Citrus Sinensis ID: 036586

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------57
MPEPRKRGRKPKPKTQTETESESETIMPGTTKNGTVASHSLPATTTTNDSRSTSPARRGRGRPKKMRKHADNSSNDNHNSANNTNSNVGHVASPERSRHGEGNDITILPPRWESVAVKAVPSMDAVVKVFCVHTEPNFSLPWQRKRQYSSSSSGFIVGGRRVLTNAHSVEHHTQVKVKKRGSDTKYLATVLSIGTECDIALLTVKDDEFWEGVSPVEFGDLPALQDAVTVVGYPIGGDTISVTSGVVSRMEILSYVHGSTELLGLQGKCVGIAFQSLKNDDVENIGYVIPTPVIIHFIQDYEKNGAYTGFPILGVEWQKMENPDLRISMGMRPGQKGVRIRRIEPTAPESHVLKPSDIILSFDGIDIANDGTVPFRHGERIGFSYLVSQKYTGDSAVVKVLRNSEVHEFNIKLSTHKRLIPAHINGRPPSYYIIAGFVFTAVTAPYLRSEYGKDYEFDAPVKLLDKLLHAMAQSVDEQIVVVSQVLVADINIGYEEIVNTQVLALNGKPVQNLKSLADMVESSEDEFLKFDLEYQQIVVLKSKTAKEATSDILATHCIPSAMSGDLKT
cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHcccccccEEEEEEEEEccccccccccccccccEEEEEEEcccEEEccccccccccEEEEEEcccccEEEEEEEEEcccccEEEEEEccccccccccccccccccccccEEEEEEcccccccEEEEEEEEEEEEcccccccccccccccccEEEEEEEEEcccccccEEEEEcHHHHHHHHHHHHHcccEEccEEEEEEEEEcccHHHHHHccccccccEEEEEEcccccHHccccccccEEEEEccEEEccccccccccccccccEEEEcccccccEEEEEEEEccEEEEEEEEEEcccccccccccccccccEEEccEEEEEccHHHHHHHHccccccccccHHHHHHHHHHHccccccEEEEEEEEccccccccccccccEEEEEccEEcccHHHHHHHHHHccccEEEEEEEccEEEEEEcHHHHHHHHHHHHHccccccccccccc
cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHccccccccccccHHHHHHHHHHccHHHcccEEEEEcccccccccccccccccccccEEEEcccEEEEcccEEccccEEEEEEcccccEEEEEEEEEcccccEEEEEEccHHHcccccccccccccccccEEEEEEcccccccEEEEEEEEEEccccccccccccEEcccccEEEEEEEEEcccccccEEEEEcHHHHHHHHHHHHHcccEccccEEEEEEEEcccHHHHHHccccccccEEEEEEEccccHHHHccccccEEEEEccEEcccccccccccccEEcHHHHHHccccccEEEEEEEEcccEEEEEEEEccccccccHHHccccccEEEEEEEEEccccHHHHHHHccccccccccHHHHHHHHHHccccccccEEEEEEEccccHHHccccccccEEEEEcccccccHHHHHHHHHHccccEEEEEEcccEEEEEEcHHHHHHHHHHHHHccccccccHHccc
mpeprkrgrkpkpktqtetesesetimpgttkngtvashslpattttndsrstsparrgrgrpkkmrkhadnssndnhnsanntnsnvghvaspersrhgegnditilpprwesvavkavpsMDAVVKVFCVhtepnfslpwqrkrqysssssgfivggrrvltnahsvehhTQVKvkkrgsdtKYLATVLSIGTECDialltvkddefwegvspvefgdlpalqdavtvvgypiggdtisVTSGVVSRMEILSYVHGstellglqgKCVGIAFQslknddvenigyviptpVIIHFIQDyekngaytgfpilgvewqkmenpdlrismgmrpgqkgvrirrieptapeshvlkpsdiilsfdgidiandgtvpfrhgerigFSYLVSQKYTGDSAVVKVLRNSevhefniklsthkrlipahingrppsyYIIAGFVFtavtapylrseygkdyefdaPVKLLDKLLHAMAQSVDEQIVVVSQVLVADINIGYEEIVNTQVlalngkpvqnLKSLADMVESSEDEFLKFDLEYQQIVVLKSKTAKEATSDILathcipsamsgdlkt
mpeprkrgrkpkpktqtetesesetimpgttkngtvashslpattttndsrstsparrgrgrpkkmrkhadnssndnhnsanntnsnvghvaspersrhgegnditilppRWESVAVKAVPSMDAVVKVFCVHTepnfslpwqrkrqySSSSSGFIVGGRRVLtnahsvehhtqvkvkkrgsdTKYLATVLSIGTECDIALLTVKDDEFWEGVSPVEFGDLPALQDAVTVVGYPIGGDTISVTSGVVSRMEILSYVHGSTELLGLQGKCVGIAFQSLKNDDVENIGYVIPTPVIIHFIQDYEKNGAYTGFPILGVEWQKMENPDLRISMGMRPGQKGVRIRrieptapeshvlkpsDIILSFDGIDIANDGTVPFRHGERIGFSYLVSQKYTGDSAVVKVLRNSEVHEfniklsthkrlipahiNGRPPSYYIIAGFVFTAVTAPYLRSEYGKDYEFDAPVKLLDKLLHAMAQSVDEQIVVVSQVLVADINIGYEEIVNTQVLALNGKPVQNLKSLADMVESSEDEFLKFDLEYQQIVVLKSktakeatsdilathcipsamsgdlkt
MpeprkrgrkpkpktqtetesesetIMPGTTKNGTVASHSLPATTTTNDSRSTSPArrgrgrpkkmrkhadnssndnhnsanntnsnVGHVASPERSRHGEGNDITILPPRWESVAVKAVPSMDAVVKVFCVHTEPNFSLPWQRKRQYSSSSSGFIVGGRRVLTNAHSVEHHTQVKVKKRGSDTKYLATVLSIGTECDIALLTVKDDEFWEGVSPVEFGDLPALQDAVTVVGYPIGGDTISVTSGVVSRMEILSYVHGSTELLGLQGKCVGIAFQSLKNDDVENIGYVIPTPVIIHFIQDYEKNGAYTGFPILGVEWQKMENPDLRISMGMRPGQKGVRIRRIEPTAPESHVLKPSDIILSFDGIDIANDGTVPFRHGERIGFSYLVSQKYTGDSAVVKVLRNSEVHEFNIKLSTHKRLIPAHINGRPPSYYIIAGFVFTAVTAPYLRSEYGKDYEFDAPVKLLDKLLHAMAQSVDEQIVVVSQVLVADINIGYEEIVNTQVLALNGKPVQNLKSLADMVESSEDEFLKFDLEYQQIVVLKSKTAKEATSDILATHCIPSAMSGDLKT
********************************************************************************************************ITILPPRWESVAVKAVPSMDAVVKVFCVHTEPNFSLPWQRKR******SGFIVGGRRVLTNAHSVEHHTQVKVKKRGSDTKYLATVLSIGTECDIALLTVKDDEFWEGVSPVEFGDLPALQDAVTVVGYPIGGDTISVTSGVVSRMEILSYVHGSTELLGLQGKCVGIAFQSLKNDDVENIGYVIPTPVIIHFIQDYEKNGAYTGFPILGVEWQKME******************************VLKPSDIILSFDGIDIANDGTVPFRHGERIGFSYLVSQKYTGDSAVVKVLRNSEVHEFNIKLSTHKRLIPAHINGRPPSYYIIAGFVFTAVTAPYLRSEYGKDYEFDAPVKLLDKLLHAMAQSVDEQIVVVSQVLVADINIGYEEIVNTQVLALNGKPVQNLKSLADMVE*SEDEFLKFDLEYQQIVVLKSKTAKEATSDILATHCI**********
*********************************************************************************************************************KAVPSMDAVVKVFCVHTE*********************VGGRRVLTNAHSVEHHTQVKVKKRGSDTKYLATVLSIGTECDIALLTVKDDEFWEGVSPVEFGDLPALQDAVTVVGYPIGGDTISVTSGVVSRMEILSYVHGSTELLGLQGKCVGIAFQSLKNDDVENIGYVIPTPVIIHFIQDYEKNGAYTGFPILGVEWQKMENPDLRISMGMRPGQKGVRIRRIEPTAPESHVLKPSDIILSFDGIDIANDGTVPFRHGERIGFSYLVSQKYTGDSAVVKVLRNSEVHEFNIKLS*****************YIIAGFVFTAVTAPYLRSEY*****FDAPVKLLD**************VVVSQVLVADINIGYEEIVNTQVLALNGKPVQNLKSLADMVESSEDEFLKFDLEYQQIVVLKSKTAKEATSDILATHCIPSA*S*****
**************************MPGTTKNGTVASHSLP***********************************HNSANNTNSNVGH**********EGNDITILPPRWESVAVKAVPSMDAVVKVFCVHTEPNFSLPW***********GFIVGGRRVLTNAHSVEHHTQVKVKKRGSDTKYLATVLSIGTECDIALLTVKDDEFWEGVSPVEFGDLPALQDAVTVVGYPIGGDTISVTSGVVSRMEILSYVHGSTELLGLQGKCVGIAFQSLKNDDVENIGYVIPTPVIIHFIQDYEKNGAYTGFPILGVEWQKMENPDLRISMGMRPGQKGVRIRRIEPTAPESHVLKPSDIILSFDGIDIANDGTVPFRHGERIGFSYLVSQKYTGDSAVVKVLRNSEVHEFNIKLSTHKRLIPAHINGRPPSYYIIAGFVFTAVTAPYLRSEYGKDYEFDAPVKLLDKLLHAMAQSVDEQIVVVSQVLVADINIGYEEIVNTQVLALNGKPVQNLKSLADMVESSEDEFLKFDLEYQQIVVLKSKTAKEATSDILATHCIPSAMSGDLKT
********************************************************************************************************ITILPPRWESVAVKAVPSMDAVVKVFCVHTEPNFSLPWQR*R***SSSSGFIVGGRRVLTNAHSVEHHTQVKVKKRGSDTKYLATVLSIGTECDIALLTVKDDEFWEGVSPVEFGDLPALQDAVTVVGYPIGGDTISVTSGVVSRMEILSYVHGSTELLGLQGKCVGIAFQSLKNDDVENIGYVIPTPVIIHFIQDYEKNGAYTGFPILGVEWQKMENPDLRISMGMRPGQKGVRIRRIEPTAPESHVLKPSDIILSFDGIDIANDGTVPFRHGERIGFSYLVSQKYTGDSAVVKVLRNSEVHEFNIKLSTHKRLIPAHINGRPPSYYIIAGFVFTAVTAPYLRSEYGKDYEFDAPVKLLDKLLHAMAQSVDEQIVVVSQVLVADINIGYEEIVNTQVLALNGKPVQNLKSLADMVESSEDEFLKFDLEYQQIVVLKSKTAKEATSDILATHCIP*********
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPEPRKRGRKPKPKTQTETESESETIMPGTTKNGTVASHSLPATTTTNDSRSTSPARRGRGRPKKMRKHADNSSNDNHNSANNTNSNVGHVASPERSRHGEGNDITILPPRWESVAVKAVPSMDAVVKVFCVHTEPNFSLPWQRKRQYSSSSSGFIVGGRRVLTNAHSVEHHTQVKVKKRGSDTKYLATVLSIGTECDIALLTVKDDEFWEGVSPVEFGDLPALQDAVTVVGYPIGGDTISVTSGVVSRMEILSYVHGSTELLGLQGKCVGIAFQSLKNDDVENIGYVIPTPVIIHFIQDYEKNGAYTGFPILGVEWQKMENPDLRISMGMRPGQKGVRIRRIEPTAPESHVLKPSDIILSFDGIDIANDGTVPFRHGERIGFSYLVSQKYTGDSAVVKVLRNSEVHEFNIKLSTHKRLIPAHINGRPPSYYIIAGFVFTAVTAPYLRSEYGKDYEFDAPVKLLDKLLHAMAQSVDEQIVVVSQVLVADINIGYEEIVNTQVLALNGKPVQNLKSLADMVESSEDEFLKFDLEYQQIVVLKSKTAKEATSDILATHCIPSAMSGDLKT
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query568 2.2.26 [Sep-21-2011]
Q9FL12592 Protease Do-like 9 OS=Ara yes no 0.971 0.932 0.703 0.0
O82261607 Protease Do-like 2, chlor no no 0.772 0.723 0.487 1e-130
Q9FIV6586 Protease Do-like 10, mito no no 0.859 0.832 0.442 1e-117
Q9SHZ1559 Putative protease Do-like no no 0.762 0.774 0.425 1e-100
Q9SHZ0518 Protease Do-like 4, mitoc no no 0.753 0.826 0.414 1e-97
Q9FM41486 Putative protease Do-like no no 0.751 0.878 0.395 4e-88
Q9LK71560 Putative protease Do-like no no 0.713 0.723 0.377 7e-80
Q9LK70499 Putative protease Do-like no no 0.728 0.829 0.369 5e-75
Q9C691219 Putative protease Do-like no no 0.241 0.625 0.485 6e-32
Q3E8B4198 Putative Do-like 15 prote no no 0.216 0.621 0.390 6e-19
>sp|Q9FL12|DEGP9_ARATH Protease Do-like 9 OS=Arabidopsis thaliana GN=DEGP9 PE=2 SV=1 Back     alignment and function desciption
 Score =  814 bits (2103), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 425/604 (70%), Positives = 472/604 (78%), Gaps = 52/604 (8%)

Query: 1   MPEPRKRGRKPKPKTQTETESESETIMPGTTKNGTVASHSLPATTTTNDSRSTSPARRGR 60
           M    KRGRK K +  +  E+       G  K  +    SLP        +S  P     
Sbjct: 1   MKNSEKRGRKHKRQDASSAENAG-----GEVKEASANEASLP--------QSPEPVSASE 47

Query: 61  GRPKKMRKHADNSSNDNHNSANNTNSNVGHVASPERSR---------HGEGNDITIL--- 108
             P   R+          N  N + +     +SPERSR         +G+ ++  I+   
Sbjct: 48  ANPSPSRRSRGRGKKRRLN--NESEAGNQRTSSPERSRSRLHHSDTKNGDCSNGMIVSTT 105

Query: 109 ------PPRWESVAVKAVPSMDAVVKVFCVHTEPNFSLPWQRKRQYSSSSSGFIVGGRRV 162
                  P WE+V VK VPSMDAVVKVFCVHTEPNFSLPWQRKRQYSS SSGFI+GGRRV
Sbjct: 106 TESIPAAPSWETV-VKVVPSMDAVVKVFCVHTEPNFSLPWQRKRQYSSGSSGFIIGGRRV 164

Query: 163 LTNAHSVEHHTQVKVKKRGSDTKYLATVLSIGTECDIALLTVKDDEFWEGVSPVEFGDLP 222
           LTNAHSVEHHTQVK+KKRGSDTKYLATVL+IGTECDIALLTV DDEFWEGVSPVEFGDLP
Sbjct: 165 LTNAHSVEHHTQVKLKKRGSDTKYLATVLAIGTECDIALLTVTDDEFWEGVSPVEFGDLP 224

Query: 223 ALQDAVTVVGYPIGGDTISVTSGVVSRMEILSYVHGSTELLGLQ---------------- 266
           ALQDAVTVVGYPIGGDTISVTSGVVSRMEILSYVHGSTELLGLQ                
Sbjct: 225 ALQDAVTVVGYPIGGDTISVTSGVVSRMEILSYVHGSTELLGLQIDAAINSGNSGGPAFN 284

Query: 267 --GKCVGIAFQSLKNDDVENIGYVIPTPVIIHFIQDYEKNGAYTGFPILGVEWQKMENPD 324
             GKCVGIAFQSLK++D ENIGYVIPTPVI+HFIQDYEK+  YTGFP+LG+EWQKMENPD
Sbjct: 285 DKGKCVGIAFQSLKHEDAENIGYVIPTPVIVHFIQDYEKHDKYTGFPVLGIEWQKMENPD 344

Query: 325 LRISMGMRPGQKGVRIRRIEPTAPESHVLKPSDIILSFDGIDIANDGTVPFRHGERIGFS 384
           LR SMGM   QKGVRIRRIEPTAPES VLKPSDIILSFDG++IANDGTVPFRHGERIGFS
Sbjct: 345 LRKSMGMESHQKGVRIRRIEPTAPESQVLKPSDIILSFDGVNIANDGTVPFRHGERIGFS 404

Query: 385 YLVSQKYTGDSAVVKVLRNSEVHEFNIKLSTHKRLIPAHINGRPPSYYIIAGFVFTAVTA 444
           YL+SQKYTGDSA+VKVLRN E+ EFNIKL+ HKRLIPAHI+G+PPSY+I+AGFVFT V+ 
Sbjct: 405 YLISQKYTGDSALVKVLRNKEILEFNIKLAIHKRLIPAHISGKPPSYFIVAGFVFTTVSV 464

Query: 445 PYLRSEYGKDYEFDAPVKLLDKLLHAMAQSVDEQIVVVSQVLVADINIGYEEIVNTQVLA 504
           PYLRSEYGK+YEFDAPVKLL+K LHAMAQSVDEQ+VVVSQVLV+DINIGYEEIVNTQV+A
Sbjct: 465 PYLRSEYGKEYEFDAPVKLLEKHLHAMAQSVDEQLVVVSQVLVSDINIGYEEIVNTQVVA 524

Query: 505 LNGKPVQNLKSLADMVESSEDEFLKFDLEYQQIVVLKSKTAKEATSDILATHCIPSAMSG 564
            NGKPV+NLK LA MVE+ EDE++KF+L+Y QIVVL +KTAKEAT DIL THCIPSAMS 
Sbjct: 525 FNGKPVKNLKGLAGMVENCEDEYMKFNLDYDQIVVLDTKTAKEATLDILTTHCIPSAMSD 584

Query: 565 DLKT 568
           DLKT
Sbjct: 585 DLKT 588
Probable serine protease.
Arabidopsis thaliana (taxid: 3702)
EC: 3EC: .EC: 4EC: .EC: 2EC: 1EC: .EC: -
>sp|O82261|DEGP2_ARATH Protease Do-like 2, chloroplastic OS=Arabidopsis thaliana GN=DEGP2 PE=1 SV=2 Back     alignment and function description
>sp|Q9FIV6|DGP10_ARATH Protease Do-like 10, mitochondrial OS=Arabidopsis thaliana GN=DEGP10 PE=2 SV=1 Back     alignment and function description
>sp|Q9SHZ1|DEGP3_ARATH Putative protease Do-like 3, mitochondrial OS=Arabidopsis thaliana GN=DEGP3 PE=3 SV=1 Back     alignment and function description
>sp|Q9SHZ0|DEGP4_ARATH Protease Do-like 4, mitochondrial OS=Arabidopsis thaliana GN=DEGP4 PE=2 SV=1 Back     alignment and function description
>sp|Q9FM41|DGP13_ARATH Putative protease Do-like 13 OS=Arabidopsis thaliana GN=DEGP13 PE=2 SV=1 Back     alignment and function description
>sp|Q9LK71|DGP11_ARATH Putative protease Do-like 11, mitochondrial OS=Arabidopsis thaliana GN=DEGP11 PE=2 SV=2 Back     alignment and function description
>sp|Q9LK70|DGP12_ARATH Putative protease Do-like 12, mitochondrial OS=Arabidopsis thaliana GN=DEGP12 PE=2 SV=1 Back     alignment and function description
>sp|Q9C691|DEGP6_ARATH Putative protease Do-like 6, chloroplastic OS=Arabidopsis thaliana GN=DEGP6 PE=3 SV=2 Back     alignment and function description
>sp|Q3E8B4|DGP15_ARATH Putative Do-like 15 protein OS=Arabidopsis thaliana GN=DEGP15 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query568
225452528579 PREDICTED: protease Do-like 9-like [Viti 0.975 0.956 0.758 0.0
147778871558 hypothetical protein VITISV_027750 [Viti 0.970 0.987 0.777 0.0
356495905544 PREDICTED: protease Do-like 9-like [Glyc 0.911 0.952 0.741 0.0
449469505586 PREDICTED: protease Do-like 9-like [Cucu 0.978 0.948 0.714 0.0
18421957592 protease Do-like 9 [Arabidopsis thaliana 0.971 0.932 0.703 0.0
297801572592 hypothetical protein ARALYDRAFT_493972 [ 0.970 0.930 0.701 0.0
357477329590 hypothetical protein MTR_4g106730 [Medic 0.978 0.942 0.688 0.0
225457105575 PREDICTED: protease Do-like 9-like [Viti 0.970 0.958 0.711 0.0
147770917576 hypothetical protein VITISV_013882 [Viti 0.957 0.944 0.703 0.0
296087700464 unnamed protein product [Vitis vinifera] 0.785 0.961 0.859 0.0
>gi|225452528|ref|XP_002275131.1| PREDICTED: protease Do-like 9-like [Vitis vinifera] Back     alignment and taxonomy information
 Score =  857 bits (2215), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 450/593 (75%), Positives = 495/593 (83%), Gaps = 39/593 (6%)

Query: 1   MPEP-RKRGRKPK-PKTQTETESESETIMPGTTKNGTVASHSLPATTTTNDSRSTSP-AR 57
           M EP RKRGRKPK PKT++  + +     P TT   T A++ + + +    +  + P AR
Sbjct: 1   MGEPKRKRGRKPKAPKTES-MDFQFTNPGPSTTATATAAANDVVSASAVELTEGSPPSAR 59

Query: 58  RGRGRPKKMRKHADNS----SNDNHNSANNTNSNVGHVASPERSRHGEGNDITILPPRWE 113
           RGRGRP+K+ KH + S    S+    S+N    +VG V  PE             PPRWE
Sbjct: 60  RGRGRPRKIGKHVEKSPERRSSRFVESSNGDARHVGAVVVPE------------APPRWE 107

Query: 114 SVAVKAVPSMDAVVKVFCVHTEPNFSLPWQRKRQYSSSSSGFIVGGRRVLTNAHSVEHHT 173
           SV V+ VPSMDAVVKVFCVHTEPNFSLPWQRKRQYSSSSSGFI+ GRRVLTNAHSVEHHT
Sbjct: 108 SV-VRVVPSMDAVVKVFCVHTEPNFSLPWQRKRQYSSSSSGFIIEGRRVLTNAHSVEHHT 166

Query: 174 QVKVKKRGSDTKYLATVLSIGTECDIALLTVKDDEFWEGVSPVEFGDLPALQDAVTVVGY 233
           QVK+KKRGSDTKYLATVL+IGTECDIALLTV DDEFW+GV PVEFGDLPALQDAVTVVGY
Sbjct: 167 QVKLKKRGSDTKYLATVLAIGTECDIALLTVNDDEFWDGVKPVEFGDLPALQDAVTVVGY 226

Query: 234 PIGGDTISVTSGVVSRMEILSYVHGSTELLGLQ------------------GKCVGIAFQ 275
           PIGGDTISVTSGVVSRMEILSYVHGSTELLGLQ                  GKCVGIAFQ
Sbjct: 227 PIGGDTISVTSGVVSRMEILSYVHGSTELLGLQIDAAINSGNSGGPAINDKGKCVGIAFQ 286

Query: 276 SLKNDDVENIGYVIPTPVIIHFIQDYEKNGAYTGFPILGVEWQKMENPDLRISMGMRPGQ 335
           SLK++DVENIGYVIPTPVI+HFI+DYEKNGAYTGFPILGVEWQKMENPDLR+SMGM P Q
Sbjct: 287 SLKHEDVENIGYVIPTPVIMHFIRDYEKNGAYTGFPILGVEWQKMENPDLRVSMGMGPDQ 346

Query: 336 KGVRIRRIEPTAPESHVLKPSDIILSFDGIDIANDGTVPFRHGERIGFSYLVSQKYTGDS 395
           KGVRIRRIEPTAPESHVLKPSD+ILSFDG++IANDGTVPFRHGERIGFSYLVSQKYTGD+
Sbjct: 347 KGVRIRRIEPTAPESHVLKPSDVILSFDGVNIANDGTVPFRHGERIGFSYLVSQKYTGDN 406

Query: 396 AVVKVLRNSEVHEFNIKLSTHKRLIPAHINGRPPSYYIIAGFVFTAVTAPYLRSEYGKDY 455
           AVVKVLRNS++ EF IKL+ HKRLI AHI GRPPSYYII GFVFTAV+ PYLRSEYGKDY
Sbjct: 407 AVVKVLRNSQILEFCIKLAIHKRLIAAHIKGRPPSYYIIGGFVFTAVSVPYLRSEYGKDY 466

Query: 456 EFDAPVKLLDKLLHAMAQSVDEQIVVVSQVLVADINIGYEEIVNTQVLALNGKPVQNLKS 515
           EFDAPVKLLDK L++MAQSVDEQ+VVV+QVLVADINIGYEEIVNTQVL+ NGKPV+NLKS
Sbjct: 467 EFDAPVKLLDKHLYSMAQSVDEQLVVVAQVLVADINIGYEEIVNTQVLSFNGKPVKNLKS 526

Query: 516 LADMVESSEDEFLKFDLEYQQIVVLKSKTAKEATSDILATHCIPSAMSGDLKT 568
           LA MVES +DEFLKF+LEYQQIVVL++KTAK AT DIL THCIPSAMS DLKT
Sbjct: 527 LATMVESCDDEFLKFELEYQQIVVLQTKTAKAATLDILTTHCIPSAMSDDLKT 579

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|147778871|emb|CAN62736.1| hypothetical protein VITISV_027750 [Vitis vinifera] Back     alignment and taxonomy information
>gi|356495905|ref|XP_003516811.1| PREDICTED: protease Do-like 9-like [Glycine max] Back     alignment and taxonomy information
>gi|449469505|ref|XP_004152460.1| PREDICTED: protease Do-like 9-like [Cucumis sativus] gi|449487776|ref|XP_004157795.1| PREDICTED: protease Do-like 9-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|18421957|ref|NP_568577.1| protease Do-like 9 [Arabidopsis thaliana] gi|75262638|sp|Q9FL12.1|DEGP9_ARATH RecName: Full=Protease Do-like 9 gi|10177507|dbj|BAB10901.1| serine protease-like protein [Arabidopsis thaliana] gi|15028147|gb|AAK76697.1| putative DegP protease [Arabidopsis thaliana] gi|23296815|gb|AAN13177.1| putative DegP protease [Arabidopsis thaliana] gi|332007136|gb|AED94519.1| protease Do-like 9 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297801572|ref|XP_002868670.1| hypothetical protein ARALYDRAFT_493972 [Arabidopsis lyrata subsp. lyrata] gi|297314506|gb|EFH44929.1| hypothetical protein ARALYDRAFT_493972 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|357477329|ref|XP_003608950.1| hypothetical protein MTR_4g106730 [Medicago truncatula] gi|355510005|gb|AES91147.1| hypothetical protein MTR_4g106730 [Medicago truncatula] Back     alignment and taxonomy information
>gi|225457105|ref|XP_002280249.1| PREDICTED: protease Do-like 9-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|147770917|emb|CAN74170.1| hypothetical protein VITISV_013882 [Vitis vinifera] Back     alignment and taxonomy information
>gi|296087700|emb|CBI34956.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query568
TAIR|locus:2173727592 DEG9 "degradation of periplasm 0.533 0.511 0.825 3.1e-214
TAIR|locus:2043403607 DEG2 "degradation of periplasm 0.521 0.487 0.451 2.8e-120
TAIR|locus:2167468586 DEG10 "degradation of periplas 0.795 0.771 0.468 1.6e-104
TAIR|locus:2018476559 DEG3 "degradation of periplasm 0.781 0.794 0.416 9.6e-89
DICTYBASE|DDB_G0281081647 DDB_G0281081 "Protease degS" [ 0.779 0.684 0.377 2.2e-80
TAIR|locus:2008286219 DEG6 "degradation of periplasm 0.294 0.762 0.432 1.8e-32
TAIR|locus:504954966198 DEG16 "degradation of periplas 0.125 0.358 0.5 1.3e-21
TIGR_CMR|SPO_1625478 SPO_1625 "periplasmic serine p 0.440 0.523 0.254 4.2e-10
UNIPROTKB|Q607Z8504 MCA1599 "Putative serine prote 0.424 0.478 0.279 2.5e-08
UNIPROTKB|Q74GB5464 degP "Periplasmic trypsin-like 0.441 0.540 0.264 3e-08
TAIR|locus:2173727 DEG9 "degradation of periplasmic proteins 9" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1326 (471.8 bits), Expect = 3.1e-214, Sum P(2) = 3.1e-214
 Identities = 250/303 (82%), Positives = 280/303 (92%)

Query:   266 QGKCVGIAFQSLKNDDVENIGYVIPTPVIIHFIQDYEKNGAYTGFPILGVEWQKMENPDL 325
             +GKCVGIAFQSLK++D ENIGYVIPTPVI+HFIQDYEK+  YTGFP+LG+EWQKMENPDL
Sbjct:   286 KGKCVGIAFQSLKHEDAENIGYVIPTPVIVHFIQDYEKHDKYTGFPVLGIEWQKMENPDL 345

Query:   326 RISMGMRPGQKGVRIRRIEPTAPESHVLKPSDIILSFDGIDIANDGTVPFRHGERIGFSY 385
             R SMGM   QKGVRIRRIEPTAPES VLKPSDIILSFDG++IANDGTVPFRHGERIGFSY
Sbjct:   346 RKSMGMESHQKGVRIRRIEPTAPESQVLKPSDIILSFDGVNIANDGTVPFRHGERIGFSY 405

Query:   386 LVSQKYTGDSAVVKVLRNSEVHEFNIKLSTHKRLIPAHINGRPPSYYIIAGFVFTAVTAP 445
             L+SQKYTGDSA+VKVLRN E+ EFNIKL+ HKRLIPAHI+G+PPSY+I+AGFVFT V+ P
Sbjct:   406 LISQKYTGDSALVKVLRNKEILEFNIKLAIHKRLIPAHISGKPPSYFIVAGFVFTTVSVP 465

Query:   446 YLRSEYGKDYEFDAPVKLLDKLLHAMAQSVDEQIVVVSQVLVADINIGYEEIVNTQVLAL 505
             YLRSEYGK+YEFDAPVKLL+K LHAMAQSVDEQ+VVVSQVLV+DINIGYEEIVNTQV+A 
Sbjct:   466 YLRSEYGKEYEFDAPVKLLEKHLHAMAQSVDEQLVVVSQVLVSDINIGYEEIVNTQVVAF 525

Query:   506 NGKPVQNLKSLADMVESSEDEFLKFDLEYQQIVVLKSKTAKEATSDILATHCIPSAMSGD 565
             NGKPV+NLK LA MVE+ EDE++KF+L+Y QIVVL +KTAKEAT DIL THCIPSAMS D
Sbjct:   526 NGKPVKNLKGLAGMVENCEDEYMKFNLDYDQIVVLDTKTAKEATLDILTTHCIPSAMSDD 585

Query:   566 LKT 568
             LKT
Sbjct:   586 LKT 588
GO:0003824 "catalytic activity" evidence=IEA
GO:0004252 "serine-type endopeptidase activity" evidence=IEA
GO:0005739 "mitochondrion" evidence=ISM
GO:0006508 "proteolysis" evidence=IEA;ISS
GO:0008236 "serine-type peptidase activity" evidence=ISS
GO:0009507 "chloroplast" evidence=IDA
GO:0005730 "nucleolus" evidence=IDA
GO:0006406 "mRNA export from nucleus" evidence=RCA
GO:0006606 "protein import into nucleus" evidence=RCA
TAIR|locus:2043403 DEG2 "degradation of periplasmic proteins 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2167468 DEG10 "degradation of periplasmic proteins 10" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2018476 DEG3 "degradation of periplasmic proteins 3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0281081 DDB_G0281081 "Protease degS" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
TAIR|locus:2008286 DEG6 "degradation of periplasmic proteins 6" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:504954966 DEG16 "degradation of periplasmic proteins 16" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TIGR_CMR|SPO_1625 SPO_1625 "periplasmic serine protease, DO/DeqQ family" [Ruegeria pomeroyi DSS-3 (taxid:246200)] Back     alignment and assigned GO terms
UNIPROTKB|Q607Z8 MCA1599 "Putative serine protease, MucD" [Methylococcus capsulatus str. Bath (taxid:243233)] Back     alignment and assigned GO terms
UNIPROTKB|Q74GB5 degP "Periplasmic trypsin-like serine protease DegP" [Geobacter sulfurreducens PCA (taxid:243231)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9FL12DEGP9_ARATH3, ., 4, ., 2, 1, ., -0.70360.97180.9324yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.4.21LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00020781001
SubName- Full=Chromosome chr14 scaffold_21, whole genome shotgun sequence; (576 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query568
TIGR02037428 TIGR02037, degP_htrA_DO, periplasmic serine protea 8e-18
COG0265347 COG0265, DegQ, Trypsin-like serine proteases, typi 5e-13
pfam00089218 pfam00089, Trypsin, Trypsin 8e-09
cd0098790 cd00987, PDZ_serine_protease, PDZ domain of tryspi 1e-08
pfam13365138 pfam13365, Trypsin_2, Trypsin-like peptidase domai 8e-07
PRK10942473 PRK10942, PRK10942, serine endoprotease; Provision 4e-04
pfam1318081 pfam13180, PDZ_2, PDZ domain 5e-04
>gnl|CDD|233695 TIGR02037, degP_htrA_DO, periplasmic serine protease, Do/DeqQ family Back     alignment and domain information 
 Score = 85.7 bits (213), Expect = 8e-18
 Identities = 73/303 (24%), Positives = 128/303 (42%), Gaps = 43/303 (14%)

Query: 136 PNFSLPWQRKRQYSSSSSGFIVG-GRRVLTNAHSVEHHTQVKVKKRGSD-TKYLATVLSI 193
           P+F    QR+++     SG I+     VLTN H V+   ++ V    SD  ++ A ++  
Sbjct: 45  PDFPRQ-QREQKVRGLGSGVIISADGYVLTNNHVVDGADEITVTL--SDGREFKAKLVGK 101

Query: 194 GTECDIALLTVKDDEFWEGVSPVEFGDLPALQ--DAVTVVGYPIGGDTISVTSGVVS--- 248
               DIA+L +   +    +  ++ GD   L+  D V  +G P G    +VTSG+VS   
Sbjct: 102 DPRTDIAVLKIDAKK---NLPVIKLGDSDKLRVGDWVLAIGNPFGLGQ-TVTSGIVSALG 157

Query: 249 --RMEILSYV----------HGST--ELLGLQGKCVGIAFQSL-KNDDVENIGYVIPTPV 293
              + I  Y            G++   L+ L+G+ +GI    L  +     IG+ IP+ +
Sbjct: 158 RSGLGIGDYENFIQTDAAINPGNSGGPLVNLRGEVIGINTAILSPSGGNVGIGFAIPSNM 217

Query: 294 IIHFIQDYEKNGAYTGFPILGVEWQKMENPDLRISMGMRPGQKGVRIRRIEPTAP-ESHV 352
             + +    + G       LGV  Q++   DL  S+G+   Q+G  + ++ P +P E   
Sbjct: 218 AKNVVDQLIEGGKVK-RGWLGVTIQEV-TSDLAKSLGL-EKQRGALVAQVLPGSPAEKAG 274

