics, PSI, protein structure initiative; 2.20A {Methanothermobacterthermautotrophicus} SCOP: c.115.1.1 Back     alignment and structure
>3tov_A Glycosyl transferase family 9; structural genomics, PSI-BIOL protein structure initiative, midwest center for structural genomics, MCSG; 2.98A {Veillonella parvula} Back     alignment and structure
>1mvl_A PPC decarboxylase athal3A; flavoprotein, active site mutant C175S; HET: FMN; 2.00A {Arabidopsis thaliana} SCOP: c.34.1.1 PDB: 1mvn_A* 1e20_A* Back     alignment and structure
>1g5t_A COB(I)alamin adenosyltransferase; P-loop protein, cobalamin biosynthesis, RECA fold; HET: ATP; 1.80A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1g5r_A* 1g64_A* Back     alignment and structure
>3auf_A Glycinamide ribonucleotide transformylase 1; structural genomics, riken structural genomics/proteomics in RSGI, rossmann fold; 2.07A {Symbiobacterium toebii} Back     alignment and structure
>3pdi_B Nitrogenase MOFE cofactor biosynthesis protein NI; nitrogenase cofactor maturation, NIFB, nifdk, NIFH; HET: CZL; 2.40A {Azotobacter vinelandii} Back     alignment and structure
>3zqu_A Probable aromatic acid decarboxylase; lyase; HET: FNR; 1.50A {Pseudomonas aeruginosa} SCOP: c.34.1.0 Back     alignment and structure
>3qjg_A Epidermin biosynthesis protein EPID; structural genomics, center for structural genomics of infec diseases, csgid, oxidoreductase; HET: FMN; 2.04A {Staphylococcus aureus} SCOP: c.34.1.0 Back     alignment and structure
>2e6c_A 5'-nucleotidase SURE; SURE protein, cowith manganese ION and AMP hydrolase; 2.05A {Thermus thermophilus} PDB: 2e6b_A 2e69_A 2e6e_A 2e6g_A 2e6h_A Back     alignment and structure
>1l5x_A SurviVal protein E; structural genomics, putative acid phosphatase, mixed alpha/ protein, N-terminal rossmann-fold like; 2.00A {Pyrobaculum aerophilum} SCOP: c.106.1.1 Back     alignment and structure
>3nb0_A Glycogen [starch] synthase isoform 2; glycogen synthase, glucose-6-phosphate, yeast, allosteric AC transferase; HET: G6P; 2.41A {Saccharomyces cerevisiae} PDB: 3rt1_A* 3nch_A 3naz_A 3o3c_A* 3rsz_A* Back     alignment and structure
>1j9j_A Stationary phase surviVal protein; SURE protein, unknown function; 1.90A {Thermotoga maritima} SCOP: c.106.1.1 PDB: 1ilv_A 1j9k_A* 1j9l_A* Back     alignment and structure
>3lqk_A Dipicolinate synthase subunit B; flavoprotein, PSI2, MCSG, structural protein structure initiative, midwest center for structural genomics; 2.10A {Bacillus halodurans} Back     alignment and structure
>2ejb_A Probable aromatic acid decarboxylase; phenylacrylic acid decarboxylase, X-RAY diffraction, structural genomics, NPPSFA; 2.15A {Aquifex aeolicus} Back     alignment and structure
>2yxb_A Coenzyme B12-dependent mutase; alpha/beta, structural genomics, NPPSFA, national project on structural and functional analyses; 1.80A {Aeropyrum pernix} Back     alignment and structure
>1sbz_A Probable aromatic acid decarboxylase; FMN binding, PAD1, UBIX, montreal-kingston bacterial structu genomics initiative, BSGI; HET: FMN; 2.00A {Escherichia coli} SCOP: c.34.1.1 Back     alignment and structure
>2ywr_A Phosphoribosylglycinamide formyltransferase; rossmann fold, structural genomics, NPPSFA; 1.77A {Aquifex aeolicus} Back     alignment and structure
>1ccw_A Protein (glutamate mutase); coenzyme B12, radical reaction, TIM-barrel rossman-fold, isomerase; HET: CNC TAR; 1.60A {Clostridium cochlearium} SCOP: c.23.6.1 PDB: 1cb7_A* 1b1a_A 1i9c_A* 1be1_A 1fmf_A 1id8_A* Back     alignment and structure
>3t5t_A Putative glycosyltransferase; GTB fold, pseudoglycosyltransferase; 1.70A {Streptomyces hygroscopicus} PDB: 4f97_A* 4f96_B* 4f9f_A* 3t7d_A* Back     alignment and structure
>3vot_A L-amino acid ligase, BL00235; ATP-grAsp motif, ATP-binding; HET: ADP PG4; 1.80A {Bacillus licheniformis} Back     alignment and structure
>1qzu_A Hypothetical protein MDS018; alpha-beta sandwich, lyase; HET: FMN; 2.91A {Homo sapiens} SCOP: c.34.1.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 365
d2vcha1471 c.87.1.10 (A:6-476) Hydroquinone glucosyltransfera 1e-41
d2vcha1 471 c.87.1.10 (A:6-476) Hydroquinone glucosyltransfera 8e-23
d2pq6a1473 c.87.1.10 (A:8-480) (Iso)flavonoid glycosyltransfe 2e-37
d2pq6a1473 c.87.1.10 (A:8-480) (Iso)flavonoid glycosyltransfe 7e-26
d2acva1461 c.87.1.10 (A:3-463) Triterpene UDP-glucosyl transf 1e-36
d2acva1461 c.87.1.10 (A:3-463) Triterpene UDP-glucosyl transf 2e-25
d2c1xa1450 c.87.1.10 (A:7-456) UDP glucose:flavonoid 3-o-gluc 9e-35
d2c1xa1450 c.87.1.10 (A:7-456) UDP glucose:flavonoid 3-o-gluc 3e-30
d1iira_401 c.87.1.5 (A:) UDP-glucosyltransferase GtfB {Amycol 8e-26
d1pn3a_391 c.87.1.5 (A:) TDP-epi-vancosaminyltransferase GtfA 6e-25
d1rrva_401 c.87.1.5 (A:) TDP-vancosaminyltransferase GftD {Am 3e-22
>d2vcha1 c.87.1.10 (A:6-476) Hydroquinone glucosyltransferase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 471 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: UDP-Glycosyltransferase/glycogen phosphorylase
superfamily: UDP-Glycosyltransferase/glycogen phosphorylase
family: UDPGT-like
domain: Hydroquinone glucosyltransferase
species: Thale cress (Arabidopsis thaliana) [TaxId: 3702]