Query: 353 LKPSDIILSFDGIDIANDGTVPFRHGERIGFSYLVSQKYTGDSAVVKVLRNSEVHEFNIK 412
           LK  D+I S +G  I++   +             +     G    + +LR  +     + 
Sbjct: 275 LKAGDVITSVNGKPISSFADLRRA----------IGTLKPGKKVTLGILRKGKEKTITVT 324

Query: 413 LST 415
           L  
Sbjct: 325 LGA 327

This family consists of a set proteins various designated DegP, heat shock protein HtrA, and protease DO. The ortholog in Pseudomonas aeruginosa is designated MucD and is found in an operon that controls mucoid phenotype. This family also includes the DegQ (HhoA) paralog in E. coli which can rescue a DegP mutant, but not the smaller DegS paralog, which cannot. Members of this family are located in the periplasm and have separable functions as both protease and chaperone. Members have a trypsin domain and two copies of a PDZ domain. This protein protects bacteria from thermal and other stresses and may be important for the survival of bacterial pathogens.// The chaperone function is dominant at low temperatures, whereas the proteolytic activity is turned on at elevated temperatures [Protein fate, Protein folding and stabilization, Protein fate, Degradation of proteins, peptides, and glycopeptides]. Length = 428
>gnl|CDD|223343 COG0265, DegQ, Trypsin-like serine proteases, typically periplasmic, contain C-terminal PDZ domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|215708 pfam00089, Trypsin, Trypsin Back     alignment and domain information
>gnl|CDD|238487 cd00987, PDZ_serine_protease, PDZ domain of tryspin-like serine proteases, such as DegP/HtrA, which are oligomeric proteins involved in heat-shock response, chaperone function, and apoptosis Back     alignment and domain information
>gnl|CDD|222077 pfam13365, Trypsin_2, Trypsin-like peptidase domain Back     alignment and domain information
>gnl|CDD|236802 PRK10942, PRK10942, serine endoprotease; Provisional Back     alignment and domain information
>gnl|CDD|221961 pfam13180, PDZ_2, PDZ domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 568
PRK10139455 serine endoprotease; Provisional 100.0
TIGR02037428 degP_htrA_DO periplasmic serine protease, Do/DeqQ 100.0
PRK10942473 serine endoprotease; Provisional 100.0
TIGR02038351 protease_degS periplasmic serine pepetdase DegS. T 100.0
PRK10898353 serine endoprotease; Provisional 100.0
KOG1421 955 consensus Predicted signaling-associated protein ( 100.0
COG0265347 DegQ Trypsin-like serine proteases, typically peri 100.0
KOG1320473 consensus Serine protease [Posttranslational modif 100.0
KOG1421955 consensus Predicted signaling-associated protein ( 99.95
KOG1320473 consensus Serine protease [Posttranslational modif 99.89
PRK10779 449 zinc metallopeptidase RseP; Provisional 99.65
TIGR00054 420 RIP metalloprotease RseP. A model that detects fra 99.5
PF1318082 PDZ_2: PDZ domain; PDB: 2L97_A 1Y8T_A 2Z9I_A 1LCY_ 99.45
PF13365120 Trypsin_2: Trypsin-like peptidase domain; PDB: 1Y8 99.29
cd0098790 PDZ_serine_protease PDZ domain of tryspin-like ser 99.28
cd0098679 PDZ_LON_protease PDZ domain of ATP-dependent LON s 99.1
cd0099179 PDZ_archaeal_metalloprotease PDZ domain of archaea 99.07
cd0099080 PDZ_glycyl_aminopeptidase PDZ domain associated wi 99.06
TIGR01713259 typeII_sec_gspC general secretion pathway protein 99.0
TIGR02037428 degP_htrA_DO periplasmic serine protease, Do/DeqQ 98.88
cd0098979 PDZ_metalloprotease PDZ domain of bacterial and pl 98.85
PF1281278 PDZ_1: PDZ-like domain 98.82
cd0098885 PDZ_CTP_protease PDZ domain of C-terminal processi 98.82
cd0013670 PDZ PDZ domain, also called DHR (Dlg homologous re 98.57
cd0098790 PDZ_serine_protease PDZ domain of tryspin-like ser 98.56
PF00089220 Trypsin: Trypsin; InterPro: IPR001254 In the MEROP 98.55
PF1318082 PDZ_2: PDZ domain; PDB: 2L97_A 1Y8T_A 2Z9I_A 1LCY_ 98.54
smart0022885 PDZ Domain present in PSD-95, Dlg, and ZO-1/2. Als 98.4
cd0099179 PDZ_archaeal_metalloprotease PDZ domain of archaea 98.38
KOG3580 1027 consensus Tight junction proteins [Signal transduc 98.28
TIGR00054420 RIP metalloprotease RseP. A model that detects fra 98.28
cd0098979 PDZ_metalloprotease PDZ domain of bacterial and pl 98.28
TIGR00225334 prc C-terminal peptidase (prc). A C-terminal pepti 98.25
PRK10779449 zinc metallopeptidase RseP; Provisional 98.21
cd0098679 PDZ_LON_protease PDZ domain of ATP-dependent LON s 98.2
PRK10139455 serine endoprotease; Provisional 98.17
cd00190232 Tryp_SPc Trypsin-like serine protease; Many of the 98.15
PF0059581 PDZ: PDZ domain (Also known as DHR or GLGF) Coordi 98.11
PLN00049389 carboxyl-terminal processing protease; Provisional 98.11
PF1468588 Tricorn_PDZ: Tricorn protease PDZ domain; PDB: 1N6 98.1
TIGR02860402 spore_IV_B stage IV sporulation protein B. SpoIVB, 98.07
TIGR02038351 protease_degS periplasmic serine pepetdase DegS. T 98.07
KOG3209 984 consensus WW domain-containing protein [General fu 98.06
TIGR03279 433 cyano_FeS_chp putative FeS-containing Cyanobacteri 98.06
PRK10942473 serine endoprotease; Provisional 98.0
smart00020229 Tryp_SPc Trypsin-like serine protease. Many of the 97.97
cd0099282 PDZ_signaling PDZ domain found in a variety of Eum 97.97
cd0098885 PDZ_CTP_protease PDZ domain of C-terminal processi 97.96
COG0793406 Prc Periplasmic protease [Cell envelope biogenesis 97.93
PRK10898353 serine endoprotease; Provisional 97.92
COG3591251 V8-like Glu-specific endopeptidase [Amino acid tra 97.8
cd0013670 PDZ PDZ domain, also called DHR (Dlg homologous re 97.8
KOG3209984 consensus WW domain-containing protein [General fu 97.76
cd0099080 PDZ_glycyl_aminopeptidase PDZ domain associated wi 97.71
TIGR01713259 typeII_sec_gspC general secretion pathway protein 97.66
PRK09681276 putative type II secretion protein GspC; Provision 97.64
COG3480342 SdrC Predicted secreted protein containing a PDZ d 97.64
KOG3580 1027 consensus Tight junction proteins [Signal transduc 97.47
PRK11186 667 carboxy-terminal protease; Provisional 97.46
KOG3129231 consensus 26S proteasome regulatory complex, subun 97.36
cd0099282 PDZ_signaling PDZ domain found in a variety of Eum 97.32
COG3975558 Predicted protease with the C-terminal PDZ domain 97.31
PF0059581 PDZ: PDZ domain (Also known as DHR or GLGF) Coordi 97.28
PF04495138 GRASP55_65: GRASP55/65 PDZ-like domain ; InterPro: 97.25
PF1281278 PDZ_1: PDZ-like domain 97.25
PF00863235 Peptidase_C4: Peptidase family C4 This family belo 97.24
TIGR02860 402 spore_IV_B stage IV sporulation protein B. SpoIVB, 97.14
KOG3605829 consensus Beta amyloid precursor-binding protein [ 97.11
COG3031275 PulC Type II secretory pathway, component PulC [In 97.09
smart0022885 PDZ Domain present in PSD-95, Dlg, and ZO-1/2. Als 96.92
TIGR00225 334 prc C-terminal peptidase (prc). A C-terminal pepti 96.8
PLN00049 389 carboxyl-terminal processing protease; Provisional 96.74
KOG3834 462 consensus Golgi reassembly stacking protein GRASP6 96.31
TIGR03279 433 cyano_FeS_chp putative FeS-containing Cyanobacteri 96.25
KOG3553124 consensus Tax interaction protein TIP1 [Cell wall/ 96.16
PF05579297 Peptidase_S32: Equine arteritis virus serine endop 96.15
COG0265347 DegQ Trypsin-like serine proteases, typically peri 95.71
PF1468588 Tricorn_PDZ: Tricorn protease PDZ domain; PDB: 1N6 95.57
PRK09681276 putative type II secretion protein GspC; Provision 95.4
KOG3550207 consensus Receptor targeting protein Lin-7 [Extrac 94.75
COG3480 342 SdrC Predicted secreted protein containing a PDZ d 94.4
COG0793 406 Prc Periplasmic protease [Cell envelope biogenesis 93.72
KOG3552 1298 consensus FERM domain protein FRM-8 [General funct 93.1
PRK11186 667 carboxy-terminal protease; Provisional 92.35
KOG3532 1051 consensus Predicted protein kinase [General functi 92.26
PF04495138 GRASP55_65: GRASP55/65 PDZ-like domain ; InterPro: 92.17
KOG3542 1283 consensus cAMP-regulated guanine nucleotide exchan 92.12
PF00548172 Peptidase_C3: 3C cysteine protease (picornain 3C); 90.2
KOG3605829 consensus Beta amyloid precursor-binding protein [ 89.34
KOG3553124 consensus Tax interaction protein TIP1 [Cell wall/ 89.28
KOG3571 626 consensus Dishevelled 3 and related proteins [Gene 88.77
KOG2921484 consensus Intramembrane metalloprotease (sterol-re 88.76
KOG3552 1298 consensus FERM domain protein FRM-8 [General funct 88.33
KOG1892 1629 consensus Actin filament-binding protein Afadin [C 87.97
KOG3651 429 consensus Protein kinase C, alpha binding protein 86.55
PF02122203 Peptidase_S39: Peptidase S39; InterPro: IPR000382 86.53
KOG3606358 consensus Cell polarity protein PAR6 [Signal trans 84.82
COG3031275 PulC Type II secretory pathway, component PulC [In 84.59
KOG3129231 consensus 26S proteasome regulatory complex, subun 84.45
COG3975558 Predicted protease with the C-terminal PDZ domain 84.29
KOG3532 1051 consensus Predicted protein kinase [General functi 83.73
COG0750375 Predicted membrane-associated Zn-dependent proteas 83.51
PF08192695 Peptidase_S64: Peptidase family S64; InterPro: IPR 82.25
KOG3549 505 consensus Syntrophins (type gamma) [Extracellular 81.69
PF03510105 Peptidase_C24: 2C endopeptidase (C24) cysteine pro 80.26
>PRK10139 serine endoprotease; Provisional Back     alignment and domain information 
Probab=100.00  E-value=1.8e-55  Score=476.34  Aligned_cols=376  Identities=20%  Similarity=0.330  Sum_probs=308.2

Q ss_pred             CcHHHHHHHhCCCCCceEEEEeEeecCC-----------C--CCcccccCCCcceEEEEEEe--CCEEEEcccccCCCCe
Q 036586          110 PRWESVAVKAVPSMDAVVKVFCVHTEPN-----------F--SLPWQRKRQYSSSSSGFIVG--GRRVLTNAHSVEHHTQ  174 (568)
Q Consensus       110 ~~~~~~~~~v~p~~~sVV~I~~~~~~~~-----------~--~~p~~~~~~~~~~GSGfiI~--~G~ILTn~HVV~~~~~  174 (568)
                      .+|+++++++.|   |||.|.+......           +  ..||...+...+.||||||+  +||||||+|||.++..
T Consensus        40 ~~~~~~~~~~~p---avV~i~~~~~~~~~~~~~~~~~~~f~~~~~~~~~~~~~~~GSG~ii~~~~g~IlTn~HVv~~a~~  116 (455)
T PRK10139         40 PSLAPMLEKVLP---AVVSVRVEGTASQGQKIPEEFKKFFGDDLPDQPAQPFEGLGSGVIIDAAKGYVLTNNHVINQAQK  116 (455)
T ss_pred             ccHHHHHHHhCC---cEEEEEEEEeecccccCchhHHHhccccCCccccccccceEEEEEEECCCCEEEeChHHhCCCCE
Confidence            369999999999   9999988654210           0  01333333456789999997  6999999999999999


Q ss_pred             EEEEEcCCCcEEEEEEEEEeCCCCeEEEEeccCccccCccceecCCCc--ccCCeEEEEecCCCCCCceEEEEEEeeeec
Q 036586          175 VKVKKRGSDTKYLATVLSIGTECDIALLTVKDDEFWEGVSPVEFGDLP--ALQDAVTVVGYPIGGDTISVTSGVVSRMEI  252 (568)
Q Consensus       175 i~V~~~~dg~~~~a~vv~~d~~~DlAlLkv~~~~~~~~l~~~~l~~~~--~~g~~V~aiG~P~g~~~~svt~GiIs~~~~  252 (568)
                      +.|++ .|+++++|++++.|+.+||||||++...   .+++++|+++.  ++|++|++||||+|+.. +++.|+||++.+
T Consensus       117 i~V~~-~dg~~~~a~vvg~D~~~DlAvlkv~~~~---~l~~~~lg~s~~~~~G~~V~aiG~P~g~~~-tvt~GivS~~~r  191 (455)
T PRK10139        117 ISIQL-NDGREFDAKLIGSDDQSDIALLQIQNPS---KLTQIAIADSDKLRVGDFAVAVGNPFGLGQ-TATSGIISALGR  191 (455)
T ss_pred             EEEEE-CCCCEEEEEEEEEcCCCCEEEEEecCCC---CCceeEecCccccCCCCEEEEEecCCCCCC-ceEEEEEccccc
Confidence            99999 6999999999999999999999998643   78999999876  56899999999999876 899999998765


Q ss_pred             cc---------------ccCC--CceeecccceEEEEEeeeecCC-CCccccccccchhhhHhHHHhhhcCccccCceee
Q 036586          253 LS---------------YVHG--STELLGLQGKCVGIAFQSLKND-DVENIGYVIPTPVIIHFIQDYEKNGAYTGFPILG  314 (568)
Q Consensus       253 ~~---------------~~~g--gspL~n~~G~VVGI~~~~~~~~-~~~~~~~aIP~~~i~~~l~~l~~~g~~~~~~~lG  314 (568)
                      ..               .++|  ||||+|.+|+||||+++.+..+ +..+++||||++.+++++++|+++|++. |+|||
T Consensus       192 ~~~~~~~~~~~iqtda~in~GnSGGpl~n~~G~vIGi~~~~~~~~~~~~gigfaIP~~~~~~v~~~l~~~g~v~-r~~LG  270 (455)
T PRK10139        192 SGLNLEGLENFIQTDASINRGNSGGALLNLNGELIGINTAILAPGGGSVGIGFAIPSNMARTLAQQLIDFGEIK-RGLLG  270 (455)
T ss_pred             cccCCCCcceEEEECCccCCCCCcceEECCCCeEEEEEEEEEcCCCCccceEEEEEhHHHHHHHHHHhhcCccc-cccee
Confidence            31               1134  4599999999999999987654 4578999999999999999999999999 99999


Q ss_pred             EEEEEcCCHHHHHhcCCCCCCCceEEEEecCCCcccC-CCCCCCEEEEECCEEcCCCCCCccccCccchHHHHHhccCCC
Q 036586          315 VEWQKMENPDLRISMGMRPGQKGVRIRRIEPTAPESH-VLKPSDIILSFDGIDIANDGTVPFRHGERIGFSYLVSQKYTG  393 (568)
Q Consensus       315 i~~~~~~~~~~~~~lgl~~~~~Gv~V~~V~p~spA~~-GL~~GDiIl~InG~~V~~~~dl~~~~~~~~~l~~~l~~~~~g  393 (568)
                      +.++.+ ++++++.+|++. ..|++|..|.++|||++ ||++||+|++|||++|.+|.+          |...+.....|
T Consensus       271 v~~~~l-~~~~~~~lgl~~-~~Gv~V~~V~~~SpA~~AGL~~GDvIl~InG~~V~s~~d----------l~~~l~~~~~g  338 (455)
T PRK10139        271 IKGTEM-SADIAKAFNLDV-QRGAFVSEVLPNSGSAKAGVKAGDIITSLNGKPLNSFAE----------LRSRIATTEPG  338 (455)
T ss_pred             EEEEEC-CHHHHHhcCCCC-CCceEEEEECCCChHHHCCCCCCCEEEEECCEECCCHHH----------HHHHHHhcCCC
Confidence            999999 999999999985 67999999999999999 999999999999999999998          56777776789


Q ss_pred             CEEEEEEEECCEEEEEEEEeccCCCccccccCCCCCCceeeecEEEeeCChHHHHHHhCCCCccCchhhhHHHHHhhhhc
Q 036586          394 DSAVVKVLRNSEVHEFNIKLSTHKRLIPAHINGRPPSYYIIAGFVFTAVTAPYLRSEYGKDYEFDAPVKLLDKLLHAMAQ  473 (568)
Q Consensus       394 ~~v~l~V~R~g~~~~v~v~l~~~~~~~~~~~~~~~~~~~~~~Gl~~~~~~~~~v~~~~~~~~~~~~p~~~~~~~~~~~~~  473 (568)
                      +++.++|.|+|+.+++++++...+....... ...+   .+.|+.+.+.   .+.                         
T Consensus       339 ~~v~l~V~R~G~~~~l~v~~~~~~~~~~~~~-~~~~---~~~g~~l~~~---~~~-------------------------  386 (455)
T PRK10139        339 TKVKLGLLRNGKPLEVEVTLDTSTSSSASAE-MITP---ALQGATLSDG---QLK-------------------------  386 (455)
T ss_pred             CEEEEEEEECCEEEEEEEEECCCCCcccccc-cccc---cccccEeccc---ccc-------------------------
Confidence            9999999999999999998864432111100 0000   1234443331   000                         


Q ss_pred             cCCcceEEEEEEeccccccccccccCcEEEeeCCEecCCHHHHHHHHHccCCCeEEEEEEcCeEEEE
Q 036586          474 SVDEQIVVVSQVLVADINIGYEEIVNTQVLALNGKPVQNLKSLADMVESSEDEFLKFDLEYQQIVVL  540 (568)
Q Consensus       474 ~~~~~gvvvs~V~~~~~~~g~~~~~gd~I~~VNg~pV~~l~~f~~~l~~~~~~~v~l~v~R~~~~~l  540 (568)
                       ....+++|..|.+++++..++++.||+|++|||++|.+|++|.+++++.+ +.+.|.+.|+++.++
T Consensus       387 -~~~~Gv~V~~V~~~spA~~aGL~~GD~I~~Ing~~v~~~~~~~~~l~~~~-~~v~l~v~R~g~~~~  451 (455)
T PRK10139        387 -DGTKGIKIDEVVKGSPAAQAGLQKDDVIIGVNRDRVNSIAEMRKVLAAKP-AIIALQIVRGNESIY  451 (455)
T ss_pred             -cCCCceEEEEeCCCChHHHcCCCCCCEEEEECCEEcCCHHHHHHHHHhCC-CeEEEEEEECCEEEE
Confidence             11246899999999888888888999999999999999999999999865 789999999987543

>TIGR02037 degP_htrA_DO periplasmic serine protease, Do/DeqQ family Back     alignment and domain information
>PRK10942 serine endoprotease; Provisional Back     alignment and domain information
>TIGR02038 protease_degS periplasmic serine pepetdase DegS Back     alignment and domain information
>PRK10898 serine endoprotease; Provisional Back     alignment and domain information
>KOG1421 consensus Predicted signaling-associated protein (contains a PDZ domain) [General function prediction only] Back     alignment and domain information
>COG0265 DegQ Trypsin-like serine proteases, typically periplasmic, contain C-terminal PDZ domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1320 consensus Serine protease [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1421 consensus Predicted signaling-associated protein (contains a PDZ domain) [General function prediction only] Back     alignment and domain information
>KOG1320 consensus Serine protease [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10779 zinc metallopeptidase RseP; Provisional Back     alignment and domain information
>TIGR00054 RIP metalloprotease RseP Back     alignment and domain information
>PF13180 PDZ_2: PDZ domain; PDB: 2L97_A 1Y8T_A 2Z9I_A 1LCY_A 2PZD_B 2P3W_A 1VCW_C 1TE0_B 1SOZ_C 1SOT_C Back     alignment and domain information
>PF13365 Trypsin_2: Trypsin-like peptidase domain; PDB: 1Y8T_A 2Z9I_A 3QO6_A 1L1J_A 1QY6_A 2O8L_A 3OTP_E 2ZLE_I 1KY9_A 3CS0_A Back     alignment and domain information
>cd00987 PDZ_serine_protease PDZ domain of tryspin-like serine proteases, such as DegP/HtrA, which are oligomeric proteins involved in heat-shock response, chaperone function, and apoptosis Back     alignment and domain information
>cd00986 PDZ_LON_protease PDZ domain of ATP-dependent LON serine proteases Back     alignment and domain information
>cd00991 PDZ_archaeal_metalloprotease PDZ domain of archaeal zinc metalloprotases, presumably membrane-associated or integral membrane proteases, which may be involved in signalling and regulatory mechanisms Back     alignment and domain information
>cd00990 PDZ_glycyl_aminopeptidase PDZ domain associated with archaeal and bacterial M61 glycyl-aminopeptidases Back     alignment and domain information
>TIGR01713 typeII_sec_gspC general secretion pathway protein C Back     alignment and domain information
>TIGR02037 degP_htrA_DO periplasmic serine protease, Do/DeqQ family Back     alignment and domain information
>cd00989 PDZ_metalloprotease PDZ domain of bacterial and plant zinc metalloprotases, presumably membrane-associated or integral membrane proteases, which may be involved in signalling and regulatory mechanisms Back     alignment and domain information
>PF12812 PDZ_1: PDZ-like domain Back     alignment and domain information
>cd00988 PDZ_CTP_protease PDZ domain of C-terminal processing-, tail-specific-, and tricorn proteases, which function in posttranslational protein processing, maturation, and disassembly or degradation, in Bacteria, Archaea, and plant chloroplasts Back     alignment and domain information
>cd00136 PDZ PDZ domain, also called DHR (Dlg homologous region) or GLGF (after a conserved sequence motif) Back     alignment and domain information
>cd00987 PDZ_serine_protease PDZ domain of tryspin-like serine proteases, such as DegP/HtrA, which are oligomeric proteins involved in heat-shock response, chaperone function, and apoptosis Back     alignment and domain information
>PF00089 Trypsin: Trypsin; InterPro: IPR001254 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF13180 PDZ_2: PDZ domain; PDB: 2L97_A 1Y8T_A 2Z9I_A 1LCY_A 2PZD_B 2P3W_A 1VCW_C 1TE0_B 1SOZ_C 1SOT_C Back     alignment and domain information
>smart00228 PDZ Domain present in PSD-95, Dlg, and ZO-1/2 Back     alignment and domain information
>cd00991 PDZ_archaeal_metalloprotease PDZ domain of archaeal zinc metalloprotases, presumably membrane-associated or integral membrane proteases, which may be involved in signalling and regulatory mechanisms Back     alignment and domain information
>KOG3580 consensus Tight junction proteins [Signal transduction mechanisms] Back     alignment and domain information
>TIGR00054 RIP metalloprotease RseP Back     alignment and domain information
>cd00989 PDZ_metalloprotease PDZ domain of bacterial and plant zinc metalloprotases, presumably membrane-associated or integral membrane proteases, which may be involved in signalling and regulatory mechanisms Back     alignment and domain information
>TIGR00225 prc C-terminal peptidase (prc) Back     alignment and domain information
>PRK10779 zinc metallopeptidase RseP; Provisional Back     alignment and domain information
>cd00986 PDZ_LON_protease PDZ domain of ATP-dependent LON serine proteases Back     alignment and domain information
>PRK10139 serine endoprotease; Provisional Back     alignment and domain information
>cd00190 Tryp_SPc Trypsin-like serine protease; Many of these are synthesized as inactive precursor zymogens that are cleaved during limited proteolysis to generate their active forms Back     alignment and domain information
>PF00595 PDZ: PDZ domain (Also known as DHR or GLGF) Coordinates are not yet available; InterPro: IPR001478 PDZ domains are found in diverse signalling proteins in bacteria, yeasts, plants, insects and vertebrates [, ] Back     alignment and domain information
>PLN00049 carboxyl-terminal processing protease; Provisional Back     alignment and domain information
>PF14685 Tricorn_PDZ: Tricorn protease PDZ domain; PDB: 1N6F_D 1N6D_C 1N6E_C 1K32_A Back     alignment and domain information
>TIGR02860 spore_IV_B stage IV sporulation protein B Back     alignment and domain information
>TIGR02038 protease_degS periplasmic serine pepetdase DegS Back     alignment and domain information
>KOG3209 consensus WW domain-containing protein [General function prediction only] Back     alignment and domain information
>TIGR03279 cyano_FeS_chp putative FeS-containing Cyanobacterial-specific oxidoreductase Back     alignment and domain information
>PRK10942 serine endoprotease; Provisional Back     alignment and domain information
>smart00020 Tryp_SPc Trypsin-like serine protease Back     alignment and domain information
>cd00992 PDZ_signaling PDZ domain found in a variety of Eumetazoan signaling molecules, often in tandem arrangements Back     alignment and domain information
>cd00988 PDZ_CTP_protease PDZ domain of C-terminal processing-, tail-specific-, and tricorn proteases, which function in posttranslational protein processing, maturation, and disassembly or degradation, in Bacteria, Archaea, and plant chloroplasts Back     alignment and domain information
>COG0793 Prc Periplasmic protease [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK10898 serine endoprotease; Provisional Back     alignment and domain information
>COG3591 V8-like Glu-specific endopeptidase [Amino acid transport and metabolism] Back     alignment and domain information
>cd00136 PDZ PDZ domain, also called DHR (Dlg homologous region) or GLGF (after a conserved sequence motif) Back     alignment and domain information
>KOG3209 consensus WW domain-containing protein [General function prediction only] Back     alignment and domain information
>cd00990 PDZ_glycyl_aminopeptidase PDZ domain associated with archaeal and bacterial M61 glycyl-aminopeptidases Back     alignment and domain information
>TIGR01713 typeII_sec_gspC general secretion pathway protein C Back     alignment and domain information
>PRK09681 putative type II secretion protein GspC; Provisional Back     alignment and domain information
>COG3480 SdrC Predicted secreted protein containing a PDZ domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG3580 consensus Tight junction proteins [Signal transduction mechanisms] Back     alignment and domain information
>PRK11186 carboxy-terminal protease; Provisional Back     alignment and domain information
>KOG3129 consensus 26S proteasome regulatory complex, subunit PSMD9 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd00992 PDZ_signaling PDZ domain found in a variety of Eumetazoan signaling molecules, often in tandem arrangements Back     alignment and domain information
>COG3975 Predicted protease with the C-terminal PDZ domain [General function prediction only] Back     alignment and domain information
>PF00595 PDZ: PDZ domain (Also known as DHR or GLGF) Coordinates are not yet available; InterPro: IPR001478 PDZ domains are found in diverse signalling proteins in bacteria, yeasts, plants, insects and vertebrates [, ] Back     alignment and domain information
>PF04495 GRASP55_65: GRASP55/65 PDZ-like domain ; InterPro: IPR007583 GRASP55 (Golgi reassembly stacking protein of 55 kDa) and GRASP65 (a 65 kDa) protein are highly homologous Back     alignment and domain information
>PF12812 PDZ_1: PDZ-like domain Back     alignment and domain information
>PF00863 Peptidase_C4: Peptidase family C4 This family belongs to family C4 of the peptidase classification Back     alignment and domain information
>TIGR02860 spore_IV_B stage IV sporulation protein B Back     alignment and domain information
>KOG3605 consensus Beta amyloid precursor-binding protein [General function prediction only] Back     alignment and domain information
>COG3031 PulC Type II secretory pathway, component PulC [Intracellular trafficking and secretion] Back     alignment and domain information
>smart00228 PDZ Domain present in PSD-95, Dlg, and ZO-1/2 Back     alignment and domain information
>TIGR00225 prc C-terminal peptidase (prc) Back     alignment and domain information
>PLN00049 carboxyl-terminal processing protease; Provisional Back     alignment and domain information
>KOG3834 consensus Golgi reassembly stacking protein GRASP65, contains PDZ domain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>TIGR03279 cyano_FeS_chp putative FeS-containing Cyanobacterial-specific oxidoreductase Back     alignment and domain information
>KOG3553 consensus Tax interaction protein TIP1 [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>PF05579 Peptidase_S32: Equine arteritis virus serine endopeptidase S32; InterPro: IPR008760 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>COG0265 DegQ Trypsin-like serine proteases, typically periplasmic, contain C-terminal PDZ domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14685 Tricorn_PDZ: Tricorn protease PDZ domain; PDB: 1N6F_D 1N6D_C 1N6E_C 1K32_A Back     alignment and domain information
>PRK09681 putative type II secretion protein GspC; Provisional Back     alignment and domain information
>KOG3550 consensus Receptor targeting protein Lin-7 [Extracellular structures] Back     alignment and domain information
>COG3480 SdrC Predicted secreted protein containing a PDZ domain [Signal transduction mechanisms] Back     alignment and domain information
>COG0793 Prc Periplasmic protease [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>KOG3552 consensus FERM domain protein FRM-8 [General function prediction only] Back     alignment and domain information
>PRK11186 carboxy-terminal protease; Provisional Back     alignment and domain information
>KOG3532 consensus Predicted protein kinase [General function prediction only] Back     alignment and domain information
>PF04495 GRASP55_65: GRASP55/65 PDZ-like domain ; InterPro: IPR007583 GRASP55 (Golgi reassembly stacking protein of 55 kDa) and GRASP65 (a 65 kDa) protein are highly homologous Back     alignment and domain information
>KOG3542 consensus cAMP-regulated guanine nucleotide exchange factor [Signal transduction mechanisms] Back     alignment and domain information
>PF00548 Peptidase_C3: 3C cysteine protease (picornain 3C); InterPro: IPR000199 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>KOG3605 consensus Beta amyloid precursor-binding protein [General function prediction only] Back     alignment and domain information
>KOG3553 consensus Tax interaction protein TIP1 [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>KOG3571 consensus Dishevelled 3 and related proteins [General function prediction only] Back     alignment and domain information
>KOG2921 consensus Intramembrane metalloprotease (sterol-regulatory element-binding protein (SREBP) protease) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3552 consensus FERM domain protein FRM-8 [General function prediction only] Back     alignment and domain information
>KOG1892 consensus Actin filament-binding protein Afadin [Cytoskeleton] Back     alignment and domain information
>KOG3651 consensus Protein kinase C, alpha binding protein [Signal transduction mechanisms] Back     alignment and domain information
>PF02122 Peptidase_S39: Peptidase S39; InterPro: IPR000382 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>KOG3606 consensus Cell polarity protein PAR6 [Signal transduction mechanisms] Back     alignment and domain information
>COG3031 PulC Type II secretory pathway, component PulC [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG3129 consensus 26S proteasome regulatory complex, subunit PSMD9 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG3975 Predicted protease with the C-terminal PDZ domain [General function prediction only] Back     alignment and domain information
>KOG3532 consensus Predicted protein kinase [General function prediction only] Back     alignment and domain information
>COG0750 Predicted membrane-associated Zn-dependent proteases 1 [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PF08192 Peptidase_S64: Peptidase family S64; InterPro: IPR012985 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>KOG3549 consensus Syntrophins (type gamma) [Extracellular structures] Back     alignment and domain information
>PF03510 Peptidase_C24: 2C endopeptidase (C24) cysteine protease family; InterPro: IPR000317 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query568
4fln_A539 Crystal Structure Of Plant Protease Deg2 Length = 5 1e-131
3num_A332 Substrate Induced Remodeling Of The Active Site Reg 2e-06
3nzi_A334 Substrate Induced Remodeling Of The Active Site Reg 3e-06
3tjo_A231 Htra1 Catalytic Domain, Mutationally Inactivated Le 5e-05
3nwu_A227 Substrate Induced Remodeling Of The Active Site Reg 5e-05
3otp_A459 Crystal Structure Of The Degp Dodecamer With A Mode 5e-05
3mh4_A456 Htra Proteases Are Activated By A Conserved Mechani 6e-05
3tjn_A228 Htra1 Catalytic Domain, Apo Form Length = 228 6e-05
4a8d_A448 Degp Dodecamer With Bound Omp Length = 448 6e-05
3mh5_A456 Htra Proteases Are Activated By A Conserved Mechani 7e-05
2zle_A448 Cryo-Em Structure Of Degp12OMP Length = 448 9e-05
>pdb|4FLN|A Chain A, Crystal Structure Of Plant Protease Deg2 Length = 539 Back     alignment and structure 
Iteration: 1

 Score =  464 bits (1195), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 225/462 (48%), Positives = 318/462 (68%), Gaps = 23/462 (4%)
Query: 123 MDAVVKVFCVHTEPNFSLPWQRKRQYSSSSSGFIVGGRRVLTNAHSVEHHTQVKVKKRGS 182
           ++AVVKV+C HT P++SLPWQ++RQ++S+ S F++G  ++LTNAH VEH TQVKVK+RG 
Sbjct: 47  LNAVVKVYCTHTAPDYSLPWQKQRQFTSTGSAFMIGDGKLLTNAHCVEHDTQVKVKRRGD 106
Query: 183 DTKYLATVLSIGTECDIALLTVKDDEFWEGVSPVEFGDLPALQDAVTVVGYPIGGDTISV 242
           D KY+A VL  G +CDIALL+V+ ++FW+G  P+  G LP LQD+VTVVGYP+GGDTISV
Sbjct: 107 DRKYVAKVLVRGVDCDIALLSVESEDFWKGAEPLRLGHLPRLQDSVTVVGYPLGGDTISV 166
Query: 243 TSGVVSRMEILSYVHGSTELLGL------------------QGKCVGIAFQSLKNDDVEN 284
           T GVVSR+E+ SY HGS++LLG+                  QG+C+G+AFQ  ++++ EN
Sbjct: 167 TKGVVSRIEVTSYAHGSSDLLGIQIDAAINPGNSGGPAFNDQGECIGVAFQVYRSEETEN 226
Query: 285 IGYVIPTPVIIHFIQDYEKNGAYTGFPILGVEWQKMENPDLRISMGMRPGQKGVRIRRIE 344
           IGYVIPT V+ HF+ DYE+NG YTG+P LGV  QK+ENP LR  + + P  +GV +RR+E
Sbjct: 227 IGYVIPTTVVSHFLTDYERNGKYTGYPCLGVLLQKLENPALRECLKV-PTNEGVLVRRVE 285
Query: 345 PTAPESHVLKPSDIILSFDGIDIANDGTVPFRHGERIGFSYLVSQKYTGDSAVVKVLRNS 404
           PT+  S VLK  D+I+SFD + +  +GTVPFR  ERI F YL+SQK+ GD A + ++R  
Sbjct: 286 PTSDASKVLKEGDVIVSFDDLHVGCEGTVPFRSSERIAFRYLISQKFAGDIAEIGIIRAG 345
Query: 405 EVHEFNIKLSTHKRLIPAHINGRPPSYYIIAGFVFTAVTAPYLRSEYGKDYEFDAPVKLL 464
           E  +  + L     L+P HI+G  PSY I+AG VFT ++ P +  E     E    +KLL
Sbjct: 346 EHKKVQVVLRPRVHLVPYHIDGGQPSYIIVAGLVFTPLSEPLIEEE----CEDTIGLKLL 401
Query: 465 DKLLHAMAQSVDEQIVVVSQVLVADINIGYEEIVNTQVLALNGKPVQNLKSLADMVESSE 524
            K  +++A+   EQIV++SQVL  ++NIGYE++ N QVL  NG P++N+  LA +++  +
Sbjct: 402 TKARYSVARFRGEQIVILSQVLANEVNIGYEDMNNQQVLKFNGIPIRNIHHLAHLIDMCK 461
Query: 525 DEFLKFDLEYQQIVVLKSKTAKEATSDILATHCIPSAMSGDL 566
           D++L F+ E   + VL+ + +  A+  IL  + IPS  S DL
Sbjct: 462 DKYLVFEFEDNYVAVLEREASNSASLCILKDYGIPSERSADL 503
>pdb|3NUM|A Chain A, Substrate Induced Remodeling Of The Active Site Regulates Htra1 Activity Length = 332 Back     alignment and structure
>pdb|3NZI|A Chain A, Substrate Induced Remodeling Of The Active Site Regulates Htra1 Activity Length = 334 Back     alignment and structure
>pdb|3TJO|A Chain A, Htra1 Catalytic Domain, Mutationally Inactivated Length = 231 Back     alignment and structure
>pdb|3NWU|A Chain A, Substrate Induced Remodeling Of The Active Site Regulates Htra1 Activity Length = 227 Back     alignment and structure
>pdb|3OTP|A Chain A, Crystal Structure Of The Degp Dodecamer With A Model Substrate Length = 459 Back     alignment and structure
>pdb|3MH4|A Chain A, Htra Proteases Are Activated By A Conserved Mechanism That Can Be Triggered By Distinct Molecular Cues Length = 456 Back     alignment and structure
>pdb|3TJN|A Chain A, Htra1 Catalytic Domain, Apo Form Length = 228 Back     alignment and structure
>pdb|4A8D|A Chain A, Degp Dodecamer With Bound Omp Length = 448 Back     alignment and structure
>pdb|3MH5|A Chain A, Htra Proteases Are Activated By A Conserved Mechanism That Can Be Triggered By Distinct Molecular Cues Length = 456 Back     alignment and structure
>pdb|2ZLE|A Chain A, Cryo-Em Structure Of Degp12OMP Length = 448 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query568
2as9_A210 Serine protease; trypsin-like fold, hydrolase; 1.7 3e-53
2vid_A204 Serine protease SPLB; hydrolase; 1.80A {Staphyloco 3e-43
2w7s_A200 Serine protease SPLA; hydrolase, family S1; 1.80A 8e-41
1lcy_A325 HTRA2 serine protease; apoptosis, PDZ domain, casp 1e-21
3pv2_A451 DEGQ; trypsin fold, PDZ domain, chaperone protease 3e-21
3stj_A345 Protease DEGQ; serine protease, PDZ domain, protea 3e-21
1te0_A318 Protease DEGS; two domains, serine protease, PDZ, 6e-21
4a8c_A436 Periplasmic PH-dependent serine endoprotease DEGQ; 1e-20
1ky9_A448 Protease DO, DEGP, HTRA; protein quality control, 9e-20
3num_A332 Serine protease HTRA1; DEGP, hydrolase; 2.75A {Hom 1e-19
2w5e_A163 Putative serine protease; coiled coil, transmembra 6e-18
3qo6_A348 Protease DO-like 1, chloroplastic; protease, HTRA, 7e-18
3k6y_A237 Serine protease, possible membrane-associated seri 2e-15
1y8t_A324 Hypothetical protein RV0983; serine protease, stru 7e-14
1agj_A242 Epidermolytic toxin A; hydrolase, serine protease; 7e-12
3sti_A245 Protease DEGQ; serine protease, PDZ domain, chaper 3e-11
1l1j_A239 Heat shock protease HTRA; hydrolase, serine protei 3e-11
3tjo_A231 Serine protease HTRA1; peptidase, hydrolase; HET: 1e-10
3lgi_A237 Protease DEGS; stress-sensor, HTRA, PDZ OMP, hydro 8e-10
2l97_A134 HTRA, putative serine protease; HTRA-PDZ, protein 1e-09
1qtf_A246 Exfoliative toxin B; serine protease, superantigen 2e-08
1wcz_A268 Glutamyl endopeptidase; virulence factor, hydrolas 2e-06
2pzd_A113 Serine protease HTRA2; PDZ domain, apoptosis, mito 4e-06
2kl1_A94 YLBL protein; structure genomics, structural genom 5e-06
2kjp_A91 Uncharacterized protein YLBL; mixed alpha-beta pro 1e-05
3i18_A100 LMO2051 protein; alpha-beta protein, structural ge 3e-05
2p3w_A112 Probable serine protease HTRA3; PDZ domain, phage 4e-05
2i4s_A105 General secretion pathway protein C; EPSC, GSPC, P 9e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 9e-05
2hga_A125 Conserved protein MTH1368; GFT structural genomics 1e-04
2i6v_A87 General secretion pathway protein C; EPSC, GSPC, P 4e-04
>2as9_A Serine protease; trypsin-like fold, hydrolase; 1.70A {Staphylococcus aureus} Length = 210 Back     alignment and structure
 Score =  179 bits (456), Expect = 3e-53
 Identities = 33/206 (16%), Positives = 75/206 (36%), Gaps = 28/206 (13%)

Query: 132 VHTEPNFSLPWQRKRQYSSSSSGFIVGGRRVLTNAHSVEHHT-QVKVKKRGSDTKY---- 186
              +   + P+         ++GF++G   ++TN H  + +    ++    +  K     
Sbjct: 6   TQVKDTNNFPYNGVVS-FKDATGFVIGKNTIITNKHVSKDYKVGDRITAHPNGDKGNGGI 64

Query: 187 --LATVLSIGTECDIALLTVKDD---------EFWEGVSPVEFGDLPALQDAVTVVGYPI 235
             + ++     + DI+++ +++           F E V    F     + D + V+GYP+
Sbjct: 65  YKIKSISDYPGDEDISVMNIEEQAVERGPKGFNFNENVQAFNFAKDAKVDDKIKVIGYPL 124

Query: 236 GGD---TISVTSGVVSRMEILSY-VHGSTE-------LLGLQGKCVGIAFQSLKNDDVEN 284
                     ++G + R++          E       +L    + +G+ +  +     E 
Sbjct: 125 PAQNSFKQFESTGTIKRIKDNILNFDAYIEPGNSGSPVLNSNNEVIGVVYGGIGKIGSEY 184

Query: 285 IGYVIPTPVIIHFIQDYEKNGAYTGF 310
            G V  TP I  FIQ + +   +   
Sbjct: 185 NGAVYFTPQIKDFIQKHIEQHHHHHH 210
>2vid_A Serine protease SPLB; hydrolase; 1.80A {Staphylococcus aureus} Length = 204 Back     alignment and structure
>2w7s_A Serine protease SPLA; hydrolase, family S1; 1.80A {Staphylococcus aureus} PDB: 2w7u_A Length = 200 Back     alignment and structure
>1lcy_A HTRA2 serine protease; apoptosis, PDZ domain, caspase activation, binding, hydrolase; 2.00A {Homo sapiens} SCOP: b.36.1.4 b.47.1.1 Length = 325 Back     alignment and structure
>3pv2_A DEGQ; trypsin fold, PDZ domain, chaperone protease, hydrolase; 2.15A {Legionella fallonii} PDB: 3pv3_A 3pv5_A 3pv4_A Length = 451 Back     alignment and structure
>3stj_A Protease DEGQ; serine protease, PDZ domain, protease, chaperone, DEGP, DEGQ hydrolase; 2.60A {Escherichia coli} Length = 345 Back     alignment and structure
>1te0_A Protease DEGS; two domains, serine protease, PDZ, alpha-beta protein, hydro; 2.20A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3gdv_A* 3gcn_A* 3gds_A* 3gdu_A* 3gco_A* 1sot_A 1soz_A 1vcw_A 2r3y_A Length = 318 Back     alignment and structure
>4a8c_A Periplasmic PH-dependent serine endoprotease DEGQ; chaperone, hydrolase; 7.50A {Escherichia coli} PDB: 4a8a_A 4a8b_A 4a9g_A Length = 436 Back     alignment and structure
>1ky9_A Protease DO, DEGP, HTRA; protein quality control, serine protease, trypsin, chaperone, PDZ, ATP-independent, temperature-regulated, periplasm; 2.80A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3ou0_A 4a8d_A 3otp_A 3mh7_A 3mh4_A 3mh5_A* 3mh6_A* 3cs0_A 2zle_A Length = 448 Back     alignment and structure
>3num_A Serine protease HTRA1; DEGP, hydrolase; 2.75A {Homo sapiens} PDB: 3nzi_A 3nwu_A 2ytw_A 2joa_A Length = 332 Back     alignment and structure
>2w5e_A Putative serine protease; coiled coil, transmembrane, thiol protease, RNA replication, ribosomal frameshifting, catalytic triad, membrane; 2.00A {Human astrovirus 1} Length = 163 Back     alignment and structure
>3qo6_A Protease DO-like 1, chloroplastic; protease, HTRA, PH-sensor, hydrolase, photosynthesis; 2.50A {Arabidopsis thaliana} Length = 348 Back     alignment and structure
>3k6y_A Serine protease, possible membrane-associated serine protease; oxidative stress, disulfide, BENT helix, HY protease; 1.30A {Mycobacterium tuberculosis} PDB: 3k6z_A 3lt3_A Length = 237 Back     alignment and structure
>1y8t_A Hypothetical protein RV0983; serine protease, structural genomics, PSI, protein structure initiative; 2.00A {Mycobacterium tuberculosis} SCOP: b.36.1.4 b.47.1.1 PDB: 2z9i_A Length = 324 Back     alignment and structure
>1agj_A Epidermolytic toxin A; hydrolase, serine protease; 1.70A {Staphylococcus aureus} SCOP: b.47.1.1 PDB: 1dua_A 1exf_A 1due_A Length = 242 Back     alignment and structure
>3sti_A Protease DEGQ; serine protease, PDZ domain, chaperone, hydrolase; 2.60A {Escherichia coli} Length = 245 Back     alignment and structure
>1l1j_A Heat shock protease HTRA; hydrolase, serine proteinase; 2.80A {Thermotoga maritima} SCOP: b.47.1.1 Length = 239 Back     alignment and structure
>3tjo_A Serine protease HTRA1; peptidase, hydrolase; HET: BOG; 2.30A {Homo sapiens} PDB: 3tjn_A 3nwu_A Length = 231 Back     alignment and structure
>3lgi_A Protease DEGS; stress-sensor, HTRA, PDZ OMP, hydrolase, serine PR; 1.65A {Escherichia coli} PDB: 2qf3_A 2qf0_A 2rce_A* 3lh3_A* 3b8j_A 2qgr_A 3lh1_A 3lgy_A 3lgu_A 3lgv_A 3lgw_A 3lgt_A 2r3u_A Length = 237 Back     alignment and structure
>2l97_A HTRA, putative serine protease; HTRA-PDZ, protein binding; NMR {Streptococcus pneumoniae} Length = 134 Back     alignment and structure
>1qtf_A Exfoliative toxin B; serine protease, superantigen, hydrolase; 2.40A {Staphylococcus aureus} SCOP: b.47.1.1 PDB: 1dt2_A Length = 246 Back     alignment and structure
>1wcz_A Glutamyl endopeptidase; virulence factor, hydrolase; 2.00A {Staphylococcus aureus} SCOP: b.47.1.1 Length = 268 Back     alignment and structure
>2pzd_A Serine protease HTRA2; PDZ domain, apoptosis, mitochondria, peptid module, hydrolase; 2.75A {Homo sapiens} SCOP: b.36.1.4 Length = 113 Back     alignment and structure
>2kl1_A YLBL protein; structure genomics, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium; NMR {Geobacillus thermodenitrificans} Length = 94 Back     alignment and structure
>2kjp_A Uncharacterized protein YLBL; mixed alpha-beta protein, cell membrane, hydrolase, membrane, protease, serine protease, transmembrane; NMR {Bacillus subtilis} Length = 91 Back     alignment and structure
>3i18_A LMO2051 protein; alpha-beta protein, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 1.70A {Listeria monocytogenes} PDB: 2kjk_A 3i1e_A Length = 100 Back     alignment and structure
>2p3w_A Probable serine protease HTRA3; PDZ domain, phage derived high affinity ligand, protein BIND; 1.70A {Homo sapiens} Length = 112 Back     alignment and structure
>2i4s_A General secretion pathway protein C; EPSC, GSPC, PDZ domain, type 2 secretion system, protein transport, membrane protein; 1.92A {Vibrio cholerae} SCOP: b.36.1.5 Length = 105 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2hga_A Conserved protein MTH1368; GFT structural genomics, PSI, protein structure initiative; NMR {Methanothermobacterthermautotrophicus} SCOP: b.36.1.6 Length = 125 Back     alignment and structure
>2i6v_A General secretion pathway protein C; EPSC, GSPC, PDZ domain, type 2 secretion system, protein transport, membrane protein; 1.63A {Vibrio cholerae} SCOP: b.36.1.5 Length = 87 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query568
4fln_A539 Protease DO-like 2, chloroplastic; protease, DEG, 100.0
4a8c_A436 Periplasmic PH-dependent serine endoprotease DEGQ; 100.0
3pv2_A451 DEGQ; trypsin fold, PDZ domain, chaperone protease 100.0
1ky9_A448 Protease DO, DEGP, HTRA; protein quality control, 100.0
3stj_A345 Protease DEGQ; serine protease, PDZ domain, protea 100.0
1te0_A318 Protease DEGS; two domains, serine protease, PDZ, 100.0
3qo6_A348 Protease DO-like 1, chloroplastic; protease, HTRA, 100.0
1lcy_A325 HTRA2 serine protease; apoptosis, PDZ domain, casp 100.0
1y8t_A324 Hypothetical protein RV0983; serine protease, stru 100.0
3num_A332 Serine protease HTRA1; DEGP, hydrolase; 2.75A {Hom 100.0
3sti_A245 Protease DEGQ; serine protease, PDZ domain, chaper 99.97
1l1j_A239 Heat shock protease HTRA; hydrolase, serine protei 99.96
3lgi_A237 Protease DEGS; stress-sensor, HTRA, PDZ OMP, hydro 99.96
3tjo_A231 Serine protease HTRA1; peptidase, hydrolase; HET: 99.94
3k6y_A237 Serine protease, possible membrane-associated seri 99.91
2w5e_A163 Putative serine protease; coiled coil, transmembra 99.82
2l97_A134 HTRA, putative serine protease; HTRA-PDZ, protein 99.81
2as9_A210 Serine protease; trypsin-like fold, hydrolase; 1.7 99.76
3rle_A209 Golgi reassembly-stacking protein 2; PDZ, tether, 99.72
3gsl_A196 Disks large homolog 4; PDZ domain, tandem, PSD-95, 99.69
1p1d_A196 PDZ45, glutamate receptor interacting protein; PDZ 99.64
2qt5_A200 Glutamate receptor-interacting protein 1; PDZ-pept 99.63
1agj_A242 Epidermolytic toxin A; hydrolase, serine protease; 99.59
2w7s_A200 Serine protease SPLA; hydrolase, family S1; 1.80A 99.59
3r0h_A206 INAD, inactivation-NO-after-potential D protein; p 99.57
2vid_A204 Serine protease SPLB; hydrolase; 1.80A {Staphyloco 99.56
1w9e_A166 Syntenin 1; cell adhesion, adhesion/complex, PDZ d 99.51
2h5c_A198 Alpha-lytic protease; serine protease, acylation t 99.5
2o8l_A274 V8 protease, taphylococcal serine; serine protease 99.5
1qtf_A246 Exfoliative toxin B; serine protease, superantigen 99.49
1mbm_A198 NSP4 proteinase, chymotrypsin-like serine protease 99.47
1wcz_A268 Glutamyl endopeptidase; virulence factor, hydrolas 99.46
2pzd_A113 Serine protease HTRA2; PDZ domain, apoptosis, mito 99.42
2oua_A188 Serine protease, protein NAPA; kinetic stability, 99.39
2p3w_A112 Probable serine protease HTRA3; PDZ domain, phage 99.39
2xkx_A 721 Disks large homolog 4; structural protein, scaffol 99.32
1hpg_A187 Glutamic acid specific protease; serine protease, 99.31
2ea3_A189 Chymotrypsin; celloulomonas, protease, hydrolase; 99.26
3suz_A388 Amyloid beta A4 precursor protein-binding family 2 99.24
3fan_A213 Non-structural protein; chymotrypsin-like, N-termi 99.23
2pfe_A186 Protease A, alkaline serine protease, TFPA; beta-b 99.23
2i4s_A105 General secretion pathway protein C; EPSC, GSPC, P 99.21
2xkx_A 721 Disks large homolog 4; structural protein, scaffol 99.21
2qa9_E185 Streptogrisin-B; chymotrypsin-type serine peptidas 99.18
3i18_A100 LMO2051 protein; alpha-beta protein, structural ge 99.18
2vz5_A139 TAX1-binding protein 3; WNT signaling pathway, pro 99.15
2kl1_A94 YLBL protein; structure genomics, structural genom 99.11
3id1_A95 Regulator of sigma E protease; hydrolase, cell inn 99.11
2kjp_A91 Uncharacterized protein YLBL; mixed alpha-beta pro 99.09
2i6v_A87 General secretion pathway protein C; EPSC, GSPC, P 99.03
1uit_A117 Human discs large 5 protein; PDZ domain, HDLG5, ma 99.0
2eaq_A90 LIM domain only protein 7; conserved hypothetical 98.98
2sga_A181 Proteinase A; hydrolase (serine proteinase); 1.50A 98.93
2w4f_A97 Protein LAP4; structural protein, phosphoprotein, 98.89
3cyy_A92 Tight junction protein ZO-1; protein-ligand comple 98.88
2fcf_A103 Multiple PDZ domain protein; adaptor molecule, pro 98.86
2zpm_A91 Regulator of sigma E protease; metalloproteinase, 98.83
2rcz_A81 Tight junction protein ZO-1; PDZ, domain-swapping, 98.83
2eeh_A100 PDZ domain-containing protein 7; structural genomi 98.82
1x5q_A110 LAP4 protein; PDZ domain, scribble homolog protein 98.82
3sfj_A104 TAX1-binding protein 3; PDZ:peptide complex, signa 98.82
2pkt_A91 PDZ and LIM domain protein 1; PDZ domain, structur 98.8
2iwq_A123 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 98.77
1wh1_A124 KIAA1095 protein; PDZ domain, structural genomics, 98.76
4fgm_A597 Aminopeptidase N family protein; structural genomi 98.74
1qau_A112 Neuronal nitric oxide synthase (residues 1-130); b 98.73
2dls_A93 PDZ-rhogef, RHO guanine nucleotide exchange factor 98.73
3rle_A209 Golgi reassembly-stacking protein 2; PDZ, tether, 98.71
2v90_A96 PDZ domain-containing protein 3; membrane, protein 98.7
2koj_A111 Partitioning defective 3 homolog; PDZ domain, stru 98.67
3tsv_A124 Tight junction protein ZO-1; PDZ, scaffolding, JAM 98.66
1uez_A101 KIAA1526 protein; PDZ domain, structural genomics, 98.64
2yub_A118 LIMK-2, LIM domain kinase 2; PDZ domain, structura 98.64
2vsp_A91 PDZ domain-containing protein 1; membrane, cytopla 98.64
2h2b_A107 Tight junction protein ZO-1; PDZ domain, phage der 98.62
1uf1_A128 KIAA1526 protein; PDZ domain, structural genomics, 98.62
1ihj_A98 INAD; intermolecular disulfide bond, PDZ domain, s 98.62
2vwr_A95 Ligand of NUMB protein X 2; protein-binding, metal 98.62
2kom_A121 Partitioning defective 3 homolog; PAR-3B, PDZ doma 98.61
2l97_A134 HTRA, putative serine protease; HTRA-PDZ, protein 98.61
1uf1_A128 KIAA1526 protein; PDZ domain, structural genomics, 98.61
2pa1_A87 PDZ and LIM domain protein 2; PDZ domain, structur 98.6
2jil_A97 GRIP1 protein, glutamate receptor interacting prot 98.6
2uzc_A88 Human pdlim5, PDZ and LIM domain 5; metal-binding, 98.6
1zyo_A191 Serine protease; beta-barrel, glutamyl endopeptida 98.6
2hga_A125 Conserved protein MTH1368; GFT structural genomics 98.6
4amh_A106 Disks large homolog 1; permutation, protein foldin 98.59
2awx_A105 Synapse associated protein 97; membrane protein, s 98.59
2he4_A90 Na(+)/H(+) exchange regulatory cofactor NHE-RF2; p 98.59
2opg_A98 Multiple PDZ domain protein; structural protein, s 98.59
2edz_A114 PDZ domain-containing protein 1; CFTR-associated p 98.58
3bpu_A88 Membrane-associated guanylate kinase, WW and PDZ c 98.57
1m5z_A91 GRIP, AMPA receptor interacting protein; six beta- 98.55
2qkv_A96 Inactivation-NO-after-potential D protein; PDZ dom 98.55
1n7e_A97 AMPA receptor interacting protein GRIP; PDZ, prote 98.54
2jxo_A98 Ezrin-radixin-moesin-binding phosphoprotein 50; nh 98.54
1nf3_C128 PAR-6B; semi-CRIB motif, switch I and II, PDZ doma 98.54
2f5y_A91 Regulator of G-protein signalling 3 isoform 1; PDZ 98.53
1rgw_A85 ZAsp protein; PDZ, cypher, oracle, muscle, Z-DISK, 98.53
1b8q_A127 Protein (neuronal nitric oxide synthase); PDZ doma 98.53
1vb7_A94 PDZ and LIM domain 2; PDZ domain PDZ-LIM protein, 98.52
2q3g_A89 PDZ and LIM domain protein 7; structural genomics, 98.51
2eeg_A94 PDZ and LIM domain protein 4; PDZ domain, structur 98.51
1x5n_A114 Harmonin; PDZ domain, usher syndrome 1C protein, a 98.5
1wf7_A103 Enigma homologue protein; PDZ domain, structural g 98.5
2pzd_A113 Serine protease HTRA2; PDZ domain, apoptosis, mito 98.5
2i04_A85 Membrane-associated guanylate kinase, WW and PDZ d 98.49
2la8_A106 Inactivation-NO-after-potential D protein, KON-TI 98.49
3khf_A99 Microtubule-associated serine/threonine-protein ki 98.49
2fe5_A94 Presynaptic protein SAP102; PDZ domain, DLG3, huma 98.49
2e7k_A91 Maguk P55 subfamily member 2; PDZ domain, MPP2 pro 98.48
1um1_A110 KIAA1849 protein, RSGI RUH-007; PDZ domain, human 98.48
3r68_A95 Na(+)/H(+) exchange regulatory cofactor NHE-RF3; P 98.48
2ejy_A97 55 kDa erythrocyte membrane protein; GPC, maguk, P 98.48
2qbw_A195 PDZ-fibronectin fusion protein; fibronectin PDZ, u 98.48
1wif_A126 RSGI RUH-020, riken cDNA 4930408O21; PDZ domain, s 98.47
3axa_A106 Afadin, nectin-3, protein AF-6; PDZ domain, fusion 98.47
1v5l_A103 PDZ and LIM domain 3; actinin alpha 2 associated L 98.47
1ujd_A117 KIAA0559 protein; PDZ domain, structural genomics, 98.46
2yt7_A101 Amyloid beta A4 precursor protein-binding family A 98.46
1wi2_A104 Riken cDNA 2700099C19; structural genomics, riken 98.46
2ego_A96 General receptor for phosphoinositides 1- associat 98.46
3ngh_A106 PDZ domain-containing protein 1; adaptor protein, 98.46
1ujv_A96 Membrane associated guanylate kinase inverted-2 (M 98.45
1tp5_A119 Presynaptic density protein 95; PDZ-peptide ligand 98.45
2dmz_A129 INAD-like protein; PDZ domain, inadl protein, hina 98.45
2p3w_A112 Probable serine protease HTRA3; PDZ domain, phage 98.45
1mfg_A95 ERB-B2 interacting protein; PDZ domain, protein-pe 98.44
1ueq_A123 Membrane associated guanylate kinase inverted-2 (M 98.44
2jik_A101 Synaptojanin-2 binding protein; transmembrane, out 98.44
1uep_A103 Membrane associated guanylate kinase inverted-2 (M 98.44
2jre_A108 C60-1 PDZ domain peptide; de novo protein; NMR {Sy 98.44
1v5q_A122 GRIP1 homolog, glutamate receptor interacting prot 98.43
3i4w_A104 Disks large homolog 4; alpha and beta protein, alt 98.42
3stj_A345 Protease DEGQ; serine protease, PDZ domain, protea 98.42
2i1n_A102 Discs, large homolog 3; DLG3, PDZ, PDZ domain, sig 98.42
2o2t_A117 Multiple PDZ domain protein; structural protein, s 98.42
1va8_A113 Maguk P55 subfamily member 5; PDZ domain, palmitoy 98.41
3i18_A100 LMO2051 protein; alpha-beta protein, structural ge 98.41
2r4h_A112 Membrane-associated guanylate kinase, WW and PDZ c 98.41
1p3c_A215 Glutamyl-endopeptidase; serine protease, hydrolase 98.41
2q9v_A90 Membrane-associated guanylate kinase, WW and PDZ c 98.4
1d5g_A96 Human phosphatase HPTP1E; protein-peptide complex, 98.39
2d90_A102 PDZ domain containing protein 1; structural genomi 98.39
1wf8_A107 Neurabin-I; PDZ domain, structural genomics, NPPSF 98.39
1wfg_A131 Regulating synaptic membrane exocytosis protein 2; 98.39
2iwn_A97 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 98.38
2qg1_A92 Multiple PDZ domain protein; MPDZ, MUPP1, structur 98.38
2djt_A104 Unnamed protein product; PDZ domain, structural ge 98.38
2kl1_A94 YLBL protein; structure genomics, structural genom 98.38
2i6v_A87 General secretion pathway protein C; EPSC, GSPC, P 98.37
1q7x_A108 PDZ2B domain of PTP-BAS (HPTP1E); phosphatase, str 98.36
1kwa_A88 Hcask/LIN-2 protein; PDZ domain, neurexin, syndeca 98.36
2fne_A117 Multiple PDZ domain protein; structural protein, s 98.36
2kv8_A83 RGS12, regulator of G-protein signaling 12; PDZ do 98.35
2dlu_A111 INAD-like protein; PDZ domain, inadl protein, hina 98.34
2kjd_A128 Sodium/hydrogen exchange regulatory cofactor NHE- 98.34
2byg_A117 Channel associated protein of synapse-110; DLG2, P 98.33
2kjp_A91 Uncharacterized protein YLBL; mixed alpha-beta pro 98.33
3qik_A101 Phosphatidylinositol 3,4,5-trisphosphate-dependen 98.33
2daz_A124 INAD-like protein; PDZ domain, inadl protein, hina 98.32
2vsv_A109 Rhophilin-2; scaffold protein, RHO GTPase binding, 98.32
2g5m_B113 Neurabin-2; spinophilin, PDZ domain, CNS, synaptic 98.32
2kpk_A129 Membrane-associated guanylate kinase, WW and PDZ c 98.32
3cbz_A108 Dishevelled-2; PDZ domain, phage derived high affi 98.31
1q3o_A109 Shank1; PDZ, GKAP, peptide binding protein; 1.80A 98.31
2iwo_A120 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 98.31
2eno_A120 Synaptojanin-2-binding protein; mitochondrial oute 98.31
1wha_A105 KIAA0147 protein, scribble; PDZ domain, cellular s 98.3
2rcz_A81 Tight junction protein ZO-1; PDZ, domain-swapping, 98.3
1y7n_A90 Amyloid beta A4 precursor protein-binding family A 98.3
1n7t_A103 99-MER peptide of densin-180-like protein; PDZ dom 98.3
2edv_A96 FERM and PDZ domain-containing protein 1; cytoskel 98.29
2pa1_A87 PDZ and LIM domain protein 2; PDZ domain, structur 98.27
1pq7_A224 Trypsin; ultra-high resolution, catalysis, hydrola 98.26
1g9o_A91 NHE-RF; PDZ domain, complex, signaling protein; 1. 98.25
1uew_A114 Membrane associated guanylate kinase inverted-2 (M 98.25
1whd_A100 RGS3, regulator of G-protein signaling 3; PDZ doma 98.24
3kzd_A94 TIAM-1, T-lymphoma invasion and metastasis-inducin 98.24
3id1_A95 Regulator of sigma E protease; hydrolase, cell inn 98.24
1te0_A318 Protease DEGS; two domains, serine protease, PDZ, 98.24
2eaq_A90 LIM domain only protein 7; conserved hypothetical 98.24
1wg6_A127 Hypothetical protein (riken cDNA 2810455B10); stru 98.24
1wfv_A103 Membrane associated guanylate kinase inverted-2; a 98.23
1v62_A117 KIAA1719 protein; structural genomics, synaptic tr 98.23
4a8c_A436 Periplasmic PH-dependent serine endoprotease DEGQ; 98.23
1gvz_A237 Kallikrein-1E2; antigen, prostate specific antigen 98.22
2yuy_A126 RHO GTPase activating protein 21; PDZ domain, stru 98.22
3e17_A88 Tight junction protein ZO-2; domain swapping, alte 98.21
2dm8_A116 INAD-like protein; PDZ domain, inadl protein, hina 98.21
3nfk_A107 Tyrosine-protein phosphatase non-receptor type 4; 98.21
3qe1_A107 Sorting nexin-27, G protein-activated inward RECT 98.2
1fc6_A388 Photosystem II D1 protease; D1 C-terminal processi 98.2
1uju_A111 Scribble; PDZ domain, cellular signaling, structur 98.2
2zpm_A91 Regulator of sigma E protease; metalloproteinase, 98.2
3mfj_A223 Cationic trypsin; serine proteinase, hydrolase; 0. 98.19
1fxy_A228 Coagulation factor XA-trypsin chimera; protease, c 98.19
1qav_A90 Alpha-1 syntrophin (residues 77-171); beta-finger, 98.19
2v90_A96 PDZ domain-containing protein 3; membrane, protein 98.18
2ehr_A117 INAD-like protein; PDZ domain, inadl protein, hina 98.18
2db5_A128 INAD-like protein; PDZ domain, hinadl, PALS1- asso 98.18
2dkr_A93 LIN-7 homolog B; LIN-7B, PDZ, structural genomics, 98.17
2pkt_A91 PDZ and LIM domain protein 1; PDZ domain, structur 98.17
3gsl_A196 Disks large homolog 4; PDZ domain, tandem, PSD-95, 98.17
4i8h_A223 Cationic trypsin, beta-trypsin; serine protease, h 98.17
1uhp_A107 Hypothetical protein KIAA1095; PDZ domain, semapho 98.17
1hj8_A222 Trypsin I; hydrolase, radiation damage, disulphide 98.17
2gzv_A114 PRKCA-binding protein; protein kinase C, PDZ domai 98.17
3b76_A118 E3 ubiquitin-protein ligase LNX; PDZ, bound ligand 98.16
3cyy_A92 Tight junction protein ZO-1; protein-ligand comple 98.16
2csj_A117 TJP2 protein; PDZ domain, structural genomics, NPP 98.16
2i4s_A105 General secretion pathway protein C; EPSC, GSPC, P 98.16
1wi4_A109 Synip, syntaxin binding protein 4; syntaxin4-inter 98.16
3k1r_A192 Harmonin; protein-protein complex, alternative spl 98.15
2edp_A100 Fragment, shroom family member 4; APX/shroom famil 98.15
2zch_P237 Prostate-specific antigen; human PSA, kallikrein r 98.15
1x6d_A119 Interleukin-16; PDZ domain, lymphocyte chemoattrac 98.15
2vz5_A139 TAX1-binding protein 3; WNT signaling pathway, pro 98.14
2d92_A108 INAD-like protein; PDZ domain, inadl protein, hina 98.14
2uzc_A88 Human pdlim5, PDZ and LIM domain 5; metal-binding, 98.14
1ihj_A98 INAD; intermolecular disulfide bond, PDZ domain, s 98.13
1ton_A235 Tonin; hydrolase(serine proteinase); 1.80A {Rattus 98.13
1wh1_A124 KIAA1095 protein; PDZ domain, structural genomics, 98.13
2eei_A106 PDZ domain-containing protein 1; regulatory factor 98.13
3l4f_D132 SH3 and multiple ankyrin repeat domains protein 1; 98.13
3pv2_A451 DEGQ; trypsin fold, PDZ domain, chaperone protease 98.13
2jxo_A98 Ezrin-radixin-moesin-binding phosphoprotein 50; nh 98.12
2qt5_A200 Glutamate receptor-interacting protein 1; PDZ-pept 98.12
2fcf_A103 Multiple PDZ domain protein; adaptor molecule, pro 98.12
3o46_A93 Maguk P55 subfamily member 7; PDZ domain, structur 98.12
2jil_A97 GRIP1 protein, glutamate receptor interacting prot 98.11
1azz_A226 Collagenase; complex (serine protease/inhibitor), 98.1
3soe_A113 Membrane-associated guanylate kinase, WW and PDZ c 98.1
1npm_A225 Neuropsin; serine proteinase, glycoprotein; HET: N 98.1
2z17_A104 Pleckstrin homology SEC7 and coiled-coil domains- 98.1
1vae_A111 Rhophilin 2, rhophilin, RHO GTPase binding protein 98.09
3tsz_A 391 Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffol 98.09
2vsp_A91 PDZ domain-containing protein 1; membrane, cytopla 98.09
2qxi_A224 Kallikrein-7; S1 pocket, chloromethyl ketone, alte 98.08
2eeh_A100 PDZ domain-containing protein 7; structural genomi 98.08
3s9c_A234 Vipera russelli proteinase RVV-V gamma; serine pro 98.07
1lo6_A223 Kallikrein 6, HK6; serine protease, human kallikre 98.06
1vb7_A94 PDZ and LIM domain 2; PDZ domain PDZ-LIM protein, 98.05
2psx_A227 Kallikrein-5; zinc inhibition, stratum corneum, gl 98.05
1a7s_A225 Heparin binding protein; serine protease homolog, 98.04
1aut_C250 Activated protein C; serine proteinase, plasma cal 98.04
1fuj_A221 PR3, myeloblastin; hydrolase, serine protease, gly 98.04
4e7n_A238 Snake-venom thrombin-like enzyme; beta-barrel, hyd 98.04
2hga_A125 Conserved protein MTH1368; GFT structural genomics 98.04
1cgh_A224 Cathepsin G; inflammation, specificity, serine pro 98.04
1um7_A113 Synapse-associated protein 102; PDZ, discs large h 98.04
1lcy_A325 HTRA2 serine protease; apoptosis, PDZ domain, casp 98.04
2yub_A118 LIMK-2, LIM domain kinase 2; PDZ domain, structura 98.03
2he4_A90 Na(+)/H(+) exchange regulatory cofactor NHE-RF2; p 98.03
1kwa_A88 Hcask/LIN-2 protein; PDZ domain, neurexin, syndeca 98.03
3beu_A224 Trypsin, SGT; beta sheets, serine protease, hydrol 98.03
3r0h_A206 INAD, inactivation-NO-after-potential D protein; p 98.03
4ag1_A226 Chymase; hydrolase-de novo protein complex, inhibi 98.03
3rp2_A224 RAT MAST cell protease II; serine proteinase; 1.90 98.03
2d8i_A114 T-cell lymphoma invasion and metastasis 1 variant; 98.03
1iau_A227 Granzyme B; hydrolase-hydrolase inhibitor complex; 98.03
3s69_A234 Thrombin-like enzyme defibrase; beta-barrel, serin 98.02
1ueq_A123 Membrane associated guanylate kinase inverted-2 (M 98.02
2iwq_A123 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 98.01
2xw9_A228 Complement factor D; immune system, hydrolase, ser 98.01
3bpu_A88 Membrane-associated guanylate kinase, WW and PDZ c 98.0
3sfj_A104 TAX1-binding protein 3; PDZ:peptide complex, signa 98.0
2koj_A111 Partitioning defective 3 homolog; PDZ domain, stru 98.0
1p1d_A196 PDZ45, glutamate receptor interacting protein; PDZ 97.99
2q3g_A89 PDZ and LIM domain protein 7; structural genomics, 97.99
3fzz_A227 Granzyme C; hydrolase, cytolysis, protease, serine 97.98
3cbz_A108 Dishevelled-2; PDZ domain, phage derived high affi 97.98
4e34_A87 Golgi-associated PDZ and coiled-coil motif-contai 97.98
2bdg_A223 Kallikrein-4; serine proteinase, S1 subsite, 70-80 97.98
1ao5_A237 Glandular kallikrein-13; serine protease, protein 97.98
2aiq_A231 Protein C activator; snake venom serine proteinase 97.98
2kom_A121 Partitioning defective 3 homolog; PAR-3B, PDZ doma 97.97
2krg_A216 Na(+)/H(+) exchange regulatory cofactor NHE-RF1; a 97.97
3egg_C170 Spinophilin; PP1, serine/threonine phosphatase, po 97.97
1v5l_A103 PDZ and LIM domain 3; actinin alpha 2 associated L 97.97
1sgf_A240 7S NGF, nerve growth factor; growth factor (beta-N 97.97
2i04_A85 Membrane-associated guanylate kinase, WW and PDZ d 97.96
3tsv_A124 Tight junction protein ZO-1; PDZ, scaffolding, JAM 97.96
3shw_A 468 Tight junction protein ZO-1; PDZ-SH3-GUK supramodu 97.96
3khf_A99 Microtubule-associated serine/threonine-protein ki 97.96
3hpk_A125 Protein interacting with PRKCA 1; oxidized, PDZ do 97.96
2fne_A117 Multiple PDZ domain protein; structural protein, s 97.96
1g9o_A91 NHE-RF; PDZ domain, complex, signaling protein; 1. 97.95
2cs5_A119 Tyrosine-protein phosphatase, non-receptor type 4; 97.95
2z7f_E218 Leukocyte elastase; serine protease, serine protea 97.95
3ncl_A241 Suppressor of tumorigenicity 14 protein; proteinas 97.95
2byg_A117 Channel associated protein of synapse-110; DLG2, P 97.95
1qau_A112 Neuronal nitric oxide synthase (residues 1-130); b 97.95
1spj_A238 Kallikrein 1; serine protease, KLK1, HK1, hydrolas 97.95
3cp7_A218 Alkaline serine protease Al20; trypsin-like, hydro 97.94
1v6b_A118 Harmonin isoform A1; structural genomics, usher sy 97.94
1eq9_A222 Chymotrypsin; FIRE ANT, serine proteinase, hydrola 97.93
2jre_A108 C60-1 PDZ domain peptide; de novo protein; NMR {Sy 97.92
1uep_A103 Membrane associated guanylate kinase inverted-2 (M 97.92
2w4f_A97 Protein LAP4; structural protein, phosphoprotein, 97.91
1bru_P241 Elastase, PPE; serine protease, hydrolase; HET: 1N 97.91
1d5g_A96 Human phosphatase HPTP1E; protein-peptide complex, 97.9
1gvk_B240 Elastase 1, peptide inhibitor; hydrolase, serine p 97.9
2vsv_A109 Rhophilin-2; scaffold protein, RHO GTPase binding, 97.9
2ego_A96 General receptor for phosphoinositides 1- associat 97.9
1rgw_A85 ZAsp protein; PDZ, cypher, oracle, muscle, Z-DISK, 97.9
1mza_A240 Pro-granzyme K; apoptosis, serine protease, S1 fam 97.9
3gov_B251 MAsp-1; complement, serine protease, beta barrel, 97.89
2yt7_A101 Amyloid beta A4 precursor protein-binding family A 97.89
1ujv_A96 Membrane associated guanylate kinase inverted-2 (M 97.89
2hlc_A230 Collagenase; serine protease, hydrolase, collagen 97.89
1v5q_A122 GRIP1 homolog, glutamate receptor interacting prot 97.89
1x5n_A114 Harmonin; PDZ domain, usher syndrome 1C protein, a 97.89
2dc2_A103 GOPC, golgi associated PDZ and coiled-coil motif c 97.88
3h7t_A235 Group 3 allergen smipp-S YVT004A06; hydrolase; 2.0 97.88
2fe5_A94 Presynaptic protein SAP102; PDZ domain, DLG3, huma 97.88
1elt_A236 Elastase; serine proteinase; 1.61A {Salmo salar} S 97.88
2r0l_A248 Hepatocyte growth factor activator; serine proteas 97.88
1x5q_A110 LAP4 protein; PDZ domain, scribble homolog protein 97.88
2ejy_A97 55 kDa erythrocyte membrane protein; GPC, maguk, P 97.87
1wi4_A109 Synip, syntaxin binding protein 4; syntaxin4-inter 97.87
1wfg_A131 Regulating synaptic membrane exocytosis protein 2; 97.87
2o2t_A117 Multiple PDZ domain protein; structural protein, s 97.87
3mhw_U247 Urokinase-type plasminogen activator; hydrolase, b 97.86
1i16_A130 Interleukin 16, LCF; cytokine, lymphocyte chemoatt 97.86
2kjd_A128 Sodium/hydrogen exchange regulatory cofactor NHE- 97.85
1si5_H240 Scatter factor, hepatocyte growth factor, SF, hepa 97.85
1t8o_A245 Chymotrypsin A; chymotrypsin, serine proteinase, B 97.85
2dmz_A129 INAD-like protein; PDZ domain, inadl protein, hina 97.85
2jkh_A241 Activated factor XA heavy chain; plasma, calcium, 97.84
1ujd_A117 KIAA0559 protein; PDZ domain, structural genomics, 97.84
1n7e_A97 AMPA receptor interacting protein GRIP; PDZ, prote 97.84
1wi2_A104 Riken cDNA 2700099C19; structural genomics, riken 97.83
2d90_A102 PDZ domain containing protein 1; structural genomi 97.83
2edz_A114 PDZ domain-containing protein 1; CFTR-associated p 97.83
2f91_A237 Hepatopancreas trypsin; trypsin, canonical inhibit 97.82
3o46_A93 Maguk P55 subfamily member 7; PDZ domain, structur 97.82
2i1n_A102 Discs, large homolog 3; DLG3, PDZ, PDZ domain, sig 97.82
2f5y_A91 Regulator of G-protein signalling 3 isoform 1; PDZ 97.82
1uew_A114 Membrane associated guanylate kinase inverted-2 (M 97.82
2r4h_A112 Membrane-associated guanylate kinase, WW and PDZ c 97.82
2d92_A108 INAD-like protein; PDZ domain, inadl protein, hina 97.82
2asu_B234 Hepatocyte growth factor-like protein; serine prot 97.82
1r6j_A82 Syntenin 1; PDZ, membrane protein; 0.73A {Homo sap 97.82
2q9v_A90 Membrane-associated guanylate kinase, WW and PDZ c 97.82
1euf_A227 Duodenase; serine protease, dual specificity, hydr 97.81
3k50_A403 Putative S41 protease; structural genomics, joint 97.81
1orf_A234 Granzyme A; hydrolase-hydrolase inhibitor complex; 97.81
3r68_A95 Na(+)/H(+) exchange regulatory cofactor NHE-RF3; P 97.81
2djt_A104 Unnamed protein product; PDZ domain, structural ge 97.81
2h2b_A107 Tight junction protein ZO-1; PDZ domain, phage der 97.8
2jik_A101 Synaptojanin-2 binding protein; transmembrane, out 97.8
2opg_A98 Multiple PDZ domain protein; structural protein, s 97.8
1mfg_A95 ERB-B2 interacting protein; PDZ domain, protein-pe 97.8
3ngh_A106 PDZ domain-containing protein 1; adaptor protein, 97.79
1va8_A113 Maguk P55 subfamily member 5; PDZ domain, palmitoy 97.79
2jde_A276 Urokinase-type plasminogen activator; plasminogen 97.79
2eeg_A94 PDZ and LIM domain protein 4; PDZ domain, structur 97.78
2kpk_A129 Membrane-associated guanylate kinase, WW and PDZ c 97.78
3gge_A95 PDZ domain-containing protein GIPC2; structural ge 97.78
2awx_A105 Synapse associated protein 97; membrane protein, s 97.78
3mmg_A241 Nuclear inclusion protein A; 3C-type protease, TEV 97.78
1wha_A105 KIAA0147 protein, scribble; PDZ domain, cellular s 97.77
3axa_A106 Afadin, nectin-3, protein AF-6; PDZ domain, fusion 97.77
4amh_A106 Disks large homolog 1; permutation, protein foldin 97.77
1vae_A111 Rhophilin 2, rhophilin, RHO GTPase binding protein 97.76
2e7k_A91 Maguk P55 subfamily member 2; PDZ domain, MPP2 pro 97.76
1m9u_A241 Earthworm fibrinolytic enzyme; hydrolase, serine p 97.76
2wph_S235 Coagulation factor IXA heavy chain; serine proteas 97.76
2vwr_A95 Ligand of NUMB protein X 2; protein-binding, metal 97.76
2any_A241 Kininogenin, plasma kallikrein, light chain, fletc 97.76
2oq5_A232 Transmembrane protease, serine 11E; type II trans- 97.75
1q3o_A109 Shank1; PDZ, GKAP, peptide binding protein; 1.80A 97.75
1yc0_A283 Hepatocyte growth factor activator; hydrolase/inhi 97.75
1wf7_A103 Enigma homologue protein; PDZ domain, structural g 97.75
3h7o_A228 Group 3 allergen smipp-S YV6023A04; hydrolase; 1.8 97.75
1b8q_A127 Protein (neuronal nitric oxide synthase); PDZ doma 97.75
3tvj_B242 Mannan-binding lectin serine protease 2 B chain; i 97.74
1v62_A117 KIAA1719 protein; structural genomics, synaptic tr 97.74
1nf3_C128 PAR-6B; semi-CRIB motif, switch I and II, PDZ doma 97.74
2lob_A112 Golgi-associated PDZ and coiled-coil motif-contai 96.93
2kv8_A83 RGS12, regulator of G-protein signaling 12; PDZ do 97.73
3f1s_B283 Vitamin K-dependent protein Z; PZ, ZPI, complex, s 97.73
1ufx_A103 KIAA1526 protein; PDZ domain, structural genomics, 97.72
3gyl_B261 Prostasin; ENAC, zymogen, divalent cation, channel 97.72
1wif_A126 RSGI RUH-020, riken cDNA 4930408O21; PDZ domain, s 97.71
1uhp_A107 Hypothetical protein KIAA1095; PDZ domain, semapho 97.71
3bg8_A238 Coagulation factor XIA light chain; protease inhib 97.71
1x6d_A119 Interleukin-16; PDZ domain, lymphocyte chemoattrac 97.71
1uit_A117 Human discs large 5 protein; PDZ domain, HDLG5, ma 97.7
2db5_A128 INAD-like protein; PDZ domain, hinadl, PALS1- asso 97.7
1pyt_D251 TC, PCPA-TC, chymotrypsinogen C; ternary complex ( 97.7
2dls_A93 PDZ-rhogef, RHO guanine nucleotide exchange factor 97.7
2iwn_A97 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 97.7
1k32_A1045 Tricorn protease; protein degradation, substrate g 97.7
1q7x_A108 PDZ2B domain of PTP-BAS (HPTP1E); phosphatase, str 97.69
2bz6_H254 Blood coagulation factor VIIA; serine protease, en 97.69
1uez_A101 KIAA1526 protein; PDZ domain, structural genomics, 97.69
3k1r_A192 Harmonin; protein-protein complex, alternative spl 97.69
2eno_A120 Synaptojanin-2-binding protein; mitochondrial oute 97.69
2qy0_B242 Complement C1R subcomponent; serine protease, beta 97.69
1i16_A130 Interleukin 16, LCF; cytokine, lymphocyte chemoatt 97.68
3e17_A88 Tight junction protein ZO-2; domain swapping, alte 97.68
3qik_A101 Phosphatidylinositol 3,4,5-trisphosphate-dependen 97.67
1y8t_A324 Hypothetical protein RV0983; serine protease, stru 97.67
3b76_A118 E3 ubiquitin-protein ligase LNX; PDZ, bound ligand 97.67
2dm8_A116 INAD-like protein; PDZ domain, inadl protein, hina 97.67
2yuy_A126 RHO GTPase activating protein 21; PDZ domain, stru 97.66
4dgj_A235 Enteropeptidase catalytic light chain; serine prot 97.66
1m5z_A91 GRIP, AMPA receptor interacting protein; six beta- 97.66
1whd_A100 RGS3, regulator of G-protein signaling 3; PDZ doma 97.66
2zgc_A240 Granzyme M; serine protease, cytolysis, glycoprote 97.65
1ym0_A238 Fibrinotic enzyme component B; two chains, glycosy 97.65
1y7n_A90 Amyloid beta A4 precursor protein-binding family A 97.64
2iwo_A120 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 97.64
2g5m_B113 Neurabin-2; spinophilin, PDZ domain, CNS, synaptic 97.64
1ddj_A247 Plasminogen; catalytic domain, blood clotting; 2.0 97.64
3qe1_A107 Sorting nexin-27, G protein-activated inward RECT 97.62
1n7t_A103 99-MER peptide of densin-180-like protein; PDZ dom 97.62
2qg1_A92 Multiple PDZ domain protein; MPDZ, MUPP1, structur 97.62
1um1_A110 KIAA1849 protein, RSGI RUH-007; PDZ domain, human 97.61
2dkr_A93 LIN-7 homolog B; LIN-7B, PDZ, structural genomics, 97.61
2dlu_A111 INAD-like protein; PDZ domain, inadl protein, hina 97.61
1ky9_A448 Protease DO, DEGP, HTRA; protein quality control, 97.6
1wg6_A127 Hypothetical protein (riken cDNA 2810455B10); stru 97.59
1w9e_A166 Syntenin 1; cell adhesion, adhesion/complex, PDZ d 97.59
2gzv_A114 PRKCA-binding protein; protein kinase C, PDZ domai 97.57
2edp_A100 Fragment, shroom family member 4; APX/shroom famil 97.57
1wf8_A107 Neurabin-I; PDZ domain, structural genomics, NPPSF 97.56
2qkv_A96 Inactivation-NO-after-potential D protein; PDZ dom 97.56
3nfk_A107 Tyrosine-protein phosphatase non-receptor type 4; 97.56
1qav_A90 Alpha-1 syntrophin (residues 77-171); beta-finger, 97.55
3h5c_B317 Vitamin K-dependent protein Z; protein Z-protein Z 97.55
2z17_A104 Pleckstrin homology SEC7 and coiled-coil domains- 97.55
1rtf_B252 (TC)-T-PA, two chain tissue plasminogen activator; 97.54
3i4w_A104 Disks large homolog 4; alpha and beta protein, alt 97.53
2cs5_A119 Tyrosine-protein phosphatase, non-receptor type 4; 97.53
3qo6_A348 Protease DO-like 1, chloroplastic; protease, HTRA, 97.53
1wfv_A103 Membrane associated guanylate kinase inverted-2; a 97.53
1uju_A111 Scribble; PDZ domain, cellular signaling, structur 97.53
3l4f_D132 SH3 and multiple ankyrin repeat domains protein 1; 97.53
2olg_A278 Pro-phenoloxidase activating enzyme-I; prophenolox 97.52
3hpk_A125 Protein interacting with PRKCA 1; oxidized, PDZ do 97.52
4fln_A 539 Protease DO-like 2, chloroplastic; protease, DEG, 97.51
1fon_A240 Procarboxypeptidase A-S6; truncated zymogen E, ser 97.5
1fiw_A290 Beta-acrosin heavy chain; anti-parallel beta-barre 97.49
1arb_A268 Achromobacter protease I; hydrolase(serine proteas 97.49
1z87_A263 Alpha-1-syntrophin; protein binding; NMR {Mus musc 97.49
2edv_A96 FERM and PDZ domain-containing protein 1; cytoskel 97.48
2vnt_A276 Urokinase-type plasminogen activator; UPA, inhibit 97.48
3rm2_H259 Thrombin heavy chain; serine protease, kringle, hy 97.48
2ehr_A117 INAD-like protein; PDZ domain, inadl protein, hina 97.48
3kzd_A94 TIAM-1, T-lymphoma invasion and metastasis-inducin 97.47
3egg_C170 Spinophilin; PP1, serine/threonine phosphatase, po 97.45
2daz_A124 INAD-like protein; PDZ domain, inadl protein, hina 97.45
3soe_A113 Membrane-associated guanylate kinase, WW and PDZ c 97.44
2d8i_A114 T-cell lymphoma invasion and metastasis 1 variant; 97.44
3num_A332 Serine protease HTRA1; DEGP, hydrolase; 2.75A {Hom 97.43
2la8_A106 Inactivation-NO-after-potential D protein, KON-TI 97.41
1z8g_A372 Serine protease hepsin; serine protease hepsin, pr 97.4
2dc2_A103 GOPC, golgi associated PDZ and coiled-coil motif c 97.39
1ufx_A103 KIAA1526 protein; PDZ domain, structural genomics, 97.39
2f9n_A245 Alpha I tryptase; serine proteinase, trypsin-like, 97.39
4e34_A87 Golgi-associated PDZ and coiled-coil motif-contai 97.39
1md8_A329 C1R complement serine protease; innate immunity, a 97.37
2csj_A117 TJP2 protein; PDZ domain, structural genomics, NPP 97.36
2qbw_A195 PDZ-fibronectin fusion protein; fibronectin PDZ, u 97.35
1yph_C131 Chymotrypsin A, chain B; serine protease, hydrolas 97.33
2eei_A106 PDZ domain-containing protein 1; regulatory factor 97.32
1v6b_A118 Harmonin isoform A1; structural genomics, usher sy 97.3
1tp5_A119 Presynaptic density protein 95; PDZ-peptide ligand 97.22
3tsz_A 391 Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffol 97.21
2b9l_A394 Prophenoloxidase activating factor; CLIP domain, e 97.19
1zjk_A403 Mannan-binding lectin serine protease 2; beta barr 97.19
1gpz_A399 Complement C1R component; hydrolase, activation, i 97.18
2bdy_A289 Thrombin; thrombin, complex structure, hydrolase, 97.15
2krg_A216 Na(+)/H(+) exchange regulatory cofactor NHE-RF1; a 97.11
1um7_A113 Synapse-associated protein 102; PDZ, discs large h 97.11
4fgm_A597 Aminopeptidase N family protein; structural genomi 97.04
4dur_A791 Plasminogen, serine protease; fibrinolysis, hydrol 97.03
1lvm_A229 Catalytic domain of the nuclear inclusion protein 97.02
3shw_A 468 Tight junction protein ZO-1; PDZ-SH3-GUK supramodu 96.98
1fc6_A 388 Photosystem II D1 protease; D1 C-terminal processi 96.96
1r6j_A82 Syntenin 1; PDZ, membrane protein; 0.73A {Homo sap 96.94
3hrz_D741 Complement factor B; serine protease, glycosilated 96.91
2xxl_A408 GRAM-positive specific serine protease, isoform B; 96.89
2lob_A112 Golgi-associated PDZ and coiled-coil motif-contai 95.92
4f4o_C347 Haptoglobin; globin fold, serine protease fold, co 96.87
1z87_A263 Alpha-1-syntrophin; protein binding; NMR {Mus musc 96.8
2f83_A625 Coagulation factor XI; protease, apple domain, hyd 96.71
3nxp_A424 Prethrombin-1; allostery, blood coagulation, hydro 96.54
3k50_A 403 Putative S41 protease; structural genomics, joint 96.27
2xrc_A565 Human complement factor I; immune system, hydrolas 96.0
3gge_A95 PDZ domain-containing protein GIPC2; structural ge 95.88
2hal_A212 Hepatitis A protease 3C; 3C protease, inhibitor de 95.85
3qzr_A187 3C protein; chymotrypsin-fold, beta-ribbon, hydrol 95.83
3suz_A388 Amyloid beta A4 precursor protein-binding family 2 95.77
1elv_A333 Complement C1S component; trypsin-like serin prote 95.69
3zve_A190 3C protease; hydrolase, michael inhibitor; HET: G8 95.35
3q3y_A191 HEVB EV93 3C protease; cysteine trypsin-like prote 95.3
>4fln_A Protease DO-like 2, chloroplastic; protease, DEG, PDZ, hydrolase; 2.80A {Arabidopsis thaliana} Back     alignment and structure
Probab=100.00  E-value=2.7e-76  Score=645.80  Aligned_cols=442  Identities=49%  Similarity=0.872  Sum_probs=400.7