 Score =  149 bits (376), Expect = 1e-41
 Identities = 48/159 (30%), Positives = 80/159 (50%), Gaps = 11/159 (6%)

Query: 217 ELEKEVIKESEQSKLPENFSDETTQKGLV-VNWCPQLGVLAHEATGCFLTHCGWNSTIEA 275
                  +    + LP  F + T ++G V   W PQ  VLAH +TG FLTHCGWNST+E+
Sbjct: 309 SYFDSHSQTDPLTFLPPGFLERTKKRGFVIPFWAPQAQVLAHPSTGGFLTHCGWNSTLES 368

Query: 276 LRLGVPMLAMPLWTDQSTNSKYVMDVWKMGLKVPADEKGIVRREAIAHCIGEILEGD--- 332
           +  G+P++A PL+ +Q  N+  + +  +  L+  A + G+VRRE +A  +  ++EG+   
Sbjct: 369 VVSGIPLIAWPLYAEQKMNAVLLSEDIRAALRPRAGDDGLVRREEVARVVKGLMEGEEGK 428

Query: 333 -------KWRNFAKEAVAKGGSSDKNIDDFVANLISSKS 364
                  + +  A   +   G+S K +        + K 
Sbjct: 429 GVRNKMKELKEAACRVLKDDGTSTKALSLVALKWKAHKK 467
>d2vcha1 c.87.1.10 (A:6-476) Hydroquinone glucosyltransferase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 471 Back     information, alignment and structure
>d2pq6a1 c.87.1.10 (A:8-480) (Iso)flavonoid glycosyltransferase {Medicago truncatula [TaxId: 3880]} Length = 473 Back     information, alignment and structure
>d2pq6a1 c.87.1.10 (A:8-480) (Iso)flavonoid glycosyltransferase {Medicago truncatula [TaxId: 3880]} Length = 473 Back     information, alignment and structure
>d2acva1 c.87.1.10 (A:3-463) Triterpene UDP-glucosyl transferase UGT71G1 {Medicago truncatula [TaxId: 3880]} Length = 461 Back     information, alignment and structure
>d2acva1 c.87.1.10 (A:3-463) Triterpene UDP-glucosyl transferase UGT71G1 {Medicago truncatula [TaxId: 3880]} Length = 461 Back     information, alignment and structure
>d2c1xa1 c.87.1.10 (A:7-456) UDP glucose:flavonoid 3-o-glucosyltransferase {Grape (Vitis vinifera) [TaxId: 29760]} Length = 450 Back     information, alignment and structure
>d2c1xa1 c.87.1.10 (A:7-456) UDP glucose:flavonoid 3-o-glucosyltransferase {Grape (Vitis vinifera) [TaxId: 29760]} Length = 450 Back     information, alignment and structure
>d1iira_ c.87.1.5 (A:) UDP-glucosyltransferase GtfB {Amycolatopsis orientalis [TaxId: 31958]} Length = 401 Back     information, alignment and structure
>d1pn3a_ c.87.1.5 (A:) TDP-epi-vancosaminyltransferase GtfA {Amycolatopsis orientalis [TaxId: 31958]} Length = 391 Back     information, alignment and structure
>d1rrva_ c.87.1.5 (A:) TDP-vancosaminyltransferase GftD {Amycolatopsis orientalis [TaxId: 31958]} Length = 401 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query365