Q ss_pred             HhCCCCCceEEEEeEeecCCCCCcccccCCCcceEEEEEEeCCEEEEcccccCCCCeEEEEEcCCCcEEEEEEEEEeCCC
Q 036586          118 KAVPSMDAVVKVFCVHTEPNFSLPWQRKRQYSSSSSGFIVGGRRVLTNAHSVEHHTQVKVKKRGSDTKYLATVLSIGTEC  197 (568)
Q Consensus       118 ~v~p~~~sVV~I~~~~~~~~~~~p~~~~~~~~~~GSGfiI~~G~ILTn~HVV~~~~~i~V~~~~dg~~~~a~vv~~d~~~  197 (568)
                      ...+   |||+|++....+++..||+++++..+.||||||++||||||+|||.++..+.|++.+|+++|+|+|++.|+.+
T Consensus        45 ~~~~---sVV~I~~~~~~~~~~~Pw~~~~~~~s~GSGfiI~dG~IlTN~HVV~~a~~i~V~~~~dg~~~~A~vv~~D~~~  121 (539)
T 4fln_A           45 SFLN---AVVKVYCTHTAPDYSLPWQKQRQFTSTGSAFMIGDGKLLTNAHCVEHDTQVKVKRRGDDRKYVAKVLVRGVDC  121 (539)
T ss_dssp             HHHT---TEEEEEEEECCBCSSSTTSBCCCEEEEEEEEEEETTEEEECGGGGTTEEEEEEECTTCCCCEEEEEEEEETTT
T ss_pred             ccCC---CeEEEEEEecCCCCCCccccCCccceEEEEEEEECCEEEEChHHcCCCCeEEEEEccCCEEEEEEEEEECCCC
Confidence            3456   9999999999999999999999999999999999999999999999999999999679999999999999999


Q ss_pred             CeEEEEeccCccccCccceecCCCcccCCeEEEEecCCCCCCceEEEEEEeeeecccc----------------cCC--C
Q 036586          198 DIALLTVKDDEFWEGVSPVEFGDLPALQDAVTVVGYPIGGDTISVTSGVVSRMEILSY----------------VHG--S  259 (568)
Q Consensus       198 DlAlLkv~~~~~~~~l~~~~l~~~~~~g~~V~aiG~P~g~~~~svt~GiIs~~~~~~~----------------~~g--g  259 (568)
                      ||||||++...++..++++.++++.++|++|++||||+|++..++|.|+||++++..+                ++|  |
T Consensus       122 DLAvLkv~~~~~~~~~~pl~~g~~~~vGd~V~aiG~P~g~~~~tvT~GIVSa~~r~~~~~~~~~~~~IQtDAaInpGnSG  201 (539)
T 4fln_A          122 DIALLSVESEDFWKGAEPLRLGHLPRLQDSVTVVGYPLGGDTISVTKGVVSRIEVTSYAHGSSDLLGIQIDAAINPGNSG  201 (539)
T ss_dssp             TEEEEEECCSSSSTTCCCCCBCCCCCTTCEEEEEECCSSSCCCEEEEEEEEEEEEEECTTSCCEEEEEEESSCCCTTTTT
T ss_pred             CEEEEEEeCCcCCcCCceeecCCcCcCCCeEEEEEcCCCCCCCcEEeEEECcccccccCCCCcceeEEEEEeEecCCCcc
Confidence            9999999987665677889999999999999999999998766999999999865421                244  4


Q ss_pred             ceeecccceEEEEEeeeecCCCCccccccccchhhhHhHHHhhhcCccccCceeeEEEEEcCCHHHHHhcCCCCCCCceE
Q 036586          260 TELLGLQGKCVGIAFQSLKNDDVENIGYVIPTPVIIHFIQDYEKNGAYTGFPILGVEWQKMENPDLRISMGMRPGQKGVR  339 (568)
Q Consensus       260 spL~n~~G~VVGI~~~~~~~~~~~~~~~aIP~~~i~~~l~~l~~~g~~~~~~~lGi~~~~~~~~~~~~~lgl~~~~~Gv~  339 (568)
                      |||+|.+|+||||+++++...+..+++||||++.+++++++|+++|++.+|+|||+.++.+.++.+++.+|++. ..|++
T Consensus       202 GPLvn~~GeVIGIntai~~~~~~~gigfAIP~~~v~~vl~~l~~~G~~~~r~~LGv~~~~~~~~~~~~~~~l~~-~~Gv~  280 (539)
T 4fln_A          202 GPAFNDQGECIGVAFQVYRSEETENIGYVIPTTVVSHFLTDYERNGKYTGYPCLGVLLQKLENPALRECLKVPT-NEGVL  280 (539)
T ss_dssp             SEEECSSSCEEEEECCCC-----CCCEEEEEHHHHHHHHHHHHTTTSCCCCCBCCEEEEECCCHHHHHHHTCSS-SBCEE
T ss_pred             chhccCCCcEEEEEEEEecCCCCCcceecccHHHHHHHHHHHHHcCeEEeeeecceEEEecCCHHHHHhcCCCC-cCcee
Confidence            59999999999999998866677899999999999999999999999877999999999987899999999987 68999


Q ss_pred             EEEecCCCcccCCCCCCCEEEEECCEEcCCCCCCccccCccchHHHHHhccCCCCEEEEEEEECCEEEEEEEEeccCCCc
Q 036586          340 IRRIEPTAPESHVLKPSDIILSFDGIDIANDGTVPFRHGERIGFSYLVSQKYTGDSAVVKVLRNSEVHEFNIKLSTHKRL  419 (568)
Q Consensus       340 V~~V~p~spA~~GL~~GDiIl~InG~~V~~~~dl~~~~~~~~~l~~~l~~~~~g~~v~l~V~R~g~~~~v~v~l~~~~~~  419 (568)
                      |.+|.++|||+++|++||+|++|||++|.+.+++.++..+++.|..++..+.+|++++|+|+|+|++++++|+|..++.+
T Consensus       281 V~~V~~~spA~~al~~GDvI~~idg~~V~~~g~~~~~~~~~~~l~~~v~~~~~Gd~v~l~v~R~Gk~~~v~Vtl~~~~~~  360 (539)
T 4fln_A          281 VRRVEPTSDASKVLKEGDVIVSFDDLHVGCEGTVPFRSSERIAFRYLISQKFAGDIAEIGIIRAGEHKKVQVVLRPRVHL  360 (539)
T ss_dssp             EEEECTTSGGGGTCCTTCEEEEETTEECBSSSEEECSTTCEEETHHHHHTSCTTCEEEEEEEETTEEEEEEEECBCCCCS
T ss_pred             eecccCCChHHhCccCCCEEEEECCEEeCcCCeeccccchhHHHHHHHHcCCCCCEEEEEEEECCEEEEEEEEEccCccc
Confidence            99999999998899999999999999999999888777788888999999999999999999999999999999999988


Q ss_pred             cccccCCCCCCceeeecEEEeeCChHHHHHHhCCCCccCchhhhHHHHHhhhhccCCcceEEEEEEeccccccccccccC
Q 036586          420 IPAHINGRPPSYYIIAGFVFTAVTAPYLRSEYGKDYEFDAPVKLLDKLLHAMAQSVDEQIVVVSQVLVADINIGYEEIVN  499 (568)
Q Consensus       420 ~~~~~~~~~~~~~~~~Gl~~~~~~~~~v~~~~~~~~~~~~p~~~~~~~~~~~~~~~~~~gvvvs~V~~~~~~~g~~~~~g  499 (568)
                      .+.+.....|+|++++||+|++++.+++. +++.   ...++++++...+.+.....+++|+|++|++++.+.+|+++.|
T Consensus       361 ~~~~~~~~~p~~~~~~Gl~f~~Lt~~~~~-~~~~---~~~~~~l~~~~~~~~~~~~~~~gVvvs~V~~~s~a~~~g~~~g  436 (539)
T 4fln_A          361 VPYHIDGGQPSYIIVAGLVFTPLSEPLIE-EECE---DTIGLKLLTKARYSVARFRGEQIVILSQVLANEVNIGYEDMNN  436 (539)
T ss_dssp             SCSCTTSSCCCCCCSTTEEEEECCHHHHT-TSCS---SSSCHHHHHHHHHCCCSSTTCCCEEEEEECCCGGGTTCSSCCS
T ss_pred             cccccccCCCccccccceEEeeCCHHHHH-hhcc---cccCceeeehhhhhhhccCCceEEEEEEecCCchhhhcCCCCC
Confidence            88888888999999999999999977666 4442   2446677777777666777888999999999999999999999


Q ss_pred             cEEEeeCCEecCCHHHHHHHHHccCCCeEEEEEEcCeEEEEeccchHhHhHhHHHhcCCCCCCCCCCC
Q 036586          500 TQVLALNGKPVQNLKSLADMVESSEDEFLKFDLEYQQIVVLKSKTAKEATSDILATHCIPSAMSGDLK  567 (568)
Q Consensus       500 d~I~~VNg~pV~~l~~f~~~l~~~~~~~v~l~v~R~~~~~l~~~~~~~~~~~i~~~~~i~~~~~~~~~  567 (568)
                      |+|++|||++|.|++||.++|+++++++++|++.++..++|+++++++++++|+++|+||++||+||.
T Consensus       437 diI~~vNg~~V~s~~~l~~~l~~~k~~~l~~~~~~~~~ivL~~~~~~~~~~~Il~~~~I~~~~S~dl~  504 (539)
T 4fln_A          437 QQVLKFNGIPIRNIHHLAHLIDMCKDKYLVFEFEDNYVAVLEREASNSASLCILKDYGIPSERSADLL  504 (539)
T ss_dssp             EEEEEETTEECCSHHHHHHHHHTCCSSEEEEEETTSCEEEEEHHHHHHHHHHHHTTTTCSCSSCGGGG
T ss_pred             CEEEeECCEEcCCHHHHHHHHHHcCCCeEEEEECCCEEEEEEHHHHHHhHHHHHHhcCCCcccCcchh
Confidence            99999999999999999999999999999999999999999999999999999999999999999985
>4a8c_A Periplasmic PH-dependent serine endoprotease DEGQ; chaperone, hydrolase; 7.50A {Escherichia coli} PDB: 4a8a_A 4a8b_A 4a9g_A Back     alignment and structure
>3pv2_A DEGQ; trypsin fold, PDZ domain, chaperone protease, hydrolase; 2.15A {Legionella fallonii} PDB: 3pv3_A 3pv5_A 3pv4_A Back     alignment and structure
>1ky9_A Protease DO, DEGP, HTRA; protein quality control, serine protease, trypsin, chaperone, PDZ, ATP-independent, temperature-regulated, periplasm; 2.80A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3ou0_A 4a8d_A 3otp_A 3mh7_A 3mh4_A 3mh5_A* 3mh6_A* 3cs0_A 2zle_A Back     alignment and structure
>3stj_A Protease DEGQ; serine protease, PDZ domain, protease, chaperone, DEGP, DEGQ hydrolase; 2.60A {Escherichia coli} Back     alignment and structure
>1te0_A Protease DEGS; two domains, serine protease, PDZ, alpha-beta protein, hydro; 2.20A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3gdv_A* 3gcn_A* 3gds_A* 3gdu_A* 3gco_A* 1sot_A 1soz_A 1vcw_A 2r3y_A Back     alignment and structure
>3qo6_A Protease DO-like 1, chloroplastic; protease, HTRA, PH-sensor, hydrolase, photosynthesis; 2.50A {Arabidopsis thaliana} Back     alignment and structure
>1lcy_A HTRA2 serine protease; apoptosis, PDZ domain, caspase activation, binding, hydrolase; 2.00A {Homo sapiens} SCOP: b.36.1.4 b.47.1.1 Back     alignment and structure
>1y8t_A Hypothetical protein RV0983; serine protease, structural genomics, PSI, protein structure initiative; 2.00A {Mycobacterium tuberculosis} SCOP: b.36.1.4 b.47.1.1 PDB: 2z9i_A Back     alignment and structure
>3num_A Serine protease HTRA1; DEGP, hydrolase; 2.75A {Homo sapiens} PDB: 3nzi_A 2ytw_A 2joa_A Back     alignment and structure
>3sti_A Protease DEGQ; serine protease, PDZ domain, chaperone, hydrolase; 2.60A {Escherichia coli} Back     alignment and structure
>1l1j_A Heat shock protease HTRA; hydrolase, serine proteinase; 2.80A {Thermotoga maritima} SCOP: b.47.1.1 Back     alignment and structure
>3lgi_A Protease DEGS; stress-sensor, HTRA, PDZ OMP, hydrolase, serine PR; 1.65A {Escherichia coli} PDB: 2qf3_A 2qf0_A 2rce_A* 3lh3_A* 3b8j_A 2qgr_A 3lh1_A 3lgy_A 3lgu_A 3lgv_A 3lgw_A 3lgt_A 2r3u_A Back     alignment and structure
>3tjo_A Serine protease HTRA1; peptidase, hydrolase; HET: BOG; 2.30A {Homo sapiens} PDB: 3tjn_A 3nwu_A Back     alignment and structure
>3k6y_A Serine protease, possible membrane-associated serine protease; oxidative stress, disulfide, BENT helix, HY protease; 1.30A {Mycobacterium tuberculosis} PDB: 3k6z_A 3lt3_A Back     alignment and structure
>2w5e_A Putative serine protease; coiled coil, transmembrane, thiol protease, RNA replication, ribosomal frameshifting, catalytic triad, membrane; 2.00A {Human astrovirus 1} Back     alignment and structure
>2l97_A HTRA, putative serine protease; HTRA-PDZ, protein binding; NMR {Streptococcus pneumoniae} Back     alignment and structure
>2as9_A Serine protease; trypsin-like fold, hydrolase; 1.70A {Staphylococcus aureus} Back     alignment and structure
>3rle_A Golgi reassembly-stacking protein 2; PDZ, tether, golgin, membrane protein; 1.65A {Homo sapiens} PDB: 4edj_A Back     alignment and structure
>3gsl_A Disks large homolog 4; PDZ domain, tandem, PSD-95, DLG4, SAP-90, GLUR6, cell juncti membrane, lipoprotein, membrane, palmitate, phosphoprotein; 2.05A {Rattus norvegicus} PDB: 3zrt_A 2ka9_A Back     alignment and structure
>1p1d_A PDZ45, glutamate receptor interacting protein; PDZ domain, tandem repeats, scaffold protein, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 b.36.1.1 PDB: 1p1e_A 1x5r_A Back     alignment and structure
>2qt5_A Glutamate receptor-interacting protein 1; PDZ-peptide complex, PDZ tandem, alternative splicing, cell junction, cytoplasm; 2.30A {Rattus norvegicus} Back     alignment and structure
>1agj_A Epidermolytic toxin A; hydrolase, serine protease; 1.70A {Staphylococcus aureus} SCOP: b.47.1.1 PDB: 1dua_A 1exf_A 1due_A Back     alignment and structure
>2w7s_A Serine protease SPLA; hydrolase, family S1; 1.80A {Staphylococcus aureus} PDB: 2w7u_A Back     alignment and structure
>3r0h_A INAD, inactivation-NO-after-potential D protein; protein-protein complex, PDZ domain, peptide binding protein; 2.60A {Drosophila melanogaster} Back     alignment and structure
>2vid_A Serine protease SPLB; hydrolase; 1.80A {Staphylococcus aureus} Back     alignment and structure
>1w9e_A Syntenin 1; cell adhesion, adhesion/complex, PDZ domain, scaffolding protein signaling protein; 1.56A {Homo sapiens} SCOP: b.36.1.1 b.36.1.1 PDB: 1n99_A 1v1t_A 1obz_A 1w9o_A 1w9q_A 1ybo_A Back     alignment and structure
>2h5c_A Alpha-lytic protease; serine protease, acylation transition STAT catalysis, protein folding, protein stability, packing DIST hydrolase; HET: SO4; 0.82A {Lysobacter enzymogenes} SCOP: b.47.1.1 PDB: 1p02_A 1p03_A 1p04_A 1p05_A 1p06_A* 1p01_A 1p11_E 1p12_E 1qrx_A* 1tal_A 2alp_A 1ssx_A* 2h5d_A* 2ull_A 3qgj_A* 9lpr_A 1boq_A 1gbj_A 1gbk_A 1gbl_A ... Back     alignment and structure
>2o8l_A V8 protease, taphylococcal serine; serine protease, enzyme, hydrolase; 1.50A {Staphylococcus aureus} SCOP: b.47.1.1 PDB: 1qy6_A Back     alignment and structure
>1qtf_A Exfoliative toxin B; serine protease, superantigen, hydrolase; 2.40A {Staphylococcus aureus} SCOP: b.47.1.1 PDB: 1dt2_A Back     alignment and structure
>1mbm_A NSP4 proteinase, chymotrypsin-like serine protease; serine proteinase, chymotrypsin-like proteinase, collapsed O HOLE, transferase; 2.00A {Equine arteritis virus} SCOP: b.47.1.3 Back     alignment and structure
>1wcz_A Glutamyl endopeptidase; virulence factor, hydrolase; 2.00A {Staphylococcus aureus} SCOP: b.47.1.1 Back     alignment and structure
>2pzd_A Serine protease HTRA2; PDZ domain, apoptosis, mitochondria, peptid module, hydrolase; 2.75A {Homo sapiens} SCOP: b.36.1.4 Back     alignment and structure
>2oua_A Serine protease, protein NAPA; kinetic stability, acid stability, electros hydrolase; HET: 2AB; 1.85A {Nocardiopsis alba} Back     alignment and structure
>2p3w_A Probable serine protease HTRA3; PDZ domain, phage derived high affinity ligand, protein BIND; 1.70A {Homo sapiens} Back     alignment and structure
>2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} Back     alignment and structure
>1hpg_A Glutamic acid specific protease; serine protease, hydrolase-hydrolase inhibitor complex; 1.50A {Streptomyces griseus} SCOP: b.47.1.1 Back     alignment and structure
>2ea3_A Chymotrypsin; celloulomonas, protease, hydrolase; 1.78A {Cellulomonas bogoriensis} Back     alignment and structure
>3suz_A Amyloid beta A4 precursor protein-binding family 2; APP binding; 2.70A {Rattus norvegicus} PDB: 1u3b_A 1u39_A 1x45_A 1u37_A 1u38_A 2yt8_A Back     alignment and structure
>3fan_A Non-structural protein; chymotrypsin-like, N-terminal beta-barrels, C-terminal alpha-beta extra domain; 1.90A {Porcine respiratory and reproductivesyndrome virus} PDB: 3fao_A Back     alignment and structure
>2pfe_A Protease A, alkaline serine protease, TFPA; beta-barrels, thermophIle, kinetic stabilit thermostability, protein folding; HET: 2AB; 1.44A {Thermobifida fusca} Back     alignment and structure
>2i4s_A General secretion pathway protein C; EPSC, GSPC, PDZ domain, type 2 secretion system, protein transport, membrane protein; 1.92A {Vibrio cholerae} SCOP: b.36.1.5 Back     alignment and structure
>2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} Back     alignment and structure
>2qa9_E Streptogrisin-B; chymotrypsin-type serine peptidase, second tetrahedral inter tetrapeptide, beta barrels, alpha helix, hydrolase; HET: GOL; 1.18A {Streptomyces griseus} SCOP: b.47.1.1 PDB: 1sge_E 1sgn_E 1sgy_E 1sgd_E 2nu0_E 2nu1_E 2gkv_E 2nu3_E 2nu4_E 2nu2_E* 2qaa_A* 2sgd_E 2sge_E 2sgf_E 2sgp_E 2sgq_E 3sgq_E 1sgp_E 1cso_E 1ct0_E ... Back     alignment and structure
>3i18_A LMO2051 protein; alpha-beta protein, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 1.70A {Listeria monocytogenes} PDB: 2kjk_A 3i1e_A Back     alignment and structure
>2vz5_A TAX1-binding protein 3; WNT signaling pathway, protein binding, nucleus, cytoplasm, PDZ domain; 1.74A {Homo sapiens} PDB: 3dj1_A 3diw_A 2l4s_A 2l4t_A 3gj9_A 2kg2_A 3dj3_A Back     alignment and structure
>2kl1_A YLBL protein; structure genomics, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium; NMR {Geobacillus thermodenitrificans} Back     alignment and structure
>3id1_A Regulator of sigma E protease; hydrolase, cell inner membrane, cell membrane, membrane, metal-binding, metalloprotease, transmembrane; 1.67A {Escherichia coli k-12} PDB: 2zpl_A Back     alignment and structure
>2kjp_A Uncharacterized protein YLBL; mixed alpha-beta protein, cell membrane, hydrolase, membrane, protease, serine protease, transmembrane; NMR {Bacillus subtilis} Back     alignment and structure
>2i6v_A General secretion pathway protein C; EPSC, GSPC, PDZ domain, type 2 secretion system, protein transport, membrane protein; 1.63A {Vibrio cholerae} SCOP: b.36.1.5 Back     alignment and structure
>1uit_A Human discs large 5 protein; PDZ domain, HDLG5, maguk family, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2eaq_A LIM domain only protein 7; conserved hypothetical protein, structural genomics, NPPSFA; 1.46A {Homo sapiens} Back     alignment and structure
>2sga_A Proteinase A; hydrolase (serine proteinase); 1.50A {Streptomyces griseus} SCOP: b.47.1.1 PDB: 1sgc_A 3sga_E* 4sga_E 5sga_E 2sfa_A Back     alignment and structure
>2w4f_A Protein LAP4; structural protein, phosphoprotein, UBL conjugation, leucine-rich repeat, alternative splicing, cytoplasm, circletail, coiled coil; 1.30A {Homo sapiens} Back     alignment and structure
>3cyy_A Tight junction protein ZO-1; protein-ligand complex, cell junction, membrane, phosphoprot domain, tight junction, transmembrane; 2.40A {Homo sapiens} Back     alignment and structure
>2fcf_A Multiple PDZ domain protein; adaptor molecule, protein linker, structural genomics, struc genomics consortium, SGC, structural protein; 1.76A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2zpm_A Regulator of sigma E protease; metalloproteinase, membrane protein, PDZ domain, hydrolase, inner membrane, membrane, metal-binding; HET: MLY MSE; 0.98A {Escherichia coli} PDB: 3id2_A 3id3_A 3id4_A Back     alignment and structure
>2rcz_A Tight junction protein ZO-1; PDZ, domain-swapping, cell junction, membrane, phosphorylati domain, protein binding; 1.70A {Homo sapiens} PDB: 2jwe_A 2osg_A Back     alignment and structure
>2eeh_A PDZ domain-containing protein 7; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x5q_A LAP4 protein; PDZ domain, scribble homolog protein, hscrib, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>3sfj_A TAX1-binding protein 3; PDZ:peptide complex, signaling protein-inhibitor complex; 1.24A {Homo sapiens} PDB: 3dj3_A Back     alignment and structure
>2pkt_A PDZ and LIM domain protein 1; PDZ domain, structural genomics, structural genomics consort unknown function; HET: PG4; 1.50A {Homo sapiens} PDB: 2v1w_A* Back     alignment and structure
>2iwq_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP- 1, membrane, HOST- interaction, structural genomics consortium, synaptosome, T junction; 1.80A {Homo sapiens} Back     alignment and structure
>1wh1_A KIAA1095 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>4fgm_A Aminopeptidase N family protein; structural genomics, PSI-biology, northeast structural genom consortium, NESG, peptidase_M61, PDZ; 2.39A {Idiomarina loihiensis L2TR} Back     alignment and structure
>1qau_A Neuronal nitric oxide synthase (residues 1-130); beta-finger, oxidoreductase; 1.25A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1qav_B Back     alignment and structure
>2dls_A PDZ-rhogef, RHO guanine nucleotide exchange factor 11; PDZ domain, arhgef11, KIAA0380, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2omj_A 2os6_A Back     alignment and structure
>3rle_A Golgi reassembly-stacking protein 2; PDZ, tether, golgin, membrane protein; 1.65A {Homo sapiens} PDB: 4edj_A Back     alignment and structure
>2v90_A PDZ domain-containing protein 3; membrane, protein-binding; 2.00A {Homo sapiens} Back     alignment and structure
>2koj_A Partitioning defective 3 homolog; PDZ domain, structural genomics, alternative splicing, cell cycle, cell division, cell junction, coiled coil; NMR {Mus musculus} PDB: 2ogp_A Back     alignment and structure
>3tsv_A Tight junction protein ZO-1; PDZ, scaffolding, JAM, cell adhesion; 1.99A {Homo sapiens} PDB: 3shu_A Back     alignment and structure
>1uez_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2yub_A LIMK-2, LIM domain kinase 2; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2vsp_A PDZ domain-containing protein 1; membrane, cytoplasm, phosphoprotein, transport protein, CAsp; 2.60A {Homo sapiens} PDB: 2eej_A Back     alignment and structure
>2h2b_A Tight junction protein ZO-1; PDZ domain, phage derived high affinity ligand, cell adhesio; 1.60A {Homo sapiens} PDB: 2h2c_A 2h3m_A 2rrm_A Back     alignment and structure
>1uf1_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1ihj_A INAD; intermolecular disulfide bond, PDZ domain, signaling protein; 1.80A {Drosophila melanogaster} SCOP: b.36.1.1 Back     alignment and structure
>2vwr_A Ligand of NUMB protein X 2; protein-binding, metal-binding, zinc, LNX2_human, zinc-finger, polymorphism, ring finger protein 1; 1.3A {Homo sapiens} Back     alignment and structure
>2kom_A Partitioning defective 3 homolog; PAR-3B, PDZ domain, PSI, structural genomics, alternative splicing, cell cycle, cell division, cell junction; NMR {Homo sapiens} Back     alignment and structure
>2l97_A HTRA, putative serine protease; HTRA-PDZ, protein binding; NMR {Streptococcus pneumoniae} Back     alignment and structure
>1uf1_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2pa1_A PDZ and LIM domain protein 2; PDZ domain, structural genomics, structural genomics consort metal binding protein; 1.70A {Homo sapiens} PDB: 3pdv_A Back     alignment and structure
>2jil_A GRIP1 protein, glutamate receptor interacting protein-1; endoplasmic reticulum, postsynaptic membrane, membrane, MEMB protein; 1.5A {Homo sapiens} Back     alignment and structure
>2uzc_A Human pdlim5, PDZ and LIM domain 5; metal-binding, enigma homolog, phosphorylation, signaling PR LIM domain, PDZ domain; 1.5A {Homo sapiens} Back     alignment and structure
>1zyo_A Serine protease; beta-barrel, glutamyl endopeptidase, hydrolase; 2.40A {Sesbania mosaic virus} Back     alignment and structure
>2hga_A Conserved protein MTH1368; GFT structural genomics, PSI, protein structure initiative; NMR {Methanothermobacterthermautotrophicus} SCOP: b.36.1.6 Back     alignment and structure
>4amh_A Disks large homolog 1; permutation, protein folding, structural protein; 2.30A {Homo sapiens} Back     alignment and structure
>2awx_A Synapse associated protein 97; membrane protein, synaptic signaling, trafficking protein; HET: HIS; 1.80A {Rattus norvegicus} PDB: 2g2l_A 2awu_A 2aww_A 3rl8_A Back     alignment and structure
>2he4_A Na(+)/H(+) exchange regulatory cofactor NHE-RF2; phosphorylation, structural genomics, structural genomics consortium, SGC, unknown function; 1.45A {Homo sapiens} PDB: 2ozf_A Back     alignment and structure
>2opg_A Multiple PDZ domain protein; structural protein, structural genomics, structural genomics consortium, SGC; 1.50A {Homo sapiens} Back     alignment and structure
>2edz_A PDZ domain-containing protein 1; CFTR-associated protein of 70 kDa, Na/PI cotransporter C- terminal-associated protein, NAPI-CAP1; NMR {Mus musculus} Back     alignment and structure
>3bpu_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; structural genomi consortium, SGC, ATP-binding, cell junction; 1.60A {Homo sapiens} Back     alignment and structure
>1m5z_A GRIP, AMPA receptor interacting protein; six beta-strands and two alpha-helices, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 Back     alignment and structure
>2qkv_A Inactivation-NO-after-potential D protein; PDZ domain, scaffolding protein, membrane, sensory transduction, vision; 1.55A {Drosophila melanogaster} PDB: 2qkt_A 2qku_A Back     alignment and structure
>1n7e_A AMPA receptor interacting protein GRIP; PDZ, protein binding; 1.50A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1n7f_A Back     alignment and structure
>2jxo_A Ezrin-radixin-moesin-binding phosphoprotein 50; nherf-1, PDZ domain, PDZ2, acetylation, cell projection, membrane, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>1nf3_C PAR-6B; semi-CRIB motif, switch I and II, PDZ domain, GTPase binding domain, signaling protein; HET: GNP; 2.10A {Mus musculus} SCOP: b.36.1.1 PDB: 2lc6_A 1ry4_A 1x8s_A 2lc7_A 1rzx_A Back     alignment and structure
>2f5y_A Regulator of G-protein signalling 3 isoform 1; PDZ domain, RGS-3, human, structural genomics, structural GE consortium, SGC, signaling protein; 2.39A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1rgw_A ZAsp protein; PDZ, cypher, oracle, muscle, Z-DISK, sarcomere, structural protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 1wjl_A Back     alignment and structure
>1b8q_A Protein (neuronal nitric oxide synthase); PDZ domain, NNOS, nitric oxide synthase, oxidoreductase; NMR {Rattus norvegicus} SCOP: b.36.1.1 Back     alignment and structure
>1vb7_A PDZ and LIM domain 2; PDZ domain PDZ-LIM protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2q3g_A PDZ and LIM domain protein 7; structural genomics, structural genomics consortium, SGC; 1.11A {Homo sapiens} Back     alignment and structure
>2eeg_A PDZ and LIM domain protein 4; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x5n_A Harmonin; PDZ domain, usher syndrome 1C protein, autoimmune enteropathy-related antigen AIE-75 ,antigen NY-CO-38/NY-CO- 37, PDZ-73 protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2kbs_A Back     alignment and structure
>1wf7_A Enigma homologue protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2pzd_A Serine protease HTRA2; PDZ domain, apoptosis, mitochondria, peptid module, hydrolase; 2.75A {Homo sapiens} SCOP: b.36.1.4 Back     alignment and structure
>2i04_A Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1; PDZ, E6 binding, tumor suppressor, peptide binding protein; 2.15A {Mus musculus} Back     alignment and structure
>2la8_A Inactivation-NO-after-potential D protein, KON-TI peptide; peptide binding protein; NMR {Drosophila melanogaster} Back     alignment and structure
>3khf_A Microtubule-associated serine/threonine-protein kinase 3; MAST3, microtubule associated serine/threonine kinase 3, PDZ domain, structural genomics; 1.20A {Homo sapiens} PDB: 2w7r_A 2kqf_A 2kyl_A 3ps4_A Back     alignment and structure
>2fe5_A Presynaptic protein SAP102; PDZ domain, DLG3, human, structural genomics, structural GEN consortium, SGC, structural protein; HET: GOL; 1.10A {Homo sapiens} SCOP: b.36.1.1 PDB: 2x7z_A 2oqs_A 1qlc_A 2i0l_A Back     alignment and structure
>2e7k_A Maguk P55 subfamily member 2; PDZ domain, MPP2 protein, discs large homolog 2, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1um1_A KIAA1849 protein, RSGI RUH-007; PDZ domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>3r68_A Na(+)/H(+) exchange regulatory cofactor NHE-RF3; PDZ domain, adaptor protein, SR-BI, signaling protein; 1.30A {Mus musculus} SCOP: b.36.1.0 PDB: 3r69_A* Back     alignment and structure
>2ejy_A 55 kDa erythrocyte membrane protein; GPC, maguk, PDZ, membrane protein; NMR {Homo sapiens} PDB: 2ev8_A Back     alignment and structure
>2qbw_A PDZ-fibronectin fusion protein; fibronectin PDZ, unknown function; 1.80A {Homo sapiens} PDB: 3ch8_A Back     alignment and structure
>1wif_A RSGI RUH-020, riken cDNA 4930408O21; PDZ domain, structural genomics, mouse cDNA, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>3axa_A Afadin, nectin-3, protein AF-6; PDZ domain, fusion protein, cell adhesion; 2.78A {Mus musculus} PDB: 1xz9_A 2exg_A* 1t2m_A 2ain_A Back     alignment and structure
>1v5l_A PDZ and LIM domain 3; actinin alpha 2 associated LIM protein; PDZ domain, cytoskeleton, actin binding, structural genomics; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>1ujd_A KIAA0559 protein; PDZ domain, structural genomics, human cDNA, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2yt7_A Amyloid beta A4 precursor protein-binding family A member 3; neuron-specific X11L2 protein, neuronal MUNC18-1-interacting protein 3, MINT-3; NMR {Homo sapiens} Back     alignment and structure
>1wi2_A Riken cDNA 2700099C19; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2ego_A General receptor for phosphoinositides 1- associated scaffold protein; PDZ domain, ligand-free, protein binding; 1.80A {Rattus norvegicus} PDB: 2egn_A 2egk_A 2pnt_A Back     alignment and structure
>3ngh_A PDZ domain-containing protein 1; adaptor protein, SR-BI, signaling protein; 1.80A {Mus musculus} SCOP: b.36.1.0 Back     alignment and structure
>1ujv_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics, KIAA0705 protein; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1tp5_A Presynaptic density protein 95; PDZ-peptide ligand complex, peptide binding protein; 1.54A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1tp3_A 1tq3_A 1be9_A 1bfe_A Back     alignment and structure
>2dmz_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>2p3w_A Probable serine protease HTRA3; PDZ domain, phage derived high affinity ligand, protein BIND; 1.70A {Homo sapiens} Back     alignment and structure
>1mfg_A ERB-B2 interacting protein; PDZ domain, protein-peptide complex, erbin., signaling protein; 1.25A {Homo sapiens} SCOP: b.36.1.1 PDB: 1mfl_A Back     alignment and structure
>1ueq_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2jik_A Synaptojanin-2 binding protein; transmembrane, outer membrane, mitochondria distribution, PDZ, membrane, scaffold, mitochondrion, membrane protein; 1.35A {Homo sapiens} PDB: 2jin_A Back     alignment and structure
>1uep_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2jre_A C60-1 PDZ domain peptide; de novo protein; NMR {Synthetic} Back     alignment and structure
>1v5q_A GRIP1 homolog, glutamate receptor interacting protein 1A-L homolog; PDZ domain, cellular signaling, structural genomics; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>3i4w_A Disks large homolog 4; alpha and beta protein, alternative splicing, cell junction, cell membrane, lipoprotein, membrane, palmitate, phosphoprotein; 1.35A {Homo sapiens} SCOP: b.36.1.1 PDB: 3k82_A* 3jxt_A* 2he2_A 1pdr_A 2i0i_A Back     alignment and structure
>3stj_A Protease DEGQ; serine protease, PDZ domain, protease, chaperone, DEGP, DEGQ hydrolase; 2.60A {Escherichia coli} Back     alignment and structure
>2i1n_A Discs, large homolog 3; DLG3, PDZ, PDZ domain, signal transduction, structural genom structural genomics consortium, SGC, signaling protein; 1.85A {Homo sapiens} PDB: 2wl7_A 3rl7_B 1rgr_A* 1kef_A 1zok_A 1iu0_A 1iu2_A Back     alignment and structure
>2o2t_A Multiple PDZ domain protein; structural protein, structural genomics, structural genomics consortium, SGC; 2.70A {Homo sapiens} Back     alignment and structure
>1va8_A Maguk P55 subfamily member 5; PDZ domain, palmitoylated 5, PALS1 protein, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>3i18_A LMO2051 protein; alpha-beta protein, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 1.70A {Listeria monocytogenes} PDB: 2kjk_A 3i1e_A Back     alignment and structure
>2r4h_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; transferase, STRU genomics, structural genomics consortium, SGC, ATP-binding; HET: HIS; 2.05A {Homo sapiens} Back     alignment and structure
>1p3c_A Glutamyl-endopeptidase; serine protease, hydrolase; 1.50A {Bacillus intermedius} SCOP: b.47.1.1 PDB: 1p3e_A Back     alignment and structure
>2q9v_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; Cys Ser mutant, S genomics consortium, SGC, transferase; 2.00A {Homo sapiens} Back     alignment and structure
>1d5g_A Human phosphatase HPTP1E; protein-peptide complex, hydrolase; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 3lnx_A 3lny_A 3pdz_A 1vj6_A 1gm1_A 1ozi_A Back     alignment and structure
>2d90_A PDZ domain containing protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1wf8_A Neurabin-I; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1wfg_A Regulating synaptic membrane exocytosis protein 2; PDZ domain, RAB3-interacting molecule, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2css_A 1zub_A Back     alignment and structure
>2iwn_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP- 1, HOST-virus interaction, structural genomics consortium, synaptosome, tight junction; 1.35A {Homo sapiens} Back     alignment and structure
>2qg1_A Multiple PDZ domain protein; MPDZ, MUPP1, structural genomics, structural genomics consortium, SGC, signaling protein; 1.40A {Homo sapiens} Back     alignment and structure
>2djt_A Unnamed protein product; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kl1_A YLBL protein; structure genomics, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium; NMR {Geobacillus thermodenitrificans} Back     alignment and structure
>2i6v_A General secretion pathway protein C; EPSC, GSPC, PDZ domain, type 2 secretion system, protein transport, membrane protein; 1.63A {Vibrio cholerae} SCOP: b.36.1.5 Back     alignment and structure
>1q7x_A PDZ2B domain of PTP-BAS (HPTP1E); phosphatase, structural proteomics in europe, spine, structural genomics, hydrolase; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1kwa_A Hcask/LIN-2 protein; PDZ domain, neurexin, syndecan, receptor clustering, kinase; 1.93A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2fne_A Multiple PDZ domain protein; structural protein, structural genomics, SGC, structural genomics consortium, unknown function; 1.83A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2kv8_A RGS12, regulator of G-protein signaling 12; PDZ domain, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>2dlu_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>2kjd_A Sodium/hydrogen exchange regulatory cofactor NHE- RF1; PDZ domain, protein, acetylation, cell projection, disease mutation, membrane; NMR {Homo sapiens} Back     alignment and structure
>2byg_A Channel associated protein of synapse-110; DLG2, PDZ, PDZ domain, structural genomics, structural genom consortium, SGC, phosphorylation; 1.85A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2kjp_A Uncharacterized protein YLBL; mixed alpha-beta protein, cell membrane, hydrolase, membrane, protease, serine protease, transmembrane; NMR {Bacillus subtilis} Back     alignment and structure
>3qik_A Phosphatidylinositol 3,4,5-trisphosphate-dependen exchanger 1 protein; PDZ domain, structural genomics consortium, SGC, hydrolase R; 2.29A {Homo sapiens} Back     alignment and structure
>2daz_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>2vsv_A Rhophilin-2; scaffold protein, RHO GTPase binding, protein-binding, RHOB, nitration, cytoplasm, PDZ domain, CAsp8; 1.82A {Homo sapiens} Back     alignment and structure
>2g5m_B Neurabin-2; spinophilin, PDZ domain, CNS, synaptic transmission, protein binding; NMR {Rattus norvegicus} Back     alignment and structure
>2kpk_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; PDZ domain, ATP-binding, cell junction, cell membrane; NMR {Homo sapiens} PDB: 2kpl_A Back     alignment and structure
>3cbz_A Dishevelled-2; PDZ domain, phage derived high affinity ligand, cytoplasm, developmental protein, phosphoprotein, WNT signaling pathway; 1.38A {Homo sapiens} PDB: 3cby_A 3cc0_A 3cbx_A 2rey_A 2f0a_A 1l6o_A 3fy5_A 2kaw_A* 1mc7_A Back     alignment and structure
>1q3o_A Shank1; PDZ, GKAP, peptide binding protein; 1.80A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1q3p_A 3qjm_A 3qjn_A 3o5n_A* Back     alignment and structure
>2iwo_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP-1, HOST-virus interaction, structural genomics consortium, synaptosome, tight junction; 1.7A {Homo sapiens} PDB: 2iwp_A Back     alignment and structure
>2eno_A Synaptojanin-2-binding protein; mitochondrial outer membrane protein 25, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wha_A KIAA0147 protein, scribble; PDZ domain, cellular signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2rcz_A Tight junction protein ZO-1; PDZ, domain-swapping, cell junction, membrane, phosphorylati domain, protein binding; 1.70A {Homo sapiens} PDB: 2jwe_A 2osg_A Back     alignment and structure
>1y7n_A Amyloid beta A4 precursor protein-binding family A member 1; copper chaperone for superoxide dismutase, neuronal adaptor, protein transport; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1n7t_A 99-MER peptide of densin-180-like protein; PDZ domain, C-terminal peptide complex, high affnity ligand, signaling protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2h3l_A Back     alignment and structure
>2edv_A FERM and PDZ domain-containing protein 1; cytoskeletal-associated protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2pa1_A PDZ and LIM domain protein 2; PDZ domain, structural genomics, structural genomics consort metal binding protein; 1.70A {Homo sapiens} PDB: 3pdv_A Back     alignment and structure
>1pq7_A Trypsin; ultra-high resolution, catalysis, hydrolase; HET: ARG; 0.80A {Fusarium oxysporum} SCOP: b.47.1.2 PDB: 1fy4_A 1fy5_A 1gdn_A 1gdq_A 1gdu_A 1ppz_A* 1pq5_A* 1fn8_A* 1pq8_A* 1try_A 1xvm_A 1xvo_A* 2g51_A 2g52_A 2vu8_E 1pqa_A* Back     alignment and structure
>1g9o_A NHE-RF; PDZ domain, complex, signaling protein; 1.50A {Homo sapiens} SCOP: b.36.1.1 PDB: 1i92_A 1gq4_A 1gq5_A 2ocs_A Back     alignment and structure
>1uew_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1whd_A RGS3, regulator of G-protein signaling 3; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>3kzd_A TIAM-1, T-lymphoma invasion and metastasis-inducing prote; PDZ, cell junction, cell adhesion, signaling protein, nucleotide exchange factor; 1.30A {Homo sapiens} PDB: 3kze_A Back     alignment and structure
>3id1_A Regulator of sigma E protease; hydrolase, cell inner membrane, cell membrane, membrane, metal-binding, metalloprotease, transmembrane; 1.67A {Escherichia coli k-12} PDB: 2zpl_A Back     alignment and structure
>1te0_A Protease DEGS; two domains, serine protease, PDZ, alpha-beta protein, hydro; 2.20A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3gdv_A* 3gcn_A* 3gds_A* 3gdu_A* 3gco_A* 1sot_A 1soz_A 1vcw_A 2r3y_A Back     alignment and structure
>2eaq_A LIM domain only protein 7; conserved hypothetical protein, structural genomics, NPPSFA; 1.46A {Homo sapiens} Back     alignment and structure
>1wg6_A Hypothetical protein (riken cDNA 2810455B10); structural genomics, PDZ domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.36.1.1 PDB: 2koh_A 2k1z_A 2k20_A Back     alignment and structure
>1wfv_A Membrane associated guanylate kinase inverted-2; atrophin-1 interacting protein 1, activin receptor interacting protein 1; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1v62_A KIAA1719 protein; structural genomics, synaptic transmission, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>4a8c_A Periplasmic PH-dependent serine endoprotease DEGQ; chaperone, hydrolase; 7.50A {Escherichia coli} PDB: 4a8a_A 4a8b_A 4a9g_A Back     alignment and structure
>1gvz_A Kallikrein-1E2; antigen, prostate specific antigen, hydrolase; 1.42A {Equus caballus} SCOP: b.47.1.2 Back     alignment and structure
>2yuy_A RHO GTPase activating protein 21; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3e17_A Tight junction protein ZO-2; domain swapping, alternative promoter usage, alternative splicing, cell junction, cell membrane, disease mutation; 1.75A {Homo sapiens} Back     alignment and structure
>2dm8_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>3nfk_A Tyrosine-protein phosphatase non-receptor type 4; PDZ-PDZ-binding site complex, protein binding; 1.43A {Homo sapiens} SCOP: b.36.1.1 PDB: 3nfl_A 2vph_A Back     alignment and structure
>1fc6_A Photosystem II D1 protease; D1 C-terminal processing protease, serine protease, serine- lysine catalytic DYAD, PDZ domain, photosynthesis; 1.80A {Scenedesmus obliquus} SCOP: b.36.1.3 c.14.1.2 PDB: 1fc9_A 1fc7_A 1fcf_A Back     alignment and structure
>1uju_A Scribble; PDZ domain, cellular signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2zpm_A Regulator of sigma E protease; metalloproteinase, membrane protein, PDZ domain, hydrolase, inner membrane, membrane, metal-binding; HET: MLY MSE; 0.98A {Escherichia coli} PDB: 3id2_A 3id3_A 3id4_A Back     alignment and structure
>3mfj_A Cationic trypsin; serine proteinase, hydrolase; 0.80A {Bos taurus} PDB: 1aq7_A* 1auj_A* 1bju_A* 1bjv_A* 1az8_A* 1c1o_A 1c1n_A* 1c1q_A* 1c1r_A* 1c1s_A* 1c1t_A* 1c2d_A* 1c2e_A* 1c2f_A* 1c2g_A* 1c2h_A* 1c2i_A* 1c2j_A* 1c2k_A* 1c2l_A ... Back     alignment and structure
>1fxy_A Coagulation factor XA-trypsin chimera; protease, chloromethylketone, hydrolase-hydrolase I complex; HET: 0G6; 2.15A {Homo sapiens} SCOP: b.47.1.2 Back     alignment and structure
>1qav_A Alpha-1 syntrophin (residues 77-171); beta-finger, heterodimer, membrane protein-oxidoreductase CO; 1.90A {Mus musculus} SCOP: b.36.1.1 PDB: 1z86_A 2pdz_A 2vrf_A Back     alignment and structure
>2v90_A PDZ domain-containing protein 3; membrane, protein-binding; 2.00A {Homo sapiens} Back     alignment and structure
>2ehr_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>2db5_A INAD-like protein; PDZ domain, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2dkr_A LIN-7 homolog B; LIN-7B, PDZ, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2pkt_A PDZ and LIM domain protein 1; PDZ domain, structural genomics, structural genomics consort unknown function; HET: PG4; 1.50A {Homo sapiens} PDB: 2v1w_A* Back     alignment and structure
>3gsl_A Disks large homolog 4; PDZ domain, tandem, PSD-95, DLG4, SAP-90, GLUR6, cell juncti membrane, lipoprotein, membrane, palmitate, phosphoprotein; 2.05A {Rattus norvegicus} PDB: 3zrt_A 2ka9_A Back     alignment and structure
>4i8h_A Cationic trypsin, beta-trypsin; serine protease, hydrolase; HET: BEN; 0.75A {Bos taurus} PDB: 1aq7_A* 1auj_A* 1bju_A* 1bjv_A* 1az8_A* 1c1o_A 1c1n_A* 1c1q_A* 1c1r_A* 1c1s_A* 1c1t_A* 1c2d_A* 1c2e_A* 1c2f_A* 1c2g_A* 1c2h_A* 1c2i_A* 1c2j_A* 1c2k_A* 1c2l_A ... Back     alignment and structure
>1uhp_A Hypothetical protein KIAA1095; PDZ domain, semaphorin cytoplasmic domain associated protein, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1hj8_A Trypsin I; hydrolase, radiation damage, disulphide bond breakage, salmon, atomic resolution; HET: BAM; 1.00A {Salmo salar} SCOP: b.47.1.2 PDB: 1utm_A 1utj_A 1utl_M* 1utk_A 1bit_A 2sta_E 1bzx_E 2stb_E 2zpq_A 2zps_A 2tbs_A 2zpr_A 1mbq_A 2eek_A Back     alignment and structure
>2gzv_A PRKCA-binding protein; protein kinase C, PDZ domain, structural genomics, structura genomics consortium, SGC, signaling protein; 1.12A {Homo sapiens} PDB: 2pku_A Back     alignment and structure
>3b76_A E3 ubiquitin-protein ligase LNX; PDZ, bound ligand, structural genomics, structural genomics consortium, SGC, metal-binding; 1.75A {Homo sapiens} Back     alignment and structure
>3cyy_A Tight junction protein ZO-1; protein-ligand complex, cell junction, membrane, phosphoprot domain, tight junction, transmembrane; 2.40A {Homo sapiens} Back     alignment and structure
>2csj_A TJP2 protein; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2i4s_A General secretion pathway protein C; EPSC, GSPC, PDZ domain, type 2 secretion system, protein transport, membrane protein; 1.92A {Vibrio cholerae} SCOP: b.36.1.5 Back     alignment and structure
>1wi4_A Synip, syntaxin binding protein 4; syntaxin4-interacting protein, STXBP4 protein, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>3k1r_A Harmonin; protein-protein complex, alternative splicing, coiled coil, deafness, hearing, non-syndromic deafness, polymorphism; 2.30A {Homo sapiens} PDB: 2kbq_A 2kbr_A 2lsr_A Back     alignment and structure
>2edp_A Fragment, shroom family member 4; APX/shroom family member, KIAA1202 protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2zch_P Prostate-specific antigen; human PSA, kallikrein related peptidases, antibodies, prostate cancer, glycoprotein, hydrolase, polymorphism; HET: NDG; 2.83A {Homo sapiens} PDB: 2zck_P* 2zcl_P* 3qum_P* Back     alignment and structure
>1x6d_A Interleukin-16; PDZ domain, lymphocyte chemoattractant factor (LCF), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.2 Back     alignment and structure
>2vz5_A TAX1-binding protein 3; WNT signaling pathway, protein binding, nucleus, cytoplasm, PDZ domain; 1.74A {Homo sapiens} PDB: 3dj1_A 3diw_A 2l4s_A 2l4t_A 3gj9_A 2kg2_A 3dj3_A Back     alignment and structure
>2d92_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>2uzc_A Human pdlim5, PDZ and LIM domain 5; metal-binding, enigma homolog, phosphorylation, signaling PR LIM domain, PDZ domain; 1.5A {Homo sapiens} Back     alignment and structure
>1ihj_A INAD; intermolecular disulfide bond, PDZ domain, signaling protein; 1.80A {Drosophila melanogaster} SCOP: b.36.1.1 Back     alignment and structure
>1ton_A Tonin; hydrolase(serine proteinase); 1.80A {Rattus rattus} SCOP: b.47.1.2 Back     alignment and structure
>1wh1_A KIAA1095 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2eei_A PDZ domain-containing protein 1; regulatory factor, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3l4f_D SH3 and multiple ankyrin repeat domains protein 1; coiled-coil, PDZ, guanine-nucleotide releasing factor, phosphoprotein, SH3 domain; 2.80A {Rattus norvegicus} Back     alignment and structure
>3pv2_A DEGQ; trypsin fold, PDZ domain, chaperone protease, hydrolase; 2.15A {Legionella fallonii} PDB: 3pv3_A 3pv5_A 3pv4_A Back     alignment and structure
>2jxo_A Ezrin-radixin-moesin-binding phosphoprotein 50; nherf-1, PDZ domain, PDZ2, acetylation, cell projection, membrane, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>2qt5_A Glutamate receptor-interacting protein 1; PDZ-peptide complex, PDZ tandem, alternative splicing, cell junction, cytoplasm; 2.30A {Rattus norvegicus} Back     alignment and structure
>2fcf_A Multiple PDZ domain protein; adaptor molecule, protein linker, structural genomics, struc genomics consortium, SGC, structural protein; 1.76A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>3o46_A Maguk P55 subfamily member 7; PDZ domain, structural genomics consortium, SGC, protein BIN; 1.30A {Homo sapiens} SCOP: b.36.1.0 Back     alignment and structure
>2jil_A GRIP1 protein, glutamate receptor interacting protein-1; endoplasmic reticulum, postsynaptic membrane, membrane, MEMB protein; 1.5A {Homo sapiens} Back     alignment and structure
>1azz_A Collagenase; complex (serine protease/inhibitor), serine protease, inhibitor, complex, protease-substrate interactions, collagen; 2.30A {Celuca pugilator} SCOP: b.47.1.2 Back     alignment and structure
>3soe_A Membrane-associated guanylate kinase, WW and PDZ containing protein 3; structural genomics consortium, SGC, PDZ domain, signaling P; 1.60A {Homo sapiens} Back     alignment and structure
>1npm_A Neuropsin; serine proteinase, glycoprotein; HET: NAG; 2.10A {Mus musculus} SCOP: b.47.1.2 Back     alignment and structure
>2z17_A Pleckstrin homology SEC7 and coiled-coil domains- binding protein; PDZ domain, cytoplasm, membrane, polymorphism, protein binding; 2.70A {Homo sapiens} Back     alignment and structure
>1vae_A Rhophilin 2, rhophilin, RHO GTPase binding protein 2; PDZ domain, intracellular signaling cascade, signal transduction; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>3tsz_A Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffolding, JAM, tight junction, cell adhesio; 2.50A {Homo sapiens} PDB: 3tsw_A 3lh5_A Back     alignment and structure
>2vsp_A PDZ domain-containing protein 1; membrane, cytoplasm, phosphoprotein, transport protein, CAsp; 2.60A {Homo sapiens} PDB: 2eej_A Back     alignment and structure
>2qxi_A Kallikrein-7; S1 pocket, chloromethyl ketone, alternate conformations, alternative splicing, glycoprotein, hydrolase, protease, secreted; HET: K7J; 1.00A {Homo sapiens} PDB: 2qxg_A* 2qxh_A* 2qxj_A* 3bsq_A Back     alignment and structure
>2eeh_A PDZ domain-containing protein 7; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3s9c_A Vipera russelli proteinase RVV-V gamma; serine proteinase, double six-stranded beta-barrels, hydrola glycosylation; HET: NAG BMA BGC GLC; 1.80A {Daboia russellii siamensis} PDB: 3s9b_A* 3s9a_A* 3sbk_A* Back     alignment and structure
>1lo6_A Kallikrein 6, HK6; serine protease, human kallikrein 6, benzamidine, protease, brain serine protease, myelencephalon specific protease, MSP, ZYME; 1.56A {Homo sapiens} SCOP: b.47.1.2 PDB: 1l2e_A 1gvl_A 4d8n_A* Back     alignment and structure
>1vb7_A PDZ and LIM domain 2; PDZ domain PDZ-LIM protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2psx_A Kallikrein-5; zinc inhibition, stratum corneum, glcosylation, hydrolase, H hydrolase inhibitor complex; HET: AR7 NAG; 2.30A {Homo sapiens} PDB: 2psy_A* Back     alignment and structure
>1a7s_A Heparin binding protein; serine protease homolog, endotoxin binding; HET: NAG; 1.12A {Homo sapiens} SCOP: b.47.1.2 PDB: 1ae5_A* 1fy3_A* 1fy1_A* Back     alignment and structure
>1aut_C Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: b.47.1.2 PDB: 3f6u_H* Back     alignment and structure
>1fuj_A PR3, myeloblastin; hydrolase, serine protease, glycoprotein, zymogen, hydrolase protease); HET: NAG FUC; 2.20A {Homo sapiens} SCOP: b.47.1.2 Back     alignment and structure
>4e7n_A Snake-venom thrombin-like enzyme; beta-barrel, hydrolase, arginine esterase, glycosylation, extracellular; HET: NAG; 1.75A {Agkistrodon halys} Back     alignment and structure
>2hga_A Conserved protein MTH1368; GFT structural genomics, PSI, protein structure initiative; NMR {Methanothermobacterthermautotrophicus} SCOP: b.36.1.6 Back     alignment and structure
>1cgh_A Cathepsin G; inflammation, specificity, serine protease, hydrolase-hydrol inhibitor complex; HET: 1ZG; 1.80A {Homo sapiens} SCOP: b.47.1.2 PDB: 1au8_A* 1t32_A* 1kyn_A* Back     alignment and structure
>1um7_A Synapse-associated protein 102; PDZ, discs large homolog 3, DLG3-human presynaptic protein, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1lcy_A HTRA2 serine protease; apoptosis, PDZ domain, caspase activation, binding, hydrolase; 2.00A {Homo sapiens} SCOP: b.36.1.4 b.47.1.1 Back     alignment and structure
>2yub_A LIMK-2, LIM domain kinase 2; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2he4_A Na(+)/H(+) exchange regulatory cofactor NHE-RF2; phosphorylation, structural genomics, structural genomics consortium, SGC, unknown function; 1.45A {Homo sapiens} PDB: 2ozf_A Back     alignment and structure
>1kwa_A Hcask/LIN-2 protein; PDZ domain, neurexin, syndecan, receptor clustering, kinase; 1.93A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>3beu_A Trypsin, SGT; beta sheets, serine protease, hydrolase, zymogen; HET: BEN; 1.05A {Streptomyces griseus} PDB: 3i78_A 3i77_A 2fmj_A 1os8_A 1oss_A 1sgt_A Back     alignment and structure