d2c1xa1450 UDP glucose:flavonoid 3-o-glucosyltransferase {Gra 100.0
d2pq6a1473 (Iso)flavonoid glycosyltransferase {Medicago trunc 100.0
d2vcha1471 Hydroquinone glucosyltransferase {Thale cress (Ara 100.0
d2acva1461 Triterpene UDP-glucosyl transferase UGT71G1 {Medic 100.0
d1pn3a_391 TDP-epi-vancosaminyltransferase GtfA {Amycolatopsi 100.0
d1rrva_401 TDP-vancosaminyltransferase GftD {Amycolatopsis or 100.0
d1iira_401 UDP-glucosyltransferase GtfB {Amycolatopsis orient 100.0
d1f0ka_351 Peptidoglycan biosynthesis glycosyltransferase Mur 99.95
d2bisa1437 Glycogen synthase 1, GlgA {Pyrococcus abyssi [TaxI 98.89
d2iw1a1370 Lipopolysaccharide core biosynthesis protein RfaG 98.59
d1o6ca_377 UDP-N-acetylglucosamine 2-epimerase {Bacillus subt 98.4
d1rzua_477 Glycogen synthase 1, GlgA {Agrobacterium tumefacie 98.3
d1v4va_373 UDP-N-acetylglucosamine 2-epimerase {Thermus therm 97.92
d1f6da_376 UDP-N-acetylglucosamine 2-epimerase {Escherichia c 97.72
d2f9fa1166 First mannosyl transferase WbaZ {Archaeoglobus ful 97.49
d2bfwa1196 Glycogen synthase 1, GlgA {Pyrococcus abyssi [TaxI 96.51
d1j9ja_247 SurE homolog TM1662 {Thermotoga maritima [TaxId: 2 91.75
d1ccwa_137 Glutamate mutase, small subunit {Clostridium cochl 91.51
d1gsaa1122 Prokaryotic glutathione synthetase, N-terminal dom 88.88
d1pswa_348 ADP-heptose LPS heptosyltransferase II {Escherichi 86.48
d1u7za_223 Coenzyme A biosynthesis bifunctional protein CoaBC 86.1
d1l5xa_276 SurE homolog PAE2908 (SurE-alpha) {Archaeon Pyroba 84.19
d7reqa2168 Methylmalonyl-CoA mutase alpha subunit, C-terminal 84.17
d1j6ua189 UDP-N-acetylmuramate-alanine ligase MurC {Thermoto 82.35
d1gsoa2105 Glycinamide ribonucleotide synthetase (GAR-syn), N 81.82
d3bula2156 Methionine synthase, C-terminal domain {Escherichi 81.56
d1jaya_212 Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archae 80.87
d1irxa2317 Class I lysyl-tRNA synthetase {Archaeon Pyrococcus 80.86
d1uana_227 Hypothetical protein TT1542 {Thermus thermophilus 80.57
d1p3da196 UDP-N-acetylmuramate-alanine ligase MurC {Haemophi 80.51
>d2c1xa1 c.87.1.10 (A:7-456) UDP glucose:flavonoid 3-o-glucosyltransferase {Grape (Vitis vinifera) [TaxId: 29760]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: UDP-Glycosyltransferase/glycogen phosphorylase
superfamily: UDP-Glycosyltransferase/glycogen phosphorylase
family: UDPGT-like
domain: UDP glucose:flavonoid 3-o-glucosyltransferase
species: Grape (Vitis vinifera) [TaxId: 29760]