>3r0h_A INAD, inactivation-NO-after-potential D protein; protein-protein complex, PDZ domain, peptide binding protein; 2.60A {Drosophila melanogaster} Back     alignment and structure
>4ag1_A Chymase; hydrolase-de novo protein complex, inhibitor, serine proteas; 1.40A {Homo sapiens} PDB: 4afs_A 4afu_A 4afz_A* 4afq_A 4ag2_A* 1nn6_A* 1klt_A* 3n7o_A* 1t31_A* 1pjp_A* 2hvx_A* 3s0n_A* 2rdl_A Back     alignment and structure
>3rp2_A RAT MAST cell protease II; serine proteinase; 1.90A {Rattus rattus} SCOP: b.47.1.2 Back     alignment and structure
>2d8i_A T-cell lymphoma invasion and metastasis 1 variant; PDZ domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1iau_A Granzyme B; hydrolase-hydrolase inhibitor complex; HET: ASJ NAG FUC MAN BMA; 2.00A {Homo sapiens} SCOP: b.47.1.2 PDB: 1fq3_A* 1fi8_A 3tk9_A 3tju_A 3tjv_A Back     alignment and structure
>3s69_A Thrombin-like enzyme defibrase; beta-barrel, serine enzymes, fibrinogen binding, glycosylati hydrolase; 1.43A {Gloydius saxatilis} PDB: 1op2_A* 1op0_A* 4gso_A 1bqy_A* Back     alignment and structure
>1ueq_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2iwq_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP- 1, membrane, HOST- interaction, structural genomics consortium, synaptosome, T junction; 1.80A {Homo sapiens} Back     alignment and structure
>2xw9_A Complement factor D; immune system, hydrolase, serine protease, alternative pathw; HET: GOL; 1.20A {Homo sapiens} PDB: 2xwb_I* 1bio_A 1dfp_A* 1dic_A* 1dsu_A 1hfd_A 4d9r_A 1fdp_A 2xwa_A 1dst_A 4d9q_A Back     alignment and structure
>3bpu_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; structural genomi consortium, SGC, ATP-binding, cell junction; 1.60A {Homo sapiens} Back     alignment and structure
>3sfj_A TAX1-binding protein 3; PDZ:peptide complex, signaling protein-inhibitor complex; 1.24A {Homo sapiens} PDB: 3dj3_A Back     alignment and structure
>2koj_A Partitioning defective 3 homolog; PDZ domain, structural genomics, alternative splicing, cell cycle, cell division, cell junction, coiled coil; NMR {Mus musculus} PDB: 2ogp_A Back     alignment and structure
>1p1d_A PDZ45, glutamate receptor interacting protein; PDZ domain, tandem repeats, scaffold protein, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 b.36.1.1 PDB: 1p1e_A 1x5r_A Back     alignment and structure
>2q3g_A PDZ and LIM domain protein 7; structural genomics, structural genomics consortium, SGC; 1.11A {Homo sapiens} Back     alignment and structure
>3fzz_A Granzyme C; hydrolase, cytolysis, protease, serine protease, zymogen; 2.50A {Mus musculus} SCOP: b.47.1.2 PDB: 3g01_A Back     alignment and structure
>3cbz_A Dishevelled-2; PDZ domain, phage derived high affinity ligand, cytoplasm, developmental protein, phosphoprotein, WNT signaling pathway; 1.38A {Homo sapiens} PDB: 3cby_A 3cc0_A 3cbx_A 2rey_A 2f0a_A 1l6o_A 3fy5_A 2kaw_A* 1mc7_A Back     alignment and structure
>4e34_A Golgi-associated PDZ and coiled-coil motif-contai protein; PDZ-peptide complex, protein transport-inhibitor complex; 1.40A {Homo sapiens} PDB: 4e35_A Back     alignment and structure
>2bdg_A Kallikrein-4; serine proteinase, S1 subsite, 70-80 loop, structural proteo europe, spine, structural genomics, hydrolase; HET: PBZ; 1.95A {Homo sapiens} PDB: 2bdh_A* 2bdi_A* Back     alignment and structure
>1ao5_A Glandular kallikrein-13; serine protease, protein maturation; HET: NAG; 2.60A {Mus musculus} SCOP: b.47.1.2 PDB: 1sgf_G* Back     alignment and structure
>2aiq_A Protein C activator; snake venom serine proteinase, hydrolas; HET: NAG NDG; 1.54A {Agkistrodon contortrix contortrix} PDB: 2aip_A* Back     alignment and structure
>2kom_A Partitioning defective 3 homolog; PAR-3B, PDZ domain, PSI, structural genomics, alternative splicing, cell cycle, cell division, cell junction; NMR {Homo sapiens} Back     alignment and structure
>2krg_A Na(+)/H(+) exchange regulatory cofactor NHE-RF1; acetylation, cell projection, disease mutation, membrane, phosphoprotein, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>3egg_C Spinophilin; PP1, serine/threonine phosphatase, post synapti density, glutametergic receptors, carbohydrate metabolism, cycle, cell division; HET: MES; 1.85A {Rattus norvegicus} PDB: 3egh_C* 3hvq_C 2fn5_A Back     alignment and structure
>1v5l_A PDZ and LIM domain 3; actinin alpha 2 associated LIM protein; PDZ domain, cytoskeleton, actin binding, structural genomics; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>1sgf_A 7S NGF, nerve growth factor; growth factor (beta-NGF), hydrolase - serine proteinase (GAM inactive serine proteinase (alpha-NGF); HET: NAG NDG; 3.15A {Mus musculus} SCOP: b.47.1.2 Back     alignment and structure
>2i04_A Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1; PDZ, E6 binding, tumor suppressor, peptide binding protein; 2.15A {Mus musculus} Back     alignment and structure
>3tsv_A Tight junction protein ZO-1; PDZ, scaffolding, JAM, cell adhesion; 1.99A {Homo sapiens} PDB: 3shu_A Back     alignment and structure
>3shw_A Tight junction protein ZO-1; PDZ-SH3-GUK supramodule, cell adhesion; 2.90A {Homo sapiens} Back     alignment and structure
>3khf_A Microtubule-associated serine/threonine-protein kinase 3; MAST3, microtubule associated serine/threonine kinase 3, PDZ domain, structural genomics; 1.20A {Homo sapiens} PDB: 2w7r_A 2kqf_A 2kyl_A 3ps4_A Back     alignment and structure
>3hpk_A Protein interacting with PRKCA 1; oxidized, PDZ domain, kinase, protein binding; 2.20A {Rattus norvegicus} PDB: 3hpm_A Back     alignment and structure
>2fne_A Multiple PDZ domain protein; structural protein, structural genomics, SGC, structural genomics consortium, unknown function; 1.83A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1g9o_A NHE-RF; PDZ domain, complex, signaling protein; 1.50A {Homo sapiens} SCOP: b.36.1.1 PDB: 1i92_A 1gq4_A 1gq5_A 2ocs_A Back     alignment and structure
>2cs5_A Tyrosine-protein phosphatase, non-receptor type 4; PDZ domain, ptpase, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2z7f_E Leukocyte elastase; serine protease, serine protease inhibitor, disease mutation glycoprotein, hydrolase, zymogen, secreted; HET: NAG FUC; 1.70A {Homo sapiens} SCOP: b.47.1.2 PDB: 1h1b_A* 1ppg_E* 1ppf_E* 3q76_A* 3q77_A* 1hne_E 2rg3_A* 1b0f_A* Back     alignment and structure
>3ncl_A Suppressor of tumorigenicity 14 protein; proteinase-inhibitor complex, serine proteinase, benzamidine phosphonate, serine endopeptidases; HET: CCZ; 1.19A {Homo sapiens} SCOP: b.47.1.2 PDB: 3bn9_B* 3nps_A 3so3_A* 1eax_A 1eaw_A 2gv6_A* 2gv7_A* 3p8g_A* 3p8f_A* Back     alignment and structure
>2byg_A Channel associated protein of synapse-110; DLG2, PDZ, PDZ domain, structural genomics, structural genom consortium, SGC, phosphorylation; 1.85A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1qau_A Neuronal nitric oxide synthase (residues 1-130); beta-finger, oxidoreductase; 1.25A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1qav_B Back     alignment and structure
>1spj_A Kallikrein 1; serine protease, KLK1, HK1, hydrolase; HET: NAG; 1.70A {Homo sapiens} Back     alignment and structure
>3cp7_A Alkaline serine protease Al20; trypsin-like, hydrolase; 1.39A {Nesterenkonia abyssinica} Back     alignment and structure
>1v6b_A Harmonin isoform A1; structural genomics, usher syndrome, USH1, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>1eq9_A Chymotrypsin; FIRE ANT, serine proteinase, hydrolase; HET: PMS; 1.70A {Solenopsis invicta} SCOP: b.47.1.2 Back     alignment and structure
>2jre_A C60-1 PDZ domain peptide; de novo protein; NMR {Synthetic} Back     alignment and structure
>1uep_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2w4f_A Protein LAP4; structural protein, phosphoprotein, UBL conjugation, leucine-rich repeat, alternative splicing, cytoplasm, circletail, coiled coil; 1.30A {Homo sapiens} Back     alignment and structure
>1bru_P Elastase, PPE; serine protease, hydrolase; HET: 1NB; 2.30A {Sus scrofa} SCOP: b.47.1.2 Back     alignment and structure
>1d5g_A Human phosphatase HPTP1E; protein-peptide complex, hydrolase; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 3lnx_A 3lny_A 3pdz_A 1vj6_A 1gm1_A 1ozi_A Back     alignment and structure
>1gvk_B Elastase 1, peptide inhibitor; hydrolase, serine protease, catalytic intermediate, atomic resolution, hydrolase-hydrolase inhibitor complex; 0.94A {Sus scrofa} SCOP: b.47.1.2 PDB: 1bma_A* 1b0e_A* 1e34_B* 1e35_B* 1e36_B* 1e37_B* 1e38_B* 1eas_A* 1eat_A* 1eau_A* 1ela_A* 1elb_A* 1elc_A* 1eld_E* 1ele_E* 1elf_A* 1elg_A* 1esa_A 1esb_A* 1est_A* ... Back     alignment and structure
>2vsv_A Rhophilin-2; scaffold protein, RHO GTPase binding, protein-binding, RHOB, nitration, cytoplasm, PDZ domain, CAsp8; 1.82A {Homo sapiens} Back     alignment and structure
>2ego_A General receptor for phosphoinositides 1- associated scaffold protein; PDZ domain, ligand-free, protein binding; 1.80A {Rattus norvegicus} PDB: 2egn_A 2egk_A 2pnt_A Back     alignment and structure
>1rgw_A ZAsp protein; PDZ, cypher, oracle, muscle, Z-DISK, sarcomere, structural protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 1wjl_A Back     alignment and structure
>1mza_A Pro-granzyme K; apoptosis, serine protease, S1 family, hydrolase; 2.23A {Homo sapiens} SCOP: b.47.1.2 PDB: 1mzd_A Back     alignment and structure
>3gov_B MAsp-1; complement, serine protease, beta barrel, hydrolase, hydroxy immune response, innate immunity, sushi, coagulation, compl pathway; 2.55A {Homo sapiens} SCOP: b.47.1.0 PDB: 4djz_B Back     alignment and structure
>2yt7_A Amyloid beta A4 precursor protein-binding family A member 3; neuron-specific X11L2 protein, neuronal MUNC18-1-interacting protein 3, MINT-3; NMR {Homo sapiens} Back     alignment and structure
>1ujv_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics, KIAA0705 protein; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2hlc_A Collagenase; serine protease, hydrolase, collagen degradation; 1.70A {Hypoderma lineatum} SCOP: b.47.1.2 PDB: 1hyl_A Back     alignment and structure
>1v5q_A GRIP1 homolog, glutamate receptor interacting protein 1A-L homolog; PDZ domain, cellular signaling, structural genomics; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>1x5n_A Harmonin; PDZ domain, usher syndrome 1C protein, autoimmune enteropathy-related antigen AIE-75 ,antigen NY-CO-38/NY-CO- 37, PDZ-73 protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2kbs_A Back     alignment and structure
>2dc2_A GOPC, golgi associated PDZ and coiled-coil motif containing isoform B; GOPC PDZ domain, structural protein; NMR {Homo sapiens} Back     alignment and structure
>3h7t_A Group 3 allergen smipp-S YVT004A06; hydrolase; 2.00A {Sarcoptes scabiei type hominis} Back     alignment and structure
>2fe5_A Presynaptic protein SAP102; PDZ domain, DLG3, human, structural genomics, structural GEN consortium, SGC, structural protein; HET: GOL; 1.10A {Homo sapiens} SCOP: b.36.1.1 PDB: 2x7z_A 2oqs_A 1qlc_A 2i0l_A Back     alignment and structure
>1elt_A Elastase; serine proteinase; 1.61A {Salmo salar} SCOP: b.47.1.2 Back     alignment and structure
>2r0l_A Hepatocyte growth factor activator; serine protease, antibody, allosteric inhibitor, EGF-like DO glycoprotein, hydrolase, kringle, secreted; HET: NAG BMA; 2.20A {Homo sapiens} PDB: 3k2u_A* 2wub_A* 2wuc_A* Back     alignment and structure
>1x5q_A LAP4 protein; PDZ domain, scribble homolog protein, hscrib, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2ejy_A 55 kDa erythrocyte membrane protein; GPC, maguk, PDZ, membrane protein; NMR {Homo sapiens} PDB: 2ev8_A Back     alignment and structure
>1wi4_A Synip, syntaxin binding protein 4; syntaxin4-interacting protein, STXBP4 protein, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>1wfg_A Regulating synaptic membrane exocytosis protein 2; PDZ domain, RAB3-interacting molecule, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2css_A 1zub_A Back     alignment and structure
>2o2t_A Multiple PDZ domain protein; structural protein, structural genomics, structural genomics consortium, SGC; 2.70A {Homo sapiens} Back     alignment and structure
>3mhw_U Urokinase-type plasminogen activator; hydrolase, blood coagulation, fibrinolysis, plasminogen activation; HET: ABV; 1.45A {Homo sapiens} SCOP: b.47.1.2 PDB: 1w10_U* 1w11_U* 1w12_U* 1w13_U* 1w14_U* 1w0z_U* 2vip_A* 1f5k_U 1f5l_A* 1f92_A* 2r2w_U* 2vin_A* 2vio_A* 1ejn_A* 2viq_A* 2viv_A* 2viw_A* 1vja_U* 1vj9_U* 1sc8_U* ... Back     alignment and structure
>1i16_A Interleukin 16, LCF; cytokine, lymphocyte chemoattractant factor, PDZ domain; NMR {Homo sapiens} SCOP: b.36.1.2 Back     alignment and structure
>2kjd_A Sodium/hydrogen exchange regulatory cofactor NHE- RF1; PDZ domain, protein, acetylation, cell projection, disease mutation, membrane; NMR {Homo sapiens} Back     alignment and structure
>1si5_H Scatter factor, hepatocyte growth factor, SF, hepatopoeitin A, LUNG; chymotrypsin homology, hormone/growth factor complex; 2.53A {Homo sapiens} SCOP: b.47.1.2 PDB: 1shy_A Back     alignment and structure
>1t8o_A Chymotrypsin A; chymotrypsin, serine proteinase, BPTI, protein-protein interaction, non-cognate binding, S1 pocket, primary specificity; 1.70A {Bos taurus} SCOP: b.47.1.2 PDB: 1cgi_E 1cgj_E 1chg_A 1ex3_A 1acb_E 1gl0_E 1gl1_A 1gcd_A* 1oxg_A 1k2i_1 1p2n_A 1p2o_A 1p2q_A 1t7c_A 1t8l_A 1t8m_A 1t8n_A 1p2m_A 2cga_A 2y6t_A ... Back     alignment and structure
>2dmz_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>2jkh_A Activated factor XA heavy chain; plasma, calcium, zymogen, secreted, protease, hydrolase, polymorphism, glycoprotein, gamma-carboxyglutamic acid; HET: BI7; 1.25A {Homo sapiens} PDB: 2bok_A* 2vvc_A* 2vvu_A* 2vvv_A* 2vwl_A* 2vwm_A* 2vwn_A* 2vwo_A* 2xbv_A* 1c5m_D 2vh0_A* 1ezq_A* 1f0s_A* 1ksn_A* 1f0r_A* 1lpk_B* 1lpz_B* 1lqd_B* 1nfu_A* 1nfw_A* ... Back     alignment and structure
>1ujd_A KIAA0559 protein; PDZ domain, structural genomics, human cDNA, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1n7e_A AMPA receptor interacting protein GRIP; PDZ, protein binding; 1.50A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1n7f_A Back     alignment and structure
>1wi2_A Riken cDNA 2700099C19; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2d90_A PDZ domain containing protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2edz_A PDZ domain-containing protein 1; CFTR-associated protein of 70 kDa, Na/PI cotransporter C- terminal-associated protein, NAPI-CAP1; NMR {Mus musculus} Back     alignment and structure
>2f91_A Hepatopancreas trypsin; trypsin, canonical inhibitor, atomic resolution, hydrolase/hydrolase inhibitor complex; 1.20A {Pontastacus leptodactylus} SCOP: b.47.1.2 Back     alignment and structure
>3o46_A Maguk P55 subfamily member 7; PDZ domain, structural genomics consortium, SGC, protein BIN; 1.30A {Homo sapiens} SCOP: b.36.1.0 Back     alignment and structure
>2i1n_A Discs, large homolog 3; DLG3, PDZ, PDZ domain, signal transduction, structural genom structural genomics consortium, SGC, signaling protein; 1.85A {Homo sapiens} PDB: 2wl7_A 3rl7_B 1rgr_A* 1kef_A 1zok_A 1iu0_A 1iu2_A Back     alignment and structure
>2f5y_A Regulator of G-protein signalling 3 isoform 1; PDZ domain, RGS-3, human, structural genomics, structural GE consortium, SGC, signaling protein; 2.39A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1uew_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2r4h_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; transferase, STRU genomics, structural genomics consortium, SGC, ATP-binding; HET: HIS; 2.05A {Homo sapiens} Back     alignment and structure
>2d92_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>2asu_B Hepatocyte growth factor-like protein; serine proteinase, beta-chain, MSP, HGFL, hydrolase; 1.85A {Homo sapiens} Back     alignment and structure
>1r6j_A Syntenin 1; PDZ, membrane protein; 0.73A {Homo sapiens} SCOP: b.36.1.1 PDB: 1nte_A 1obx_A 1oby_A Back     alignment and structure
>2q9v_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; Cys Ser mutant, S genomics consortium, SGC, transferase; 2.00A {Homo sapiens} Back     alignment and structure
>1euf_A Duodenase; serine protease, dual specificity, hydrola; HET: NAG; 2.40A {Bos taurus} SCOP: b.47.1.2 Back     alignment and structure
>3k50_A Putative S41 protease; structural genomics, joint center for structural genomics, JCSG, protein structure initiative; 2.00A {Bacteroides fragilis nctc 9343} Back     alignment and structure
>1orf_A Granzyme A; hydrolase-hydrolase inhibitor complex; HET: 0G6; 2.40A {Homo sapiens} SCOP: b.47.1.2 PDB: 1op8_A Back     alignment and structure
>3r68_A Na(+)/H(+) exchange regulatory cofactor NHE-RF3; PDZ domain, adaptor protein, SR-BI, signaling protein; 1.30A {Mus musculus} SCOP: b.36.1.0 PDB: 3r69_A* Back     alignment and structure
>2djt_A Unnamed protein product; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2h2b_A Tight junction protein ZO-1; PDZ domain, phage derived high affinity ligand, cell adhesio; 1.60A {Homo sapiens} PDB: 2h2c_A 2h3m_A 2rrm_A Back     alignment and structure
>2jik_A Synaptojanin-2 binding protein; transmembrane, outer membrane, mitochondria distribution, PDZ, membrane, scaffold, mitochondrion, membrane protein; 1.35A {Homo sapiens} PDB: 2jin_A Back     alignment and structure
>2opg_A Multiple PDZ domain protein; structural protein, structural genomics, structural genomics consortium, SGC; 1.50A {Homo sapiens} Back     alignment and structure
>1mfg_A ERB-B2 interacting protein; PDZ domain, protein-peptide complex, erbin., signaling protein; 1.25A {Homo sapiens} SCOP: b.36.1.1 PDB: 1mfl_A Back     alignment and structure
>3ngh_A PDZ domain-containing protein 1; adaptor protein, SR-BI, signaling protein; 1.80A {Mus musculus} SCOP: b.36.1.0 Back     alignment and structure
>1va8_A Maguk P55 subfamily member 5; PDZ domain, palmitoylated 5, PALS1 protein, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2eeg_A PDZ and LIM domain protein 4; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kpk_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; PDZ domain, ATP-binding, cell junction, cell membrane; NMR {Homo sapiens} PDB: 2kpl_A Back     alignment and structure
>3gge_A PDZ domain-containing protein GIPC2; structural genomics, structural genomics consort protein binding; 2.60A {Homo sapiens} Back     alignment and structure
>2awx_A Synapse associated protein 97; membrane protein, synaptic signaling, trafficking protein; HET: HIS; 1.80A {Rattus norvegicus} PDB: 2g2l_A 2awu_A 2aww_A 3rl8_A Back     alignment and structure
>3mmg_A Nuclear inclusion protein A; 3C-type protease, TEV, TVMV, viral protein, hydrolase; 1.70A {Tobacco vein mottling virus} SCOP: b.47.1.0 Back     alignment and structure
>1wha_A KIAA0147 protein, scribble; PDZ domain, cellular signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>3axa_A Afadin, nectin-3, protein AF-6; PDZ domain, fusion protein, cell adhesion; 2.78A {Mus musculus} PDB: 1xz9_A 2exg_A* 1t2m_A 2ain_A Back     alignment and structure
>4amh_A Disks large homolog 1; permutation, protein folding, structural protein; 2.30A {Homo sapiens} Back     alignment and structure
>1vae_A Rhophilin 2, rhophilin, RHO GTPase binding protein 2; PDZ domain, intracellular signaling cascade, signal transduction; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2e7k_A Maguk P55 subfamily member 2; PDZ domain, MPP2 protein, discs large homolog 2, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1m9u_A Earthworm fibrinolytic enzyme; hydrolase, serine protease (elastase-like); 2.30A {Eisenia fetida} SCOP: b.47.1.2 Back     alignment and structure
>2wph_S Coagulation factor IXA heavy chain; serine protease, zymogen, hydrolase, glycoprotein, hydroxylation, phosphoprotein, sulfation, hemostasis; HET: DPN 1PE; 1.50A {Homo sapiens} PDB: 2wpj_S* 2wpk_S* 2wpl_S* 2wpi_S* 2wpm_S 3lc3_A* 1rfn_A* 3lc5_A* 3kcg_H* 1x7a_C* 1pfx_C* Back     alignment and structure
>2vwr_A Ligand of NUMB protein X 2; protein-binding, metal-binding, zinc, LNX2_human, zinc-finger, polymorphism, ring finger protein 1; 1.3A {Homo sapiens} Back     alignment and structure
>2any_A Kininogenin, plasma kallikrein, light chain, fletcher factor; mutagenically deglycosyalted human plasma kallikrein protease domain; HET: BAM; 1.40A {Homo sapiens} PDB: 2anw_A* Back     alignment and structure
>2oq5_A Transmembrane protease, serine 11E; type II trans-membrane serine proteinases, trypsin-like serine protease, tumor marker, hydrolase; 1.61A {Homo sapiens} Back     alignment and structure
>1q3o_A Shank1; PDZ, GKAP, peptide binding protein; 1.80A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1q3p_A 3qjm_A 3qjn_A 3o5n_A* Back     alignment and structure
>1yc0_A Hepatocyte growth factor activator; hydrolase/inhibitor, hydrolase-inhibitor complex; 2.60A {Homo sapiens} PDB: 1ybw_A 2r0k_A Back     alignment and structure
>1wf7_A Enigma homologue protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>3h7o_A Group 3 allergen smipp-S YV6023A04; hydrolase; 1.85A {Sarcoptes scabiei type hominis} SCOP: b.47.1.0 Back     alignment and structure
>1b8q_A Protein (neuronal nitric oxide synthase); PDZ domain, NNOS, nitric oxide synthase, oxidoreductase; NMR {Rattus norvegicus} SCOP: b.36.1.1 Back     alignment and structure
>3tvj_B Mannan-binding lectin serine protease 2 B chain; in vitro evolution, specific inhibitor, allostery, hydrolase; 1.28A {Homo sapiens} PDB: 4fxg_H* Back     alignment and structure
>1v62_A KIAA1719 protein; structural genomics, synaptic transmission, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1nf3_C PAR-6B; semi-CRIB motif, switch I and II, PDZ domain, GTPase binding domain, signaling protein; HET: GNP; 2.10A {Mus musculus} SCOP: b.36.1.1 PDB: 2lc6_A 1ry4_A 1x8s_A 2lc7_A 1rzx_A Back     alignment and structure
>2lob_A Golgi-associated PDZ and coiled-coil motif-contai protein; structural protein-hydrolase complex, peptide binding protei; NMR {Homo sapiens} Back     alignment and structure
>2kv8_A RGS12, regulator of G-protein signaling 12; PDZ domain, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>3f1s_B Vitamin K-dependent protein Z; PZ, ZPI, complex, serpin, protease inhibitor, protease, GLYC secreted, serine protease inhibitor, blood coagulation; HET: FLC NAG; 2.30A {Homo sapiens} Back     alignment and structure
>1ufx_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>3gyl_B Prostasin; ENAC, zymogen, divalent cation, channel activatin membrane, disulfide bond, glycoprotein, hydrolase, membrane protease, secreted; 1.30A {Homo sapiens} PDB: 3gym_A 3e16_B* 3e0p_B* 3e0n_B* 3e1x_B 3fvf_B* 3dfj_A 3dfl_A* Back     alignment and structure
>1wif_A RSGI RUH-020, riken cDNA 4930408O21; PDZ domain, structural genomics, mouse cDNA, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>1uhp_A Hypothetical protein KIAA1095; PDZ domain, semaphorin cytoplasmic domain associated protein, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>3bg8_A Coagulation factor XIA light chain; protease inhibitor, factor XIA inhibitor complex, covalent inhibitor, alternative splicing, blood coagulation; HET: INH; 1.60A {Homo sapiens} PDB: 3sor_A* 3sos_A* 1zsl_A* 1zpz_A* 1zrk_A* 1xx9_A* 1zjd_A 1zhr_A 1zmj_A* 1zml_A* 1zmn_A* 1zom_A* 1zpb_A* 1zpc_A* 1zsj_A* 1zsk_A* 1ztj_A* 1ztk_A* 1ztl_A* 2fda_A* ... Back     alignment and structure
>1x6d_A Interleukin-16; PDZ domain, lymphocyte chemoattractant factor (LCF), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.2 Back     alignment and structure
>1uit_A Human discs large 5 protein; PDZ domain, HDLG5, maguk family, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2db5_A INAD-like protein; PDZ domain, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1pyt_D TC, PCPA-TC, chymotrypsinogen C; ternary complex (zymogen), serine proteinase, C-terminal peptidase; 2.35A {Bos taurus} SCOP: b.47.1.2 Back     alignment and structure
>2dls_A PDZ-rhogef, RHO guanine nucleotide exchange factor 11; PDZ domain, arhgef11, KIAA0380, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2omj_A 2os6_A Back     alignment and structure
>2iwn_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP- 1, HOST-virus interaction, structural genomics consortium, synaptosome, tight junction; 1.35A {Homo sapiens} Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure
>1q7x_A PDZ2B domain of PTP-BAS (HPTP1E); phosphatase, structural proteomics in europe, spine, structural genomics, hydrolase; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2bz6_H Blood coagulation factor VIIA; serine protease, enzyme complex, hydrolase; HET: 346; 1.6A {Homo sapiens} SCOP: b.47.1.2 PDB: 1cvw_H* 1dva_H* 1fak_H* 1j9c_H* 1jbu_H 1dan_H 1klj_H 1o5d_H* 1qfk_H* 1w0y_H* 1w2k_H* 1w7x_H* 1w8b_H* 1wqv_H* 1wss_H* 1wtg_H* 1wun_H* 1wv7_H* 1ygc_H* 1z6j_H* ... Back     alignment and structure
>1uez_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>3k1r_A Harmonin; protein-protein complex, alternative splicing, coiled coil, deafness, hearing, non-syndromic deafness, polymorphism; 2.30A {Homo sapiens} PDB: 2kbq_A 2kbr_A 2lsr_A Back     alignment and structure
>2eno_A Synaptojanin-2-binding protein; mitochondrial outer membrane protein 25, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2qy0_B Complement C1R subcomponent; serine protease, beta barrel, complement pathway like domain, glycoprotein, hydrolase, hydroxylation, immune response; 2.60A {Homo sapiens} SCOP: b.47.1.2 Back     alignment and structure
>1i16_A Interleukin 16, LCF; cytokine, lymphocyte chemoattractant factor, PDZ domain; NMR {Homo sapiens} SCOP: b.36.1.2 Back     alignment and structure
>3e17_A Tight junction protein ZO-2; domain swapping, alternative promoter usage, alternative splicing, cell junction, cell membrane, disease mutation; 1.75A {Homo sapiens} Back     alignment and structure
>3qik_A Phosphatidylinositol 3,4,5-trisphosphate-dependen exchanger 1 protein; PDZ domain, structural genomics consortium, SGC, hydrolase R; 2.29A {Homo sapiens} Back     alignment and structure
>1y8t_A Hypothetical protein RV0983; serine protease, structural genomics, PSI, protein structure initiative; 2.00A {Mycobacterium tuberculosis} SCOP: b.36.1.4 b.47.1.1 PDB: 2z9i_A Back     alignment and structure
>3b76_A E3 ubiquitin-protein ligase LNX; PDZ, bound ligand, structural genomics, structural genomics consortium, SGC, metal-binding; 1.75A {Homo sapiens} Back     alignment and structure
>2dm8_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>2yuy_A RHO GTPase activating protein 21; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>4dgj_A Enteropeptidase catalytic light chain; serine protease, hydrolase; 1.90A {Homo sapiens} PDB: 1ekb_B Back     alignment and structure
>1m5z_A GRIP, AMPA receptor interacting protein; six beta-strands and two alpha-helices, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 Back     alignment and structure
>1whd_A RGS3, regulator of G-protein signaling 3; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2zgc_A Granzyme M; serine protease, cytolysis, glycoprotein, hydrolase, secrete zymogen; 1.96A {Homo sapiens} PDB: 2zgh_A 2zks_A 2zgj_A Back     alignment and structure
>1ym0_A Fibrinotic enzyme component B; two chains, glycosylation, pyroglutamation, eight-membered R peptide bond, hydrolase; HET: NAG MAN FUC; 2.06A {Eisenia fetida} Back     alignment and structure
>1y7n_A Amyloid beta A4 precursor protein-binding family A member 1; copper chaperone for superoxide dismutase, neuronal adaptor, protein transport; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2iwo_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP-1, HOST-virus interaction, structural genomics consortium, synaptosome, tight junction; 1.7A {Homo sapiens} PDB: 2iwp_A Back     alignment and structure
>2g5m_B Neurabin-2; spinophilin, PDZ domain, CNS, synaptic transmission, protein binding; NMR {Rattus norvegicus} Back     alignment and structure
>1ddj_A Plasminogen; catalytic domain, blood clotting; 2.00A {Homo sapiens} SCOP: b.47.1.2 PDB: 1bml_A 1l4d_A 1l4z_A 1bui_A* 1rjx_B 1qrz_A Back     alignment and structure
>1n7t_A 99-MER peptide of densin-180-like protein; PDZ domain, C-terminal peptide complex, high affnity ligand, signaling protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2h3l_A Back     alignment and structure
>2qg1_A Multiple PDZ domain protein; MPDZ, MUPP1, structural genomics, structural genomics consortium, SGC, signaling protein; 1.40A {Homo sapiens} Back     alignment and structure
>1um1_A KIAA1849 protein, RSGI RUH-007; PDZ domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2dkr_A LIN-7 homolog B; LIN-7B, PDZ, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dlu_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>1ky9_A Protease DO, DEGP, HTRA; protein quality control, serine protease, trypsin, chaperone, PDZ, ATP-independent, temperature-regulated, periplasm; 2.80A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3ou0_A 4a8d_A 3otp_A 3mh7_A 3mh4_A 3mh5_A* 3mh6_A* 3cs0_A 2zle_A Back     alignment and structure
>1wg6_A Hypothetical protein (riken cDNA 2810455B10); structural genomics, PDZ domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.36.1.1 PDB: 2koh_A 2k1z_A 2k20_A Back     alignment and structure
>1w9e_A Syntenin 1; cell adhesion, adhesion/complex, PDZ domain, scaffolding protein signaling protein; 1.56A {Homo sapiens} SCOP: b.36.1.1 b.36.1.1 PDB: 1n99_A 1v1t_A 1obz_A 1w9o_A 1w9q_A 1ybo_A Back     alignment and structure
>2gzv_A PRKCA-binding protein; protein kinase C, PDZ domain, structural genomics, structura genomics consortium, SGC, signaling protein; 1.12A {Homo sapiens} PDB: 2pku_A Back     alignment and structure
>2edp_A Fragment, shroom family member 4; APX/shroom family member, KIAA1202 protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wf8_A Neurabin-I; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2qkv_A Inactivation-NO-after-potential D protein; PDZ domain, scaffolding protein, membrane, sensory transduction, vision; 1.55A {Drosophila melanogaster} PDB: 2qkt_A 2qku_A Back     alignment and structure
>3nfk_A Tyrosine-protein phosphatase non-receptor type 4; PDZ-PDZ-binding site complex, protein binding; 1.43A {Homo sapiens} SCOP: b.36.1.1 PDB: 3nfl_A 2vph_A Back     alignment and structure
>1qav_A Alpha-1 syntrophin (residues 77-171); beta-finger, heterodimer, membrane protein-oxidoreductase CO; 1.90A {Mus musculus} SCOP: b.36.1.1 PDB: 1z86_A 2pdz_A 2vrf_A Back     alignment and structure
>3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} Back     alignment and structure
>2z17_A Pleckstrin homology SEC7 and coiled-coil domains- binding protein; PDZ domain, cytoplasm, membrane, polymorphism, protein binding; 2.70A {Homo sapiens} Back     alignment and structure
>1rtf_B (TC)-T-PA, two chain tissue plasminogen activator; serine protease, fibrinolytic enzymes; HET: BEN; 2.30A {Homo sapiens} SCOP: b.47.1.2 PDB: 1a5h_A* 1bda_A* 1a5i_A* Back     alignment and structure
>3i4w_A Disks large homolog 4; alpha and beta protein, alternative splicing, cell junction, cell membrane, lipoprotein, membrane, palmitate, phosphoprotein; 1.35A {Homo sapiens} SCOP: b.36.1.1 PDB: 3k82_A* 3jxt_A* 2he2_A 1pdr_A 2i0i_A Back     alignment and structure
>2cs5_A Tyrosine-protein phosphatase, non-receptor type 4; PDZ domain, ptpase, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>3qo6_A Protease DO-like 1, chloroplastic; protease, HTRA, PH-sensor, hydrolase, photosynthesis; 2.50A {Arabidopsis thaliana} Back     alignment and structure
>1wfv_A Membrane associated guanylate kinase inverted-2; atrophin-1 interacting protein 1, activin receptor interacting protein 1; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1uju_A Scribble; PDZ domain, cellular signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>3l4f_D SH3 and multiple ankyrin repeat domains protein 1; coiled-coil, PDZ, guanine-nucleotide releasing factor, phosphoprotein, SH3 domain; 2.80A {Rattus norvegicus} Back     alignment and structure
>2olg_A Pro-phenoloxidase activating enzyme-I; prophenoloxidase activating factor-I, PPAF-I, serine proteas hydrolase; HET: NAG; 1.70A {Holotrichia diomphalia} Back     alignment and structure
>3hpk_A Protein interacting with PRKCA 1; oxidized, PDZ domain, kinase, protein binding; 2.20A {Rattus norvegicus} PDB: 3hpm_A Back     alignment and structure
>4fln_A Protease DO-like 2, chloroplastic; protease, DEG, PDZ, hydrolase; 2.80A {Arabidopsis thaliana} Back     alignment and structure
>1fon_A Procarboxypeptidase A-S6; truncated zymogen E, serine protease; 1.70A {Bos taurus} SCOP: b.47.1.2 PDB: 1pyt_C Back     alignment and structure
>1fiw_A Beta-acrosin heavy chain; anti-parallel beta-barrel, hydrolase; HET: NAG FUL BMA MAN PBZ; 2.10A {Ovis aries} SCOP: b.47.1.2 PDB: 1fiz_A* Back     alignment and structure
>1arb_A Achromobacter protease I; hydrolase(serine protease); 1.20A {Achromobacter lyticus} SCOP: b.47.1.1 PDB: 1arc_A* Back     alignment and structure
>1z87_A Alpha-1-syntrophin; protein binding; NMR {Mus musculus} Back     alignment and structure
>2edv_A FERM and PDZ domain-containing protein 1; cytoskeletal-associated protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2vnt_A Urokinase-type plasminogen activator; UPA, inhibitor complex, hydrolase; HET: QGG; 2.2A {Homo sapiens} Back     alignment and structure
>3rm2_H Thrombin heavy chain; serine protease, kringle, hydrolase, blood coagulation, BLOO clotting, convertion of fibrinogen to fibrin; HET: TYS NAG S00; 1.23A {Homo sapiens} PDB: 1a2c_H* 1a3e_H* 1a46_H* 1a4w_H* 1a5g_H* 1a61_H* 1abi_H* 1abj_H* 1ad8_H* 1ae8_H* 1afe_H* 1a3b_H* 1ai8_H* 1aix_H* 1awf_H* 1awh_B* 1ay6_H* 1b5g_H* 1ba8_B* 1bb0_B* ... Back     alignment and structure
>2ehr_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>3kzd_A TIAM-1, T-lymphoma invasion and metastasis-inducing prote; PDZ, cell junction, cell adhesion, signaling protein, nucleotide exchange factor; 1.30A {Homo sapiens} PDB: 3kze_A Back     alignment and structure
>3egg_C Spinophilin; PP1, serine/threonine phosphatase, post synapti density, glutametergic receptors, carbohydrate metabolism, cycle, cell division; HET: MES; 1.85A {Rattus norvegicus} PDB: 3egh_C* 3hvq_C 2fn5_A Back     alignment and structure
>2daz_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>3soe_A Membrane-associated guanylate kinase, WW and PDZ containing protein 3; structural genomics consortium, SGC, PDZ domain, signaling P; 1.60A {Homo sapiens} Back     alignment and structure
>2d8i_A T-cell lymphoma invasion and metastasis 1 variant; PDZ domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3num_A Serine protease HTRA1; DEGP, hydrolase; 2.75A {Homo sapiens} PDB: 3nzi_A 2ytw_A 2joa_A Back     alignment and structure
>2la8_A Inactivation-NO-after-potential D protein, KON-TI peptide; peptide binding protein; NMR {Drosophila melanogaster} Back     alignment and structure
>1z8g_A Serine protease hepsin; serine protease hepsin, protease, hydrolase-hydrolase inhibi complex; HET: AR7; 1.55A {Homo sapiens} SCOP: b.47.1.2 d.170.1.2 PDB: 3t2n_A 1o5e_H* 1o5f_H* 1p57_B* 1o5e_L* 1o5f_L* 1p57_A* Back     alignment and structure
>2dc2_A GOPC, golgi associated PDZ and coiled-coil motif containing isoform B; GOPC PDZ domain, structural protein; NMR {Homo sapiens} Back     alignment and structure
>1ufx_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2f9n_A Alpha I tryptase; serine proteinase, trypsin-like, difucosylation, hydrolase-hydrolase inhibitor complex; HET: AR7 NAG FUC; 1.60A {Homo sapiens} PDB: 2f9o_A* 2f9p_A* 1lto_A 2fpz_A* 2bm2_A* 2fs8_A* 2fs9_A* 2fww_A* 2fxr_A* 2gdd_A* 2za5_A* 3v7t_A* 4a6l_A* 1a0l_A* 2zec_A* 2zeb_A* Back     alignment and structure
>4e34_A Golgi-associated PDZ and coiled-coil motif-contai protein; PDZ-peptide complex, protein transport-inhibitor complex; 1.40A {Homo sapiens} PDB: 4e35_A Back     alignment and structure
>1md8_A C1R complement serine protease; innate immunity, activation, substrate specificity, hydrolase; 2.80A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 PDB: 1md7_A* Back     alignment and structure
>2csj_A TJP2 protein; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2qbw_A PDZ-fibronectin fusion protein; fibronectin PDZ, unknown function; 1.80A {Homo sapiens} PDB: 3ch8_A Back     alignment and structure
>1yph_C Chymotrypsin A, chain B; serine protease, hydrolase; 1.34A {Bos taurus} PDB: 1afq_B* 1ca0_B 1cbw_B 1cho_F 1gct_B 1ab9_B* 1ggd_B* 1gha_F 1ghb_F* 1gmc_F 1gmd_F 1gmh_F 1hja_B 1mtn_B 1n8o_B 1vgc_B* 1gg6_B 2cha_B* 2gch_F 2gct_B ... Back     alignment and structure
>2eei_A PDZ domain-containing protein 1; regulatory factor, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1v6b_A Harmonin isoform A1; structural genomics, usher syndrome, USH1, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>1tp5_A Presynaptic density protein 95; PDZ-peptide ligand complex, peptide binding protein; 1.54A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1tp3_A 1tq3_A 1be9_A 1bfe_A Back     alignment and structure
>3tsz_A Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffolding, JAM, tight junction, cell adhesio; 2.50A {Homo sapiens} PDB: 3tsw_A 3lh5_A Back     alignment and structure
>2b9l_A Prophenoloxidase activating factor; CLIP domain, easter, innate immunity, melanin, immune system binding complex; HET: NAG FUC; 2.00A {Holotrichia diomphalia} Back     alignment and structure
>1zjk_A Mannan-binding lectin serine protease 2; beta barrel, modular protein, hydrolase; 2.18A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 g.18.1.1 PDB: 1q3x_A Back     alignment and structure
>1gpz_A Complement C1R component; hydrolase, activation, innate immunity, modular structure, serine protease; HET: NAG FUC MAN; 2.9A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 g.18.1.1 Back     alignment and structure
>2bdy_A Thrombin; thrombin, complex structure, hydrolase, hydrolase-hydrolase complex; HET: TYS UNB; 1.61A {Homo sapiens} SCOP: b.47.1.2 PDB: 3k65_B 1doj_A* 1hag_E* 1xm1_A* 1nu9_A* 3sqe_E 3sqh_E 1jwt_A* 1d9i_A* 1d6w_A* 1g37_A* 1nm6_A* 1nt1_A* 1sl3_A* 1ta2_A* 1ta6_A* 1z71_A* 1zgi_A* 1zgv_A* 1zrb_A* ... Back     alignment and structure
>2krg_A Na(+)/H(+) exchange regulatory cofactor NHE-RF1; acetylation, cell projection, disease mutation, membrane, phosphoprotein, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>1um7_A Synapse-associated protein 102; PDZ, discs large homolog 3, DLG3-human presynaptic protein, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>4fgm_A Aminopeptidase N family protein; structural genomics, PSI-biology, northeast structural genom consortium, NESG, peptidase_M61, PDZ; 2.39A {Idiomarina loihiensis L2TR} Back     alignment and structure
>4dur_A Plasminogen, serine protease; fibrinolysis, hydrolase; HET: NAG GAL SIA; 2.45A {Homo sapiens} PDB: 4a5t_S* 4duu_A 2feb_A Back     alignment and structure
>1lvm_A Catalytic domain of the nuclear inclusion protein A (NIA); beta barrel, chymotrypsin-type cystein protease, enzyme- peptide complex; 1.80A {Tobacco etch virus} SCOP: b.47.1.3 PDB: 1lvb_A 1q31_A Back     alignment and structure
>3shw_A Tight junction protein ZO-1; PDZ-SH3-GUK supramodule, cell adhesion; 2.90A {Homo sapiens} Back     alignment and structure
>1fc6_A Photosystem II D1 protease; D1 C-terminal processing protease, serine protease, serine- lysine catalytic DYAD, PDZ domain, photosynthesis; 1.80A {Scenedesmus obliquus} SCOP: b.36.1.3 c.14.1.2 PDB: 1fc9_A 1fc7_A 1fcf_A Back     alignment and structure
>1r6j_A Syntenin 1; PDZ, membrane protein; 0.73A {Homo sapiens} SCOP: b.36.1.1 PDB: 1nte_A 1obx_A 1oby_A Back     alignment and structure
>3hrz_D Complement factor B; serine protease, glycosilated, multi-domain, complement SYST convertase, complement alternate pathway; HET: NAG P6G; 2.20A {Homo sapiens} PDB: 2xwj_I* 3hs0_D* 2ok5_A* 2xwb_F* Back     alignment and structure
>2xxl_A GRAM-positive specific serine protease, isoform B; hydrolase, innate immunity; HET: NAG FUC BMA; 1.80A {Drosophila melanogaster} Back     alignment and structure
>2lob_A Golgi-associated PDZ and coiled-coil motif-contai protein; structural protein-hydrolase complex, peptide binding protei; NMR {Homo sapiens} Back     alignment and structure
>4f4o_C Haptoglobin; globin fold, serine protease fold, complement control protei haemoglobin scavenging, oxygen storage-transport complex; HET: HEM NAG FUC; 2.90A {Sus scrofa} Back     alignment and structure
>1z87_A Alpha-1-syntrophin; protein binding; NMR {Mus musculus} Back     alignment and structure
>2f83_A Coagulation factor XI; protease, apple domain, hydrolase; HET: NAG; 2.87A {Homo sapiens} PDB: 2j8j_A 2j8l_A Back     alignment and structure
>3nxp_A Prethrombin-1; allostery, blood coagulation, hydro kringle, serine protease, zymogen; HET: NAG; 2.20A {Homo sapiens} Back     alignment and structure
>3k50_A Putative S41 protease; structural genomics, joint center for structural genomics, JCSG, protein structure initiative; 2.00A {Bacteroides fragilis nctc 9343} Back     alignment and structure
>2xrc_A Human complement factor I; immune system, hydrolase, conglutinogen activating factor, S protease, complement system; HET: NAG; 2.69A {Homo sapiens} Back     alignment and structure
>3gge_A PDZ domain-containing protein GIPC2; structural genomics, structural genomics consort protein binding; 2.60A {Homo sapiens} Back     alignment and structure
>2hal_A Hepatitis A protease 3C; 3C protease, inhibitor design; HET: BBL; 1.35A {Hepatitis a virus} SCOP: b.47.1.4 PDB: 2h6m_A* 2h9h_A* 2cxv_A* 2a4o_A* 1hav_A 1qa7_A* Back     alignment and structure
>3qzr_A 3C protein; chymotrypsin-fold, beta-ribbon, hydrolysis, nucleus, hydrola hydrolase inhibitor complex; HET: AG7; 1.04A {Human enterovirus 71} SCOP: b.47.1.0 PDB: 3osy_A 3qzq_A* 3r0f_A* 3sjo_A* 3sjk_A 3sji_A* 3sj8_A* 3sj9_A Back     alignment and structure
>3suz_A Amyloid beta A4 precursor protein-binding family 2; APP binding; 2.70A {Rattus norvegicus} PDB: 1u3b_A 1u39_A 1x45_A 1u37_A 1u38_A 2yt8_A Back     alignment and structure
>1elv_A Complement C1S component; trypsin-like serin protease, CCP (OR sushi or SCR)module, HY; HET: NAG FUC NES; 1.70A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 Back     alignment and structure
>3zve_A 3C protease; hydrolase, michael inhibitor; HET: G84; 1.80A {Human enterovirus} PDB: 3zv8_A* 3zva_A* 3zvb_A* 3zv9_A* 3zvd_A* 3zvc_A* 3zvf_A* 3zvg_A* Back     alignment and structure
>3q3y_A HEVB EV93 3C protease; cysteine trypsin-like protease, 3C cysteine protease (picorn antiviral compound 1 (AG7404); HET: XNV; 1.32A {Human enterovirus B} SCOP: b.47.1.4 PDB: 3q3x_A* 3ruo_A* 3zyd_A 3zz5_A* 3zz6_A* 3zz7_A* 3zz8_A* 3zz9_A* 3zza_A* 3zzb_A* 2ztx_A 2vb0_A 2zty_A 2ztz_A 2zu3_A* 3zye_A 3zz3_A 2zu1_A 3zz4_A 3zzc_A* ... Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 568
d1ky9a2249 b.47.1.1 (A:11-259) Protease Do (DegP, HtrA), cata 6e-10
d1lcya2205 b.47.1.1 (A:6-210) Mitochondrial serine protease H 3e-09
d1qtfa_246 b.47.1.1 (A:) Exfoliative toxin B {Staphylococcus 5e-09
d1agja_242 b.47.1.1 (A:) Epidermolytic (exfoliative) toxin A 6e-09
d2qf3a1210 b.47.1.1 (A:43-252) Stress sensor protease DegS, c 3e-08
d1l1ja_228 b.47.1.1 (A:) Protease Do (DegP, HtrA), catalytic 2e-07
d2qaaa1185 b.47.1.1 (A:16-242) Protease B {Streptomyces grise 2e-07
d2z9ia2221 b.47.1.1 (A:6-226) Protease PepD {Mycobacterium tu 1e-06
d2bhga1199 b.47.1.4 (A:7-205) 3C cysteine protease (picornain 5e-06
d2sgaa_181 b.47.1.1 (A:) Protease A {Streptomyces griseus, st 9e-06
d1sota199 b.36.1.4 (A:255-353) Stress sensor protease DegS, 1e-05
d2i6va187 b.36.1.5 (A:219-305) General secretion pathway pro 2e-05
d2h5ca1198 b.47.1.1 (A:15A-245) alpha-Lytic protease {Lysobac 5e-05
d2o8la1216 b.47.1.1 (A:1-216) V8 protease {Staphylococcus aur 9e-05
d1ky9a194 b.36.1.4 (A:260-353) Protease Do (DegP, HtrA), C-t 1e-04
d1p3ca_215 b.47.1.1 (A:) Glutamyl endopeptidase {Bacillus int 0.003
>d1ky9a2 b.47.1.1 (A:11-259) Protease Do (DegP, HtrA), catalytic domain {Escherichia coli [TaxId: 562]} Length = 249 Back     information, alignment and structure