Probab=100.00  E-value=1.6e-46  Score=353.50  Aligned_cols=344  Identities=26%  Similarity=0.381  Sum_probs=225.1

Q ss_pred             CcEEEEEcCCCCCChHHHHHHHHHHHhCCCeEEEEeCccc---cccccC-CCCCCCCeeEEEcCCCCCCCCCCCcCCHHH
Q 036519           14 LAHCLVLSYPAQGHMNPLLQFSKRLEHNGIKVTLVTTYFI---SKSLHR-DPSSSISIPLETISDGYDEGRSAQAETDQA   89 (365)
Q Consensus        14 ~~~il~~~~~~~GH~~p~l~la~~L~~~Gh~Vt~~~~~~~---~~~v~~-~~~~~~gi~~~~l~~~~~~~~~~~~~~~~~   89 (365)
                      ..||+|+|+|++||++|+++||++|++|||+|||++....   .+.... .......+.+..++++++. ..........
T Consensus         1 ~~hvl~~p~P~~gH~~p~l~la~~L~~rGH~Vt~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~   79 (450)
T d2c1xa1           1 NPHVAVLAFPFSTHAAPLLAVVRRLAAAAPHAVFSFFSTSQSNASIFHDSMHTMQCNIKSYDISDGVPE-GYVFAGRPQE   79 (450)
T ss_dssp             CCEEEEECCCSSSSHHHHHHHHHHHHHHCTTSEEEEEECHHHHHHHC-------CTTEEEEECCCCCCT-TCCCCCCTTH
T ss_pred             CCEEEEECchhHhHHHHHHHHHHHHHHCCCcEEEEEccCccchhhhhcccccccCCCceeeecCCCCCc-chhhccchHH
Confidence            3699999999999999999999999999999999874321   111111 0112256888888888876 4444444433


Q ss_pred             HHHHHH----HHhHHHHHHHHHhcC-CCcEEEEcCCCccHHHHHHHhCCceEEEecccHHHHHHHHHhhccc----cc-C
Q 036519           90 YVDRFW----QIGVQTLTELVERMN-DVDCIVYDSFLPWALDVAKKFGLTGAAFLTQSCTVASIYHYVNKGL----IK-L  159 (365)
Q Consensus        90 ~~~~~~----~~~~~~l~~ll~~~~-~pD~vv~D~~~~~a~~~A~~~giP~v~~~~~~~~~~~~~~~~~~~~----~~-~  159 (365)
                      .+..+.    ....+.+.+++.... +||+||+|.+..++..+|+++|+|++.+.+.+....+.........    .+ .
T Consensus        80 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~Dlvi~D~~~~~~~~~a~~~~~p~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~  159 (450)
T d2c1xa1          80 DIELFTRAAPESFRQGMVMAVAETGRPVSCLVADAFIWFAADMAAEMGVAWLPFWTAGPNSLSTHVYIDEIREKIGVSGI  159 (450)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHTCCCCEEEEETTSTTHHHHHHHHTCEEEEEECSCHHHHHHHHTHHHHHHHHCSSCC
T ss_pred             HHHHHHHHHHHHhHHHHHHHHHhCCCCCeEEEECCccHHHHHHHHHhCCCEEEEecCchhhhhhhhcccccccccCCCcc
Confidence            333333    233333334444322 8999999999999999999999999999998887666544331111    11 0