class: All beta proteins
fold: Trypsin-like serine proteases
superfamily: Trypsin-like serine proteases
family: Prokaryotic proteases
domain: Protease Do (DegP, HtrA), catalytic domain
species: Escherichia coli [TaxId: 562]

 Score = 57.7 bits (138), Expect = 6e-10
 Identities = 37/191 (19%), Positives = 76/191 (39%), Gaps = 25/191 (13%)

Query: 136 PNFSLPWQRKRQYSSSSSGFIVGGRR-VLTNAHSVEHHTQVKVKKRGSDTKYLATVLSIG 194
                   +++++ +  SG I+   +  +   + V  +  V   +     K+ A ++   
Sbjct: 62  GQGGNGGGQQQKFMALGSGVIIDADKGYVVTNNHVVDNATVIKVQLSDGRKFDAKMVGKD 121

Query: 195 TECDIALLTVKDDEFWEGVSPVEFGDLPALQ--DAVTVVGYPIGGDTISVTSGVVSRMEI 252
              DIAL+ +++ +    ++ ++  D  AL+  D    +G P G    +VTSG+VS +  
Sbjct: 122 PRSDIALIQIQNPK---NLTAIKMADSDALRVGDYTVAIGNPFGLG-ETVTSGIVSALGR 177

Query: 253 LSYVHGSTE-----------------LLGLQGKCVGIAFQSLKNDDV-ENIGYVIPTPVI 294
                 + E                 L+ L G+ +GI    L  D     IG+ IP+ ++
Sbjct: 178 SGLNAENYENFIQTDAAINRGNAGGALVNLNGELIGINTAILAPDGGNIGIGFAIPSNMV 237