Q ss_pred             CC-C-CCccccCCCCCCCCCCCCCccCCCCCchh----------------------------------------------
Q 036519          160 PL-T-GDQVFLPGLPPLDPQDTPSFINDPASYPA----------------------------------------------  191 (365)
Q Consensus       160 ~~-~-~~~~~~pg~p~~~~~~lp~~~~~~~~~~~----------------------------------------------  191 (365)
                      .. . ......++.........+...........                                              
T Consensus       160 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~p~~~~~g~  239 (450)
T d2c1xa1         160 QGREDELLNFIPGMSKVRFRDLQEGIVFGNLNSLFSRMLHRMGQVLPKATAVFINSFEELDDSLTNDLKSKLKTYLNIGP  239 (450)
T ss_dssp             TTCTTCBCTTSTTCTTCBGGGSCTTTSSSCTTSHHHHHHHHHHHHGGGSSCEEESSCGGGCHHHHHHHHHHSSCEEECCC
T ss_pred             ccccccccccCCcccchhHhhhhhhhhcccchHHHHHHHHHHHhhhhcccccccccHHhhhhhhhhhccccCCceeecCC
Confidence            00 0 00001111111110011100000000000                                              


Q ss_pred             ---------------HHHHHHHhhh-------------hccccchhHhHhhHhhhhhhhhCchh---hCCCCcccccccC
Q 036519          192 ---------------FFDMILTRQF-------------SNIDKADWILCNTFYELEKEVIKESE---QSKLPENFSDETT  240 (365)
Q Consensus       192 ---------------~~~~~~~~~~-------------~~~~~~~~~~~~~~~~l~~~~~~~~~---~~~~p~~~~~~~~  240 (365)
                                     +..++ ....             ....+....++..+.++..+++|...   ...+|+++....+
T Consensus       240 ~~~~~~~~~~~~~~~~~~~~-~~~~~~~~v~~s~gs~~~~~~~~~~~~~~~~~~~~~~vl~~~~~~~~~~l~~~~~~~~~  318 (450)
T d2c1xa1         240 FNLITPPPVVPNTTGCLQWL-KERKPTSVVYISFGTVTTPPPAEVVALSEALEASRVPFIWSLRDKARVHLPEGFLEKTR  318 (450)
T ss_dssp             HHHHC---------CHHHHH-HTSCTTCEEEEECCSSCCCCHHHHHHHHHHHHHHTCCEEEECCGGGGGGSCTTHHHHHT
T ss_pred             ccccCCCCCCcchhhhcccc-ccCCccceeeecccccccCCHHHHHHHHHHHHhcCCeEEEEECCCccccCChhhhhhcc
Confidence                           00000 0000             00000012244445555555555432   2456777777788


Q ss_pred             CCCeEEeecchhhhhcccccccccccCChhhHHHHHHcCCCeeeccccCchhhHHHHHHh-HhcceeEecCCCCCcccHH
Q 036519          241 QKGLVVNWCPQLGVLAHEATGCFLTHCGWNSTIEALRLGVPMLAMPLWTDQSTNSKYVMD-VWKMGLKVPADEKGIVRRE  319 (365)
Q Consensus       241 ~~~~~~~~~p~~~~L~~~~~~~~I~hgG~gs~~eal~~GvP~v~~P~~~DQ~~nA~~v~~-~~G~G~~~~~~~~~~~~~~  319 (365)
                      .|+.+..|+||.++|.|+.+++||||||+||++||+++|||||++|+++||+.||+|+++ . |+|+.++..   ++|++
T Consensus       319 ~nv~~~~~~pq~~lL~hp~~~~fItHGG~~s~~eal~~GvP~v~~P~~~DQ~~na~rv~~~~-G~G~~l~~~---~~t~~  394 (450)
T d2c1xa1         319 GYGMVVPWAPQAEVLAHEAVGAFVTHCGWNSLWESVAGGVPLICRPFFGDQRLNGRMVEDVL-EIGVRIEGG---VFTKS  394 (450)
T ss_dssp             TTEEEESCCCHHHHHTSTTEEEEEECCCHHHHHHHHHHTCCEEECCCSTTHHHHHHHHHHTS-CCEEECGGG---SCCHH
T ss_pred             ccccccccCChHhhhccCceeEEEccCCccHHHHHHHcCCCEEecccccchHHHHHHHHHHc-CcEEEecCC---CcCHH
Confidence            999999999999999777777799999999999999999999999999999999999975 7 999999987   89999