Query: 295 IHFIQDYEKNG 305
            +      + G
Sbjct: 238 KNLTSQMVEYG 248
>d1lcya2 b.47.1.1 (A:6-210) Mitochondrial serine protease HtrA2, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Length = 205 Back     information, alignment and structure
>d1qtfa_ b.47.1.1 (A:) Exfoliative toxin B {Staphylococcus aureus [TaxId: 1280]} Length = 246 Back     information, alignment and structure
>d1agja_ b.47.1.1 (A:) Epidermolytic (exfoliative) toxin A {Staphylococcus aureus [TaxId: 1280]} Length = 242 Back     information, alignment and structure
>d2qf3a1 b.47.1.1 (A:43-252) Stress sensor protease DegS, catalytic domain {Escherichia coli [TaxId: 562]} Length = 210 Back     information, alignment and structure
>d1l1ja_ b.47.1.1 (A:) Protease Do (DegP, HtrA), catalytic domain {Thermotoga maritima [TaxId: 2336]} Length = 228 Back     information, alignment and structure
>d2qaaa1 b.47.1.1 (A:16-242) Protease B {Streptomyces griseus, strain k1 [TaxId: 1911]} Length = 185 Back     information, alignment and structure
>d2z9ia2 b.47.1.1 (A:6-226) Protease PepD {Mycobacterium tuberculosis [TaxId: 1773]} Length = 221 Back     information, alignment and structure
>d2bhga1 b.47.1.4 (A:7-205) 3C cysteine protease (picornain 3C) {Foot-and-mouth disease virus FMDV [TaxId: 12110]} Length = 199 Back     information, alignment and structure
>d2sgaa_ b.47.1.1 (A:) Protease A {Streptomyces griseus, strain k1 [TaxId: 1911]} Length = 181 Back     information, alignment and structure
>d1sota1 b.36.1.4 (A:255-353) Stress sensor protease DegS, C-terminal domain {Escherichia coli [TaxId: 562]} Length = 99 Back     information, alignment and structure
>d2i6va1 b.36.1.5 (A:219-305) General secretion pathway protein C, EpsC {Vibrio cholerae [TaxId: 666]} Length = 87 Back     information, alignment and structure
>d2h5ca1 b.47.1.1 (A:15A-245) alpha-Lytic protease {Lysobacter enzymogenes, 495 [TaxId: 69]} Length = 198 Back     information, alignment and structure
>d2o8la1 b.47.1.1 (A:1-216) V8 protease {Staphylococcus aureus [TaxId: 1280]} Length = 216 Back     information, alignment and structure
>d1ky9a1 b.36.1.4 (A:260-353) Protease Do (DegP, HtrA), C-terminal domains {Escherichia coli [TaxId: 562]} Length = 94 Back     information, alignment and structure
>d1p3ca_ b.47.1.1 (A:) Glutamyl endopeptidase {Bacillus intermedius [TaxId: 1400]} Length = 215 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query568
d1ky9a2249 Protease Do (DegP, HtrA), catalytic domain {Escher 99.97
d1l1ja_228 Protease Do (DegP, HtrA), catalytic domain {Thermo 99.95
d2qf3a1210 Stress sensor protease DegS, catalytic domain {Esc 99.95
d2z9ia2221 Protease PepD {Mycobacterium tuberculosis [TaxId: 99.94
d1lcya2205 Mitochondrial serine protease HtrA2, catalytic dom 99.93
d1lvmb_219 TEV protease (nucleat inclusion protein A, NIA) {T 99.7
d1agja_242 Epidermolytic (exfoliative) toxin A {Staphylococcu 99.64
d1sota199 Stress sensor protease DegS, C-terminal domain {Es 99.63
d1ky9a194 Protease Do (DegP, HtrA), C-terminal domains {Esch 99.61
d1lcya1100 Mitochondrial serine protease HtrA2 {Human (Homo s 99.55
d1qtfa_246 Exfoliative toxin B {Staphylococcus aureus [TaxId: 99.49
d2qaaa1185 Protease B {Streptomyces griseus, strain k1 [TaxId 99.48
d2z9ia188 Protease PepD {Mycobacterium tuberculosis [TaxId: 99.42
d2o8la1216 V8 protease {Staphylococcus aureus [TaxId: 1280]} 99.37
d2bhga1199 3C cysteine protease (picornain 3C) {Foot-and-mout 99.29
d2i6va187 General secretion pathway protein C, EpsC {Vibrio 99.09
d2hgaa1103 Uncharacterized protein MTH1368 {Methanobacterium 99.07
d2sgaa_181 Protease A {Streptomyces griseus, strain k1 [TaxId 99.03
d1k32a191 Tricorn protease {Archaeon Thermoplasma acidophilu 99.02
d2h5ca1198 alpha-Lytic protease {Lysobacter enzymogenes, 495 98.99
d1fc6a392 Photosystem II D1 C-terminal processing protease { 98.95
d1ky9b288 Protease Do (DegP, HtrA), C-terminal domains {Esch 98.92
d1lcya1100 Mitochondrial serine protease HtrA2 {Human (Homo s 98.88
d1ky9a194 Protease Do (DegP, HtrA), C-terminal domains {Esch 98.82
d1p3ca_215 Glutamyl endopeptidase {Bacillus intermedius [TaxI 98.8
d1hpga_187 Glutamic acid-specific protease {Streptomyces gris 98.67
d1sota199 Stress sensor protease DegS, C-terminal domain {Es 98.64
d2hgaa1103 Uncharacterized protein MTH1368 {Methanobacterium 98.57
d1w9ea185 Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} 98.5
d1m5za_91 Glutamate receptor interacting protein {Rat (Rattu 98.48
d1ky9b288 Protease Do (DegP, HtrA), C-terminal domains {Esch 98.48
d1x5qa197 Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 98.47
d2f5ya177 Regulator of G-protein signaling 3, RGS3 {Human (H 98.46
d2z9ia188 Protease PepD {Mycobacterium tuberculosis [TaxId: 98.46
d1rgwa_85 Zasp (Cypher, Oracle 1) {Human (Homo sapiens) [Tax 98.42
d1t2ma192 Afadin {Human (Homo sapiens) [TaxId: 9606]} 98.4
d1cqqa_180 3C cysteine protease (picornain 3C) {Human rhinovi 98.32
d1ozia_99 Phosphatase hPTP1e {Mouse (Mus musculus) [TaxId: 1 98.31
d2fe5a192 Synapse-associated protein 102 {Human (Homo sapien 98.27
d1uita_117 Discs large 5 protein KIAA0583 {Human (Homo sapien 98.25
d2fcfa196 Multiple PDZ domain protein {Human (Homo sapiens) 98.25
d2i6va187 General secretion pathway protein C, EpsC {Vibrio 98.24
d1g9oa_91 Na+/H+ exchanger regulatory factor, NHERF {Human ( 98.2
d1wifa_126 hypothetical PDZ domain containing protein Uqcrc2 98.19
d1vb7a_94 PDZ-LIM protein mystique {Mouse (Mus musculus) [Ta 98.19
d1ueza_101 KIAA1526 protein {Human (Homo sapiens) [TaxId: 960 98.18
d1rgra_93 Synaptic protein PSD-95 {Rat (Rattus norvegicus) [ 98.18
d1x45a185 Amyloid beta A4 precursor protein-binding family A 98.16
d1uf1a_128 KIAA1526 protein {Human (Homo sapiens) [TaxId: 960 98.14
d1ihja_94 Inad {Fruit fly (Drosophila melanogaster) [TaxId: 98.14
d1wi2a_104 PDZ domain containing protein 11, Pdzk11 {Mouse (M 98.14
d1q3oa_104 Shank1, PDZ domain {Rat (Rattus norvegicus) [TaxId 98.13
d1whaa_105 Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 98.13
d1wf8a194 Neurabin-i {Human (Homo sapiens) [TaxId: 9606]} 98.12
d1n7ea_95 Glutamate receptor-interacting protein 1, GRIP1 {R 98.11
d1k32a191 Tricorn protease {Archaeon Thermoplasma acidophilu 98.08
d1fc6a392 Photosystem II D1 C-terminal processing protease { 98.08
d2h3la1103 Erbin {Human (Homo sapiens) [TaxId: 9606]} 98.07
d1ueqa_123 Membrane associated guanylate kinase inverted-2 (M 98.05
d1x5na1101 Harmonin {Human (Homo sapiens) [TaxId: 9606]} 98.04
d1uhpa_107 Hypothetical protein KIAA1095 {Human (Homo sapiens 98.04
d1kwaa_88 Cask/Lin-2 {Human (Homo sapiens) [TaxId: 9606]} 98.03
d1qava_90 Syntrophin {Mouse (Mus musculus) [TaxId: 10090]} 98.02
d1uepa_103 Membrane associated guanylate kinase inverted-2 (M 98.02
d1p1da299 Glutamate receptor interacting protein {Rat (Rattu 98.02
d1qaua_112 Neuronal nitric oxide synthase, NNOS {Rat (Rattus 98.01
d1j16a_223 Trypsin(ogen) {Rat (Rattus norvegicus) [TaxId: 101 98.01
d1uewa_114 Membrane associated guanylate kinase inverted-2 (M 98.01
d1v5la_103 Alpha-actinin-2 associated LIM protein {Mouse (Mus 97.99
d1tp5a1102 Synaptic protein PSD-95 {Rat (Rattus norvegicus) [ 97.98
d1vaea_111 Rhophilin-2 {Mouse (Mus musculus) [TaxId: 10090]} 97.97
d2csja1104 Tight junction protein ZO-2, Tjp2 {Mouse (Mus musc 97.96
d1va8a1100 Maguk p55 subfamily member 5 {Mouse (Mus musculus) 97.96
d2cssa1108 Regulating synaptic membrane exocytosis protein 1, 97.95
d1ujda_117 Hypothetical protein KIAA0559 {Human (Homo sapiens 97.94
d1gdna_224 Trypsin(ogen) {Mold (Fusarium oxysporum) [TaxId: 5 97.92
d1v62a_117 Glutamate receptor interacting protein 2, GRIP2 (K 97.89
d1um1a_110 Hypothetical protein KIAA1849 {Human (Homo sapiens 97.89
d1rzxa_98 GTPase-binding domain of the cell polarity protein 97.88
d1ujua_111 Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 97.87
d1r6ja_82 Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} 97.86
d1wi4a196 Syntaxin binding protein 4 {Mouse (Mus musculus) [ 97.86
d1wf7a_103 Enigma homolog ENH {Mouse (Mus musculus) [TaxId: 1 97.86
d1y7na179 Amyloid beta A4 precursor protein-binding family A 97.84
d2f0aa192 Segment polarity protein dishevelled homolog Dvl-2 97.84
d1w9ea185 Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} 97.78
d2fnea188 Multiple PDZ domain protein {Human (Homo sapiens) 97.78
d1wh1a_124 Hypothetical protein KIAA1095 {Human (Homo sapiens 97.78
d1ozia_99 Phosphatase hPTP1e {Mouse (Mus musculus) [TaxId: 1 97.78
d1v6ba_118 Harmonin {Mouse (Mus musculus) [TaxId: 10090]} 97.77
d1hj8a_222 Trypsin(ogen) {North atlantic salmon (Salmo salar) 97.76
d1x5qa197 Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 97.74
d1rgwa_85 Zasp (Cypher, Oracle 1) {Human (Homo sapiens) [Tax 97.72
d1i16a_130 Interleukin 16 {Human (Homo sapiens) [TaxId: 9606] 97.71
d1azza_226 Crab collagenase {Atlantic sand fiddler crab (Uca 97.71
d2f5ya177 Regulator of G-protein signaling 3, RGS3 {Human (H 97.7
d1x5ra199 Glutamate receptor interacting protein 2, GRIP2 (K 97.69
d1fxya_228 Coagulation factor Xa-trypsin chimera {Synthetic, 97.68
d1vaea_111 Rhophilin-2 {Mouse (Mus musculus) [TaxId: 10090]} 97.68
d1eufa_224 Duodenase {Cow (Bos taurus) [TaxId: 9913]} 97.67
d1lo6a_221 Kallikrein 6 {Human (Homo sapiens) [TaxId: 9606]} 97.67
d1op0a_234 Venom serine protease {Hundred-pace snake (Agkistr 97.66
d1autc_240 Activated protein c (autoprothrombin IIa) {Human ( 97.64
d1m5za_91 Glutamate receptor interacting protein {Rat (Rattu 97.63
d1q3oa_104 Shank1, PDZ domain {Rat (Rattus norvegicus) [TaxId 97.63
d1uf1a_128 KIAA1526 protein {Human (Homo sapiens) [TaxId: 960 97.62
d1v5qa_122 Glutamate receptor interacting protein {Mouse (Mus 97.61
d1ao5a_237 Kallikrein-13 {Mouse (Mus musculus) [TaxId: 10090] 97.61
d1t2ma192 Afadin {Human (Homo sapiens) [TaxId: 9606]} 97.6
d1wfva_103 Membrane associated guanylate kinase inverted-2 (M 97.6
d1wg6a_127 Partitioning-defective 3-like protein, PAR3-L (RIK 97.59
d1x6da1107 Interleukin 16 {Human (Homo sapiens) [TaxId: 9606] 97.54
d1nn6a_224 Chymase (mast cell protease I) {Human (Homo sapien 97.53
d2fe5a192 Synapse-associated protein 102 {Human (Homo sapien 97.52
d1mzaa_240 Granzyme K {Human (Homo sapiens) [TaxId: 9606]} 97.52
d1hj9a_223 Trypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]} 97.52
d1xx9a_237 Coagulation factor XI {Human (Homo sapiens) [TaxId 97.49
d1fuja_221 Myeloblastin, PR3 {Human (Homo sapiens) [TaxId: 96 97.47
d1npma_225 Neuropsin {Mouse (Mus musculus) [TaxId: 10090]} 97.47
d2z7fe1218 Elastase {Human (Homo sapiens) [TaxId: 9606]} 97.46
d1p1da299 Glutamate receptor interacting protein {Rat (Rattu 97.45
d1ufxa_103 KIAA1526 protein {Human (Homo sapiens) [TaxId: 960 97.45
d1fi8a_227 Granzyme B {Rat (Rattus norvegicus) [TaxId: 10116] 97.44
d1rgra_93 Synaptic protein PSD-95 {Rat (Rattus norvegicus) [ 97.42
d2hlca_230 HL collagenase {Common cattle grub (Hypoderma line 97.41
d2fcfa196 Multiple PDZ domain protein {Human (Homo sapiens) 97.4
d1wh1a_124 Hypothetical protein KIAA1095 {Human (Homo sapiens 97.39
d2cs5a1106 Tyrosine-protein phosphatase non-receptor type 4, 97.38
g2pka.1232 Kallikrein A {Pig (Sus scrofa) [TaxId: 9823]} 97.38
d1bioa_228 Factor D {Human (Homo sapiens) [TaxId: 9606]} 97.36
d2h3la1103 Erbin {Human (Homo sapiens) [TaxId: 9606]} 97.36
g1gg6.1238 (alpha,gamma)-chymotrypsin(ogen) {Cow (Bos taurus) 97.34
d1sgfa_228 7S NGF protease subunits {Mouse (Mus musculus) [Ta 97.34
d1ihja_94 Inad {Fruit fly (Drosophila melanogaster) [TaxId: 97.33
d1vb7a_94 PDZ-LIM protein mystique {Mouse (Mus musculus) [Ta 97.32
d1qava_90 Syntrophin {Mouse (Mus musculus) [TaxId: 10090]} 97.32
d1si5h_234 Hepatocyte growth factor, HGF {Human (Homo sapiens 97.32
d1tona_235 Tonin {Rat (Rattus rattus) [TaxId: 10117]} 97.31
d2bz6h1254 Coagulation factor VIIa {Human (Homo sapiens) [Tax 97.31
d1g9oa_91 Na+/H+ exchanger regulatory factor, NHERF {Human ( 97.31
g1gj7.1256 Urokinase-type plasminogen activator (LMW U-PA), c 97.3
d1elta_236 Elastase {Salmon (Salmo salar) [TaxId: 8030]} 97.28
d1wf8a194 Neurabin-i {Human (Homo sapiens) [TaxId: 9606]} 97.28
d1wifa_126 hypothetical PDZ domain containing protein Uqcrc2 97.27
d1ujva_96 Membrane associated guanylate kinase inverted-2 (M 97.26
d1gvza_237 Prostate specific antigen (PSA kallikrein) {Horse 97.26
d1arba_263 Achromobacter protease {Achromobacter lyticus, str 97.26
d1n7ea_95 Glutamate receptor-interacting protein 1, GRIP1 {R 97.23
d1a7sa_225 Heparin binding protein, HBP {Human (Homo sapiens) 97.23
d1wi2a_104 PDZ domain containing protein 11, Pdzk11 {Mouse (M 97.23
g1fiw.1274 Beta-acrosin {Sheep (Ovis aries) [TaxId: 9940]} 97.23
d1os8a_223 Trypsin {Streptomyces griseus, strain k1 [TaxId: 1 97.22
d1rfna_235 Coagulation factor IXa, protease domain {Human (Ho 97.22
d1ueqa_123 Membrane associated guanylate kinase inverted-2 (M 97.22
d1i16a_130 Interleukin 16 {Human (Homo sapiens) [TaxId: 9606] 97.22
d1orfa_232 Granzyme A {Human (Homo sapiens) [TaxId: 9606]} 97.2
d1uhpa_107 Hypothetical protein KIAA1095 {Human (Homo sapiens 97.2
d1wf7a_103 Enigma homolog ENH {Mouse (Mus musculus) [TaxId: 1 97.19
d1elva1259 Complement C1S protease, catalytic domain {Human ( 97.19
d1eq9a_222 (alpha,gamma)-chymotrypsin(ogen) {Red fire ant (So 97.18
d1wi4a196 Syntaxin binding protein 4 {Mouse (Mus musculus) [ 97.18
d1z8ga1255 Hepsin, catalytic domain {Human (Homo sapiens) [Ta 97.18
d1whaa_105 Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 97.17
d1ujda_117 Hypothetical protein KIAA0559 {Human (Homo sapiens 97.15
d1ekbb_235 Enteropeptidase (enterokinase light chain) {Cow (B 97.15
d1t32a1224 Cathepsin G {Human (Homo sapiens) [TaxId: 9606]} 97.14
d2p3ub1233 Coagulation factor Xa, protease domain {Human (Hom 97.14
d1brup_241 Elastase {Pig (Sus scrofa) [TaxId: 9823]} 97.11
d2f0aa192 Segment polarity protein dishevelled homolog Dvl-2 97.11
d2cssa1108 Regulating synaptic membrane exocytosis protein 1, 97.09
d1v5la_103 Alpha-actinin-2 associated LIM protein {Mouse (Mus 97.07
d2csja1104 Tight junction protein ZO-2, Tjp2 {Mouse (Mus musc 97.06
d2qy0b1240 Complement C1R protease, catalytic domain {Human ( 97.06
d1qaua_112 Neuronal nitric oxide synthase, NNOS {Rat (Rattus 97.05
d1uepa_103 Membrane associated guanylate kinase inverted-2 (M 97.05
d1uita_117 Discs large 5 protein KIAA0583 {Human (Homo sapien 97.04
d1fq3a_227 Granzyme B {Human (Homo sapiens) [TaxId: 9606]} 97.03
d1x45a185 Amyloid beta A4 precursor protein-binding family A 97.01
d3rp2a_224 Chymase II (mast cell proteinase II) {Rat (Rattus 97.01
d1uewa_114 Membrane associated guanylate kinase inverted-2 (M 97.0
d1um1a_110 Hypothetical protein KIAA1849 {Human (Homo sapiens 96.99
d1rzxa_98 GTPase-binding domain of the cell polarity protein 96.99
d1rjxb_247 Plasmin(ogen), catalytic domain {Human (Homo sapie 96.99
d1tp5a1102 Synaptic protein PSD-95 {Rat (Rattus norvegicus) [ 96.99
d1pytd_251 (alpha,gamma)-chymotrypsin(ogen) {Cow (Bos taurus) 96.98
d2f91a1237 Trypsin(ogen) {Narrow-clawed crayfish (Pontastacus 96.98
g1rtf.1260 Two-chain tissue plasminogen activator (TC)-T-PA { 96.96
d1ueza_101 KIAA1526 protein {Human (Homo sapiens) [TaxId: 960 96.95
d1gvkb_240 Elastase {Pig (Sus scrofa) [TaxId: 9823]} 96.93
d1kwaa_88 Cask/Lin-2 {Human (Homo sapiens) [TaxId: 9606]} 96.92
g1h8d.1289 Thrombin {Human (Homo sapiens) [TaxId: 9606]} 96.92
d1fona_232 Procarboxypeptidase A-S6 subunit III (zymogen E) { 96.91
d1ujua_111 Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 96.89
d1eaxa_241 Matriptase MTSP1 {Human (Homo sapiens) [TaxId: 960 96.88
d1rrka1287 Factor B {Human (Homo sapiens) [TaxId: 9606]} 96.86
d2fpza1243 beta-Tryptase {Human (Homo sapiens) [TaxId: 9606]} 96.84
d2cs5a1106 Tyrosine-protein phosphatase non-receptor type 4, 96.84
d1y7na179 Amyloid beta A4 precursor protein-binding family A 96.83
d1q3xa1242 Mannan-binding lectin serine protease 2 (MASP-2), 96.82
d1v62a_117 Glutamate receptor interacting protein 2, GRIP2 (K 96.81
d1x5na1101 Harmonin {Human (Homo sapiens) [TaxId: 9606]} 96.79
d1r6ja_82 Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} 96.78
d1x6da1107 Interleukin 16 {Human (Homo sapiens) [TaxId: 9606] 96.73
d1v5qa_122 Glutamate receptor interacting protein {Mouse (Mus 96.72
d1va8a1100 Maguk p55 subfamily member 5 {Mouse (Mus musculus) 96.68
d2fnea188 Multiple PDZ domain protein {Human (Homo sapiens) 96.68
d1x5ra199 Glutamate receptor interacting protein 2, GRIP2 (K 96.66
d1wfva_103 Membrane associated guanylate kinase inverted-2 (M 96.58
d1mbma_198 NSP4 proteinase {Equine arteritis virus, EAV [TaxI 96.47
d1l1na_180 3C cysteine protease (picornain 3C) {Human poliovi 96.42
d1wg6a_127 Partitioning-defective 3-like protein, PAR3-L (RIK 96.36
d1v6ba_118 Harmonin {Mouse (Mus musculus) [TaxId: 10090]} 96.29
d1m9ua_241 Elastase {Worm (Eisenia fetida) [TaxId: 6396]} 96.26
d1ujva_96 Membrane associated guanylate kinase inverted-2 (M 95.96
d1ufxa_103 KIAA1526 protein {Human (Homo sapiens) [TaxId: 960 95.51
d2h6ma1212 3C cysteine protease (picornain 3C) {Human hepatit 93.05
>d1ky9a2 b.47.1.1 (A:11-259) Protease Do (DegP, HtrA), catalytic domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: All beta proteins
fold: Trypsin-like serine proteases
superfamily: Trypsin-like serine proteases
family: Prokaryotic proteases
domain: Protease Do (DegP, HtrA), catalytic domain
species: Escherichia coli [TaxId: 562]

Probab=99.97  E-value=1.8e-30  Score=257.49  Aligned_cols=189  Identities=24%  Similarity=0.410  Sum_probs=153.7

Q ss_pred             CcHHHHHHHhCCCCCceEEEEeEeecC-------CCCC--------------c---------------ccccCCCcceEE
Q 036586          110 PRWESVAVKAVPSMDAVVKVFCVHTEP-------NFSL--------------P---------------WQRKRQYSSSSS  153 (568)
Q Consensus       110 ~~~~~~~~~v~p~~~sVV~I~~~~~~~-------~~~~--------------p---------------~~~~~~~~~~GS  153 (568)
                      ++|+++++++.|   |||.|.+.....       ....              |               +...+...+.||
T Consensus         3 Ps~a~~ve~v~P---aVV~I~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~GS   79 (249)
T d1ky9a2           3 PSLAPMLEKVMP---SVVSINVEGSTTVNTPRMPRNFQQFFGDDSPFCQEGSPFQSSPFCQGGQGGNGGGQQQKFMALGS   79 (249)
T ss_dssp             CCSHHHHHHHGG---GEEEEEEEEEEEECCCCSSCCTTCCCC---------------------------CEEEEEEEEEE
T ss_pred             CChHHHHHHhCC---ceEEEEEEEEEeecCCcCcchhhhccccCCccccccccccccccccccccccccccccccccccc
Confidence            378999999999   999998754310       0000              0               001123346899


Q ss_pred             EEEEe-C-CEEEEcccccCCCCeEEEEEcCCCcEEEEEEEEEeCCCCeEEEEeccCccccCccceecCCCc--ccCCeEE
Q 036586          154 GFIVG-G-RRVLTNAHSVEHHTQVKVKKRGSDTKYLATVLSIGTECDIALLTVKDDEFWEGVSPVEFGDLP--ALQDAVT  229 (568)
Q Consensus       154 GfiI~-~-G~ILTn~HVV~~~~~i~V~~~~dg~~~~a~vv~~d~~~DlAlLkv~~~~~~~~l~~~~l~~~~--~~g~~V~  229 (568)
                      ||+|+ + ||||||+|||.++..+.|++ .+++.+.|++++.|+.+|||+|+++...   .+++++|+++.  ++|++|+
T Consensus        80 G~iI~~~~g~IlTn~HVv~~~~~~~v~~-~~~~~~~a~~~~~d~~~dlavl~i~~~~---~~~~~~l~~~~~~~~G~~v~  155 (249)
T d1ky9a2          80 GVIIDADKGYVVTNNHVVDNATVIKVQL-SDGRKFDAKMVGKDPRSDIALIQIQNPK---NLTAIKMADSDALRVGDYTV  155 (249)
T ss_dssp             EEEEETTTTEEEEEHHHHTTEEEEEEEE-TTSCEEEEEEEEEETTTTEEEEEESSCC---SCCCCCBCCGGGCCTTCEEE
T ss_pred             EEEEeccCceEEeeccccccceeeeeee-cccccccceeeEeccchhhceeeecccc---cceEEEcCCcCcCCcCCEEE
Confidence            99998 5 89999999999999999999 5999999999999999999999998763   78999999865  5689999


Q ss_pred             EEecCCCCCCceEEEEEEeeeeccc---------------ccC--CCceeecccceEEEEEeeeecCC-CCccccccccc
Q 036586          230 VVGYPIGGDTISVTSGVVSRMEILS---------------YVH--GSTELLGLQGKCVGIAFQSLKND-DVENIGYVIPT  291 (568)
Q Consensus       230 aiG~P~g~~~~svt~GiIs~~~~~~---------------~~~--ggspL~n~~G~VVGI~~~~~~~~-~~~~~~~aIP~  291 (568)
                      ++|||+|+.. +++.|+++...+..               ..+  +||||+|.+|+||||+++.+... +..+++||||+
T Consensus       156 aiG~P~g~~~-tvt~~~~~~~~~~~~~~~~~~~~iqtda~i~~GnSGGPl~n~~G~vIGI~t~~~~~~~~~~gi~faIP~  234 (249)
T d1ky9a2         156 AIGNPFGLGE-TVTSGIVSALGRSGLNAENYENFIQTDAAINRGNAGGALVNLNGELIGINTAILAPDGGNIGIGFAIPS  234 (249)
T ss_dssp             EEECTTSSSC-EEEEEEEEEESSCC-----CCCCEEESCCCTTSCCCSEEECTTSCEEEEEECSSTTSCCCSSSEEEEEH
T ss_pred             EEecccccCC-ceeecceeecccccccCccccceEEEeeeecCCCCCceEECCCCEEEEEEEEEeccCCCcccEEEEEEH
Confidence            9999999877 99999998775431               123  45599999999999999987654 45789999999


Q ss_pred             hhhhHhHHHhhhcCc
Q 036586          292 PVIIHFIQDYEKNGA  306 (568)
Q Consensus       292 ~~i~~~l~~l~~~g~  306 (568)
                      +.+++++++|++.|+
T Consensus       235 ~~~~~~~~~l~~~G~  249 (249)
T d1ky9a2         235 NMVKNLTSQMVEYGQ  249 (249)
T ss_dssp             HHHHHHHHHHHHHSS
T ss_pred             HHHHHHHHHHHHhCc
Confidence            999999999988664
>d1l1ja_ b.47.1.1 (A:) Protease Do (DegP, HtrA), catalytic domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2qf3a1 b.47.1.1 (A:43-252) Stress sensor protease DegS, catalytic domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2z9ia2 b.47.1.1 (A:6-226) Protease PepD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1lcya2 b.47.1.1 (A:6-210) Mitochondrial serine protease HtrA2, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lvmb_ b.47.1.3 (B:) TEV protease (nucleat inclusion protein A, NIA) {Tobacco etch virus, TEV [TaxId: 12227]} Back     information, alignment and structure
>d1agja_ b.47.1.1 (A:) Epidermolytic (exfoliative) toxin A {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1sota1 b.36.1.4 (A:255-353) Stress sensor protease DegS, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ky9a1 b.36.1.4 (A:260-353) Protease Do (DegP, HtrA), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lcya1 b.36.1.4 (A:226-325) Mitochondrial serine protease HtrA2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qtfa_ b.47.1.1 (A:) Exfoliative toxin B {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2qaaa1 b.47.1.1 (A:16-242) Protease B {Streptomyces griseus, strain k1 [TaxId: 1911]} Back     information, alignment and structure
>d2z9ia1 b.36.1.4 (A:227-314) Protease PepD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2o8la1 b.47.1.1 (A:1-216) V8 protease {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2bhga1 b.47.1.4 (A:7-205) 3C cysteine protease (picornain 3C) {Foot-and-mouth disease virus FMDV [TaxId: 12110]} Back     information, alignment and structure
>d2i6va1 b.36.1.5 (A:219-305) General secretion pathway protein C, EpsC {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d2hgaa1 b.36.1.6 (A:23-125) Uncharacterized protein MTH1368 {Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d2sgaa_ b.47.1.1 (A:) Protease A {Streptomyces griseus, strain k1 [TaxId: 1911]} Back     information, alignment and structure
>d1k32a1 b.36.1.3 (A:763-853) Tricorn protease {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d2h5ca1 b.47.1.1 (A:15A-245) alpha-Lytic protease {Lysobacter enzymogenes, 495 [TaxId: 69]} Back     information, alignment and structure
>d1fc6a3 b.36.1.3 (A:157-248) Photosystem II D1 C-terminal processing protease {Algae (Scenedesmus obliquus) [TaxId: 3088]} Back     information, alignment and structure
>d1ky9b2 b.36.1.4 (B:359-446) Protease Do (DegP, HtrA), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lcya1 b.36.1.4 (A:226-325) Mitochondrial serine protease HtrA2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ky9a1 b.36.1.4 (A:260-353) Protease Do (DegP, HtrA), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1p3ca_ b.47.1.1 (A:) Glutamyl endopeptidase {Bacillus intermedius [TaxId: 1400]} Back     information, alignment and structure
>d1hpga_ b.47.1.1 (A:) Glutamic acid-specific protease {Streptomyces griseus [TaxId: 1911]} Back     information, alignment and structure
>d1sota1 b.36.1.4 (A:255-353) Stress sensor protease DegS, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2hgaa1 b.36.1.6 (A:23-125) Uncharacterized protein MTH1368 {Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1w9ea1 b.36.1.1 (A:110-194) Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m5za_ b.36.1.1 (A:) Glutamate receptor interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ky9b2 b.36.1.4 (B:359-446) Protease Do (DegP, HtrA), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1x5qa1 b.36.1.1 (A:8-104) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f5ya1 b.36.1.1 (A:19-95) Regulator of G-protein signaling 3, RGS3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2z9ia1 b.36.1.4 (A:227-314) Protease PepD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1rgwa_ b.36.1.1 (A:) Zasp (Cypher, Oracle 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t2ma1 b.36.1.1 (A:2-93) Afadin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cqqa_ b.47.1.4 (A:) 3C cysteine protease (picornain 3C) {Human rhinovirus 2 [TaxId: 12130]} Back     information, alignment and structure
>d1ozia_ b.36.1.1 (A:) Phosphatase hPTP1e {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2fe5a1 b.36.1.1 (A:223-314) Synapse-associated protein 102 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uita_ b.36.1.1 (A:) Discs large 5 protein KIAA0583 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fcfa1 b.36.1.1 (A:1148-1243) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2i6va1 b.36.1.5 (A:219-305) General secretion pathway protein C, EpsC {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1g9oa_ b.36.1.1 (A:) Na+/H+ exchanger regulatory factor, NHERF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wifa_ b.36.1.1 (A:) hypothetical PDZ domain containing protein Uqcrc2 (4930408O21Rik) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1vb7a_ b.36.1.1 (A:) PDZ-LIM protein mystique {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ueza_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rgra_ b.36.1.1 (A:) Synaptic protein PSD-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1x45a1 b.36.1.1 (A:8-92) Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uf1a_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihja_ b.36.1.1 (A:) Inad {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1wi2a_ b.36.1.1 (A:) PDZ domain containing protein 11, Pdzk11 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1q3oa_ b.36.1.1 (A:) Shank1, PDZ domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1whaa_ b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf8a1 b.36.1.1 (A:8-101) Neurabin-i {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n7ea_ b.36.1.1 (A:) Glutamate receptor-interacting protein 1, GRIP1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1k32a1 b.36.1.3 (A:763-853) Tricorn protease {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1fc6a3 b.36.1.3 (A:157-248) Photosystem II D1 C-terminal processing protease {Algae (Scenedesmus obliquus) [TaxId: 3088]} Back     information, alignment and structure
>d2h3la1 b.36.1.1 (A:1310-1412) Erbin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ueqa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5na1 b.36.1.1 (A:8-108) Harmonin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uhpa_ b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kwaa_ b.36.1.1 (A:) Cask/Lin-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qava_ b.36.1.1 (A:) Syntrophin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uepa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p1da2 b.36.1.1 (A:115-213) Glutamate receptor interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1qaua_ b.36.1.1 (A:) Neuronal nitric oxide synthase, NNOS {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1j16a_ b.47.1.2 (A:) Trypsin(ogen) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1uewa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v5la_ b.36.1.1 (A:) Alpha-actinin-2 associated LIM protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1tp5a1 b.36.1.1 (A:302-403) Synaptic protein PSD-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1vaea_ b.36.1.1 (A:) Rhophilin-2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2csja1 b.36.1.1 (A:8-111) Tight junction protein ZO-2, Tjp2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1va8a1 b.36.1.1 (A:8-107) Maguk p55 subfamily member 5 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cssa1 b.36.1.1 (A:8-115) Regulating synaptic membrane exocytosis protein 1, RIMS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ujda_ b.36.1.1 (A:) Hypothetical protein KIAA0559 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gdna_ b.47.1.2 (A:) Trypsin(ogen) {Mold (Fusarium oxysporum) [TaxId: 5507]} Back     information, alignment and structure
>d1v62a_ b.36.1.1 (A:) Glutamate receptor interacting protein 2, GRIP2 (KIAA1719) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1um1a_ b.36.1.1 (A:) Hypothetical protein KIAA1849 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rzxa_ b.36.1.1 (A:) GTPase-binding domain of the cell polarity protein par6 (Par-6B) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ujua_ b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r6ja_ b.36.1.1 (A:) Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi4a1 b.36.1.1 (A:8-103) Syntaxin binding protein 4 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wf7a_ b.36.1.1 (A:) Enigma homolog ENH {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1y7na1 b.36.1.1 (A:12-90) Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f0aa1 b.36.1.1 (A:251-342) Segment polarity protein dishevelled homolog Dvl-2 {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d1w9ea1 b.36.1.1 (A:110-194) Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fnea1 b.36.1.1 (A:1955-2042) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wh1a_ b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozia_ b.36.1.1 (A:) Phosphatase hPTP1e {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1v6ba_ b.36.1.1 (A:) Harmonin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1hj8a_ b.47.1.2 (A:) Trypsin(ogen) {North atlantic salmon (Salmo salar) [TaxId: 8030]} Back     information, alignment and structure
>d1x5qa1 b.36.1.1 (A:8-104) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rgwa_ b.36.1.1 (A:) Zasp (Cypher, Oracle 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i16a_ b.36.1.2 (A:) Interleukin 16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1azza_ b.47.1.2 (A:) Crab collagenase {Atlantic sand fiddler crab (Uca pugilator) [TaxId: 6772]} Back     information, alignment and structure
>d2f5ya1 b.36.1.1 (A:19-95) Regulator of G-protein signaling 3, RGS3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ra1 b.36.1.1 (A:8-106) Glutamate receptor interacting protein 2, GRIP2 (KIAA1719) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fxya_ b.47.1.2 (A:) Coagulation factor Xa-trypsin chimera {Synthetic, based on Homo sapiens sequence} Back     information, alignment and structure
>d1vaea_ b.36.1.1 (A:) Rhophilin-2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1eufa_ b.47.1.2 (A:) Duodenase {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1lo6a_ b.47.1.2 (A:) Kallikrein 6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1op0a_ b.47.1.2 (A:) Venom serine protease {Hundred-pace snake (Agkistrodon acutus) [TaxId: 36307]} Back     information, alignment and structure
>d1autc_ b.47.1.2 (C:) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m5za_ b.36.1.1 (A:) Glutamate receptor interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1q3oa_ b.36.1.1 (A:) Shank1, PDZ domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1uf1a_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v5qa_ b.36.1.1 (A:) Glutamate receptor interacting protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ao5a_ b.47.1.2 (A:) Kallikrein-13 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1t2ma1 b.36.1.1 (A:2-93) Afadin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wfva_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg6a_ b.36.1.1 (A:) Partitioning-defective 3-like protein, PAR3-L (RIKEN cDNA 2810455b10) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x6da1 b.36.1.2 (A:8-114) Interleukin 16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nn6a_ b.47.1.2 (A:) Chymase (mast cell protease I) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fe5a1 b.36.1.1 (A:223-314) Synapse-associated protein 102 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mzaa_ b.47.1.2 (A:) Granzyme K {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hj9a_ b.47.1.2 (A:) Trypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1xx9a_ b.47.1.2 (A:) Coagulation factor XI {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fuja_ b.47.1.2 (A:) Myeloblastin, PR3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1npma_ b.47.1.2 (A:) Neuropsin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2z7fe1 b.47.1.2 (E:16-243) Elastase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p1da2 b.36.1.1 (A:115-213) Glutamate receptor interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ufxa_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fi8a_ b.47.1.2 (A:) Granzyme B {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1rgra_ b.36.1.1 (A:) Synaptic protein PSD-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2hlca_ b.47.1.2 (A:) HL collagenase {Common cattle grub (Hypoderma lineatum) [TaxId: 7389]} Back     information, alignment and structure
>d2fcfa1 b.36.1.1 (A:1148-1243) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wh1a_ b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cs5a1 b.36.1.1 (A:8-113) Tyrosine-protein phosphatase non-receptor type 4, PTPN4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bioa_ b.47.1.2 (A:) Factor D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h3la1 b.36.1.1 (A:1310-1412) Erbin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sgfa_ b.47.1.2 (A:) 7S NGF protease subunits {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ihja_ b.36.1.1 (A:) Inad {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1vb7a_ b.36.1.1 (A:) PDZ-LIM protein mystique {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1qava_ b.36.1.1 (A:) Syntrophin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1si5h_ b.47.1.2 (H:) Hepatocyte growth factor, HGF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tona_ b.47.1.2 (A:) Tonin {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d2bz6h1 b.47.1.2 (H:16-257) Coagulation factor VIIa {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g9oa_ b.36.1.1 (A:) Na+/H+ exchanger regulatory factor, NHERF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elta_ b.47.1.2 (A:) Elastase {Salmon (Salmo salar) [TaxId: 8030]} Back     information, alignment and structure
>d1wf8a1 b.36.1.1 (A:8-101) Neurabin-i {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wifa_ b.36.1.1 (A:) hypothetical PDZ domain containing protein Uqcrc2 (4930408O21Rik) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ujva_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gvza_ b.47.1.2 (A:) Prostate specific antigen (PSA kallikrein) {Horse (Equus caballus) [TaxId: 9796]} Back     information, alignment and structure
>d1arba_ b.47.1.1 (A:) Achromobacter protease {Achromobacter lyticus, strain m497-1 [TaxId: 224]} Back     information, alignment and structure
>d1n7ea_ b.36.1.1 (A:) Glutamate receptor-interacting protein 1, GRIP1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a7sa_ b.47.1.2 (A:) Heparin binding protein, HBP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi2a_ b.36.1.1 (A:) PDZ domain containing protein 11, Pdzk11 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1os8a_ b.47.1.1 (A:) Trypsin {Streptomyces griseus, strain k1 [TaxId: 1911]} Back     information, alignment and structure
>d1rfna_ b.47.1.2 (A:) Coagulation factor IXa, protease domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ueqa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i16a_ b.36.1.2 (A:) Interleukin 16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1orfa_ b.47.1.2 (A:) Granzyme A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uhpa_ b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf7a_ b.36.1.1 (A:) Enigma homolog ENH {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1elva1 b.47.1.2 (A:410-668) Complement C1S protease, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1eq9a_ b.47.1.2 (A:) (alpha,gamma)-chymotrypsin(ogen) {Red fire ant (Solenopsis invicta) [TaxId: 13686]} Back     information, alignment and structure
>d1wi4a1 b.36.1.1 (A:8-103) Syntaxin binding protein 4 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1z8ga1 b.47.1.2 (A:163-417) Hepsin, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whaa_ b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ujda_ b.36.1.1 (A:) Hypothetical protein KIAA0559 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ekbb_ b.47.1.2 (B:) Enteropeptidase (enterokinase light chain) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1t32a1 b.47.1.2 (A:16-244) Cathepsin G {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2p3ub1 b.47.1.2 (B:16-243) Coagulation factor Xa, protease domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1brup_ b.47.1.2 (P:) Elastase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2f0aa1 b.36.1.1 (A:251-342) Segment polarity protein dishevelled homolog Dvl-2 {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d2cssa1 b.36.1.1 (A:8-115) Regulating synaptic membrane exocytosis protein 1, RIMS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v5la_ b.36.1.1 (A:) Alpha-actinin-2 associated LIM protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2csja1 b.36.1.1 (A:8-111) Tight junction protein ZO-2, Tjp2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2qy0b1 b.47.1.2 (B:447-686) Complement C1R protease, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qaua_ b.36.1.1 (A:) Neuronal nitric oxide synthase, NNOS {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1uepa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uita_ b.36.1.1 (A:) Discs large 5 protein KIAA0583 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fq3a_ b.47.1.2 (A:) Granzyme B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x45a1 b.36.1.1 (A:8-92) Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3rp2a_ b.47.1.2 (A:) Chymase II (mast cell proteinase II) {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d1uewa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1um1a_ b.36.1.1 (A:) Hypothetical protein KIAA1849 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rzxa_ b.36.1.1 (A:) GTPase-binding domain of the cell polarity protein par6 (Par-6B) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1rjxb_ b.47.1.2 (B:) Plasmin(ogen), catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tp5a1 b.36.1.1 (A:302-403) Synaptic protein PSD-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1pytd_ b.47.1.2 (D:) (alpha,gamma)-chymotrypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2f91a1 b.47.1.2 (A:16-244) Trypsin(ogen) {Narrow-clawed crayfish (Pontastacus leptodactylus) [TaxId: 6717]} Back     information, alignment and structure
>d1ueza_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gvkb_ b.47.1.2 (B:) Elastase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1kwaa_ b.36.1.1 (A:) Cask/Lin-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fona_ b.47.1.2 (A:) Procarboxypeptidase A-S6 subunit III (zymogen E) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ujua_ b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1eaxa_ b.47.1.2 (A:) Matriptase MTSP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rrka1 b.47.1.2 (A:453-739) Factor B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fpza1 b.47.1.2 (A:16-244) beta-Tryptase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cs5a1 b.36.1.1 (A:8-113) Tyrosine-protein phosphatase non-receptor type 4, PTPN4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y7na1 b.36.1.1 (A:12-90) Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q3xa1 b.47.1.2 (A:445-686) Mannan-binding lectin serine protease 2 (MASP-2), catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v62a_ b.36.1.1 (A:) Glutamate receptor interacting protein 2, GRIP2 (KIAA1719) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5na1 b.36.1.1 (A:8-108) Harmonin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r6ja_ b.36.1.1 (A:) Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6da1 b.36.1.2 (A:8-114) Interleukin 16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v5qa_ b.36.1.1 (A:) Glutamate receptor interacting protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1va8a1 b.36.1.1 (A:8-107) Maguk p55 subfamily member 5 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2fnea1 b.36.1.1 (A:1955-2042) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ra1 b.36.1.1 (A:8-106) Glutamate receptor interacting protein 2, GRIP2 (KIAA1719) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wfva_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mbma_ b.47.1.3 (A:) NSP4 proteinase {Equine arteritis virus, EAV [TaxId: 11047]} Back     information, alignment and structure
>d1l1na_ b.47.1.4 (A:) 3C cysteine protease (picornain 3C) {Human poliovirus 1 Mahoney [TaxId: 12081]} Back     information, alignment and structure
>d1wg6a_ b.36.1.1 (A:) Partitioning-defective 3-like protein, PAR3-L (RIKEN cDNA 2810455b10) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1v6ba_ b.36.1.1 (A:) Harmonin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1m9ua_ b.47.1.2 (A:) Elastase {Worm (Eisenia fetida) [TaxId: 6396]} Back     information, alignment and structure
>d1ujva_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ufxa_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h6ma1 b.47.1.4 (A:1-212) 3C cysteine protease (picornain 3C) {Human hepatitis A virus [TaxId: 208726]} Back     information, alignment and structure