Q ss_pred             HHHHHHHHHhcCHHHHHHH---HHHH-------HcCCCcHHHHHHHHHHHHhcc
Q 036519          320 AIAHCIGEILEGDKWRNFA---KEAV-------AKGGSSDKNIDDFVANLISSK  363 (365)
Q Consensus       320 ~l~~~i~~ll~~~~~~~~a---~~~~-------~~~g~s~~~~~~~~~~i~~~~  363 (365)
                      +|.++|+++|+|++|++++   +++.       +++|||.+++..+|+.+.++.
T Consensus       395 ~l~~ai~~vL~d~~y~~~~~r~~~l~~~~~~a~~~~gss~~~~~~~~e~v~r~~  448 (450)
T d2c1xa1         395 GLMSCFDQILSQEKGKKLRENLRALRETADRAVGPKGSSTENFITLVDLVSKPK  448 (450)
T ss_dssp             HHHHHHHHHHHSHHHHHHHHHHHHHHHHHHHHTSTTCHHHHHHHHHHHHHTSCC
T ss_pred             HHHHHHHHHhcCcHHHHHHHHHHHHHHHHHHhccCCCCHHHHHHHHHHHHhhhc
Confidence            9999999999999877544   4432       348899999999999998764
>d2pq6a1 c.87.1.10 (A:8-480) (Iso)flavonoid glycosyltransferase {Medicago truncatula [TaxId: 3880]} Back     information, alignment and structure
>d2vcha1 c.87.1.10 (A:6-476) Hydroquinone glucosyltransferase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2acva1 c.87.1.10 (A:3-463) Triterpene UDP-glucosyl transferase UGT71G1 {Medicago truncatula [TaxId: 3880]} Back     information, alignment and structure
>d1pn3a_ c.87.1.5 (A:) TDP-epi-vancosaminyltransferase GtfA {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d1rrva_ c.87.1.5 (A:) TDP-vancosaminyltransferase GftD {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d1iira_ c.87.1.5 (A:) UDP-glucosyltransferase GtfB {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d1f0ka_ c.87.1.2 (A:) Peptidoglycan biosynthesis glycosyltransferase MurG {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bisa1 c.87.1.8 (A:1-437) Glycogen synthase 1, GlgA {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d2iw1a1 c.87.1.8 (A:2-371) Lipopolysaccharide core biosynthesis protein RfaG {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1o6ca_ c.87.1.3 (A:) UDP-N-acetylglucosamine 2-epimerase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1rzua_ c.87.1.8 (A:) Glycogen synthase 1, GlgA {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1v4va_ c.87.1.3 (A:) UDP-N-acetylglucosamine 2-epimerase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1f6da_ c.87.1.3 (A:) UDP-N-acetylglucosamine 2-epimerase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2f9fa1 c.87.1.8 (A:2-167) First mannosyl transferase WbaZ {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2bfwa1 c.87.1.8 (A:218-413) Glycogen synthase 1, GlgA {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1j9ja_ c.106.1.1 (A:) SurE homolog TM1662 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ccwa_ c.23.6.1 (A:) Glutamate mutase, small subunit {Clostridium cochlearium [TaxId: 1494]} Back     information, alignment and structure
>d1gsaa1 c.30.1.3 (A:1-122) Prokaryotic glutathione synthetase, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pswa_ c.87.1.7 (A:) ADP-heptose LPS heptosyltransferase II {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1u7za_ c.72.3.1 (A:) Coenzyme A biosynthesis bifunctional protein CoaBC, phosphopantothenoylcysteine synthase domain (CoaB) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1l5xa_ c.106.1.1 (A:) SurE homolog PAE2908 (SurE-alpha) {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d7reqa2 c.23.6.1 (A:561-728) Methylmalonyl-CoA mutase alpha subunit, C-terminal domain {Propionibacterium freudenreichii, subsp. shermanii [TaxId: 1744]} Back     information, alignment and structure
>d1j6ua1 c.5.1.1 (A:0-88) UDP-N-acetylmuramate-alanine ligase MurC {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d3bula2 c.23.6.1 (A:741-896) Methionine synthase, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jaya_ c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1irxa2 c.26.1.1 (A:3-319) Class I lysyl-tRNA synthetase {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1uana_ c.134.1.1 (A:) Hypothetical protein TT1542 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1p3da1 c.5.1.1 (A:11-106) UDP-N-acetylmuramate-alanine ligase MurC {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure