Citrus Sinensis ID: 036612

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100--
MLDGNESLEDKNRPLVDLRDVADVILVVYEKPEAKRRYICTSFAIRMQALAVKIKIMFLNYDYSKSFTKVDEGNLGWKYRPLEESIHDSDKNYEESGILHKE
cccccccccccccccEEHHHHHHHHHHHHccccccccEEEEcccccHHHHHHHHHHHccccccccccccccccccccEEEHHHHHHHHHHHHHHHccccccc
ccccccccccccccEEEHHHHHHHHHHHHccccccccEEEccccccHHHHHHHHHHHcccccccccccHHHHHHcccccccHHHHHHHHHHHHHHccccccc
mldgnesledknrplvdlrdVADVILVVYEKPEAKRRYICTSFAIRMQALAVKIKIMFLNydysksftkvdegnlgwkyrpleesihdsdknyeesgilhke
mldgnesledknrplvdlrdvaDVILVVyekpeakrryICTSFAIRMQALAVKIKIMFLNYDYSKsftkvdegnlgwkyrpleesihdsdknyeesgilhke
MLDGNESLEDKNRPLVDLRDVADVILVVYEKPEAKRRYICTSFAIRMQALAVKIKIMFLNYDYSKSFTKVDEGNLGWKYRPLEESIHDSDKNYEESGILHKE
**************LVDLRDVADVILVVYEKPEAKRRYICTSFAIRMQALAVKIKIMFLNYDYSKSFTKVDEGNLGWKYRP*********************
*LDG***LEDKNRPLVDLRDVADVILVVYEKPEAKRRYICTSFAIRMQALAVKIKIMFLNYDYSKSFTKVDEGNLGWKYRPLEESIHDSDKNYEESGILH**
********EDKNRPLVDLRDVADVILVVYEKPEAKRRYICTSFAIRMQALAVKIKIMFLNYDYSKSFTKVDEGNLGWKYRPLEESIHDSD************
****NESLEDKNRPLVDLRDVADVILVVYEKPEAKRRYICTSFAIRMQALAVKIKIMFLNYDYSKSFTKVDEGNLGWKYRPLEESIHDSDKNYEESGI****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLDGNESLEDKNRPLVDLRDVADVILVVYEKPEAKRRYICTSFAIRMQALAVKIKIMFLNYDYSKSFTKVDEGNLGWKYRPLEESIHDSDKNYEESGILHKE
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query102 2.2.26 [Sep-21-2011]
P51106354 Dihydroflavonol-4-reducta N/A no 0.862 0.248 0.333 2e-05
P51108357 Dihydroflavonol-4-reducta N/A no 0.872 0.249 0.223 0.0006
>sp|P51106|DFRA_HORVU Dihydroflavonol-4-reductase OS=Hordeum vulgare GN=ANT18 PE=3 SV=1 Back     alignment and function desciption
 Score = 48.1 bits (113), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 33/99 (33%), Positives = 48/99 (48%), Gaps = 11/99 (11%)

Query: 1   MLDGNESLED--KNRPLVDLRDVADVILVVYEKPEAKRRYICTSFAIRMQALAVKIKIMF 58
           ++ GNE+     K   LV L D+ D +  ++E PEA  RYIC+S    +  LA  ++  F
Sbjct: 212 LITGNEAHYSILKQVQLVHLDDLCDAMTFLFEHPEANGRYICSSHDATIHGLARMLQDRF 271

Query: 59  LNYDYSKSFTKVDEGNLGWKYRPLEESIHDSDKNYEESG 97
             YD  + F  VD+ NL        + IH S K   + G
Sbjct: 272 PEYDIPQKFAGVDD-NL--------QPIHFSSKKLLDHG 301

Hordeum vulgare (taxid: 4513)
EC: 1EC: .EC: 1EC: .EC: 1EC: .EC: 2EC: 1EC: 9
>sp|P51108|DFRA_MAIZE Dihydroflavonol-4-reductase OS=Zea mays GN=A1 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query102
225446901 322 PREDICTED: bifunctional dihydroflavonol 0.960 0.304 0.527 7e-25
359485168 320 PREDICTED: bifunctional dihydroflavonol 0.970 0.309 0.509 6e-24
147843934 272 hypothetical protein VITISV_003030 [Viti 0.970 0.363 0.509 7e-24
224061829 319 predicted protein [Populus trichocarpa] 0.950 0.304 0.518 2e-22
359495058 323 PREDICTED: bifunctional dihydroflavonol 0.970 0.306 0.472 2e-22
225457658 318 PREDICTED: bifunctional dihydroflavonol 0.950 0.305 0.509 3e-22
147770305 268 hypothetical protein VITISV_028852 [Viti 0.901 0.343 0.5 1e-21
225457656 323 PREDICTED: bifunctional dihydroflavonol 0.960 0.303 0.495 9e-21
359491872 312 PREDICTED: bifunctional dihydroflavonol 0.960 0.314 0.495 1e-20
225457654 319 PREDICTED: bifunctional dihydroflavonol 0.950 0.304 0.481 2e-20
>gi|225446901|ref|XP_002280095.1| PREDICTED: bifunctional dihydroflavonol 4-reductase/flavanone 4-reductase [Vitis vinifera] gi|296086338|emb|CBI31779.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  117 bits (294), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 57/108 (52%), Positives = 80/108 (74%), Gaps = 10/108 (9%)

Query: 3   DGNESLEDKNRPLVDLRDVADVILVVYEKPEAKRRYICTSFAIRMQALAVKIKIMFLNYD 62
           DG ES+E+K+RP++D+RD+A+ IL+VYEKPEA+ RYIC+S+ I  Q L  K+K M+ NY+
Sbjct: 215 DGPESVENKDRPIIDVRDLAEAILLVYEKPEAQGRYICSSYTISTQELVEKLKSMYPNYN 274

Query: 63  YSKSFTKVDEG---------NLGWKYRPLEESIHDSDKNYEESGILHK 101
           Y KS+T V EG          LGWKYRPLEE++ D+ K+++E+G L K
Sbjct: 275 YPKSYTAV-EGLKLSSEKLQGLGWKYRPLEETLVDAVKSFQENGFLPK 321

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|359485168|ref|XP_002280010.2| PREDICTED: bifunctional dihydroflavonol 4-reductase/flavanone 4-reductase-like [Vitis vinifera] gi|296086331|emb|CBI31772.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|147843934|emb|CAN83703.1| hypothetical protein VITISV_003030 [Vitis vinifera] Back     alignment and taxonomy information
>gi|224061829|ref|XP_002300619.1| predicted protein [Populus trichocarpa] gi|222842345|gb|EEE79892.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|359495058|ref|XP_002267718.2| PREDICTED: bifunctional dihydroflavonol 4-reductase/flavanone 4-reductase-like [Vitis vinifera] gi|296081291|emb|CBI17735.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|225457658|ref|XP_002275562.1| PREDICTED: bifunctional dihydroflavonol 4-reductase/flavanone 4-reductase [Vitis vinifera] gi|297745607|emb|CBI40772.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|147770305|emb|CAN60237.1| hypothetical protein VITISV_028852 [Vitis vinifera] Back     alignment and taxonomy information
>gi|225457656|ref|XP_002275531.1| PREDICTED: bifunctional dihydroflavonol 4-reductase/flavanone 4-reductase isoform 1 [Vitis vinifera] gi|297745606|emb|CBI40771.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|359491872|ref|XP_003634335.1| PREDICTED: bifunctional dihydroflavonol 4-reductase/flavanone 4-reductase isoform 2 [Vitis vinifera] Back     alignment and taxonomy information
>gi|225457654|ref|XP_002275693.1| PREDICTED: bifunctional dihydroflavonol 4-reductase/flavanone 4-reductase [Vitis vinifera] gi|297745605|emb|CBI40770.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query102
TAIR|locus:2051018321 CRL2 "CCR(Cinnamoyl coA:NADP o 0.950 0.302 0.424 5.8e-18
TAIR|locus:2051008321 CRL1 "CCR(Cinnamoyl coA:NADP o 0.950 0.302 0.377 5.3e-16
TAIR|locus:2011741325 AT1G76470 [Arabidopsis thalian 0.960 0.301 0.440 1.3e-15
TAIR|locus:2051018 CRL2 "CCR(Cinnamoyl coA:NADP oxidoreductase)-like 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 218 (81.8 bits), Expect = 5.8e-18, P = 5.8e-18
 Identities = 45/106 (42%), Positives = 68/106 (64%)

Query:     3 DGNESLEDKNRPLVDLRDVADVILVVYEKPEAKRRYICTSFAIRMQALAVKIKIMFLNYD 62
             +G ES  ++ R LVD+RDVA  +L+VYEK EA+ RYIC    +R Q +A K+K ++LNY+
Sbjct:   215 EGYESRNNQERHLVDVRDVAQALLLVYEKAEAEGRYICIGHTVREQEVAEKLKSLYLNYN 274

Query:    63 YSKSFTKVDEG---------NLGWKYRPLEESIHDSDKNYEESGIL 99
             Y K + + D            LGW YRPLEE++ DS ++Y ++ ++
Sbjct:   275 YPKRYIEADGKVKVSSEKLQKLGWTYRPLEETLVDSVESYRKAKLV 320
GO:0000166 "nucleotide binding" evidence=IEA
GO:0003824 "catalytic activity" evidence=IEA
GO:0009809 "lignin biosynthetic process" evidence=ISS
GO:0016621 "cinnamoyl-CoA reductase activity" evidence=ISS
GO:0044237 "cellular metabolic process" evidence=IEA
GO:0050662 "coenzyme binding" evidence=IEA
TAIR|locus:2051008 CRL1 "CCR(Cinnamoyl coA:NADP oxidoreductase)-like 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2011741 AT1G76470 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query102
cd08958293 cd08958, FR_SDR_e, flavonoid reductase (FR), exten 1e-12
PLN02662322 PLN02662, PLN02662, cinnamyl-alcohol dehydrogenase 9e-05
cd05227301 cd05227, AR_SDR_e, aldehyde reductase, extended (e 3e-04
PLN02650351 PLN02650, PLN02650, dihydroflavonol-4-reductase 3e-04
>gnl|CDD|187661 cd08958, FR_SDR_e, flavonoid reductase (FR), extended (e) SDRs Back     alignment and domain information 
 Score = 61.4 bits (150), Expect = 1e-12
 Identities = 25/74 (33%), Positives = 38/74 (51%), Gaps = 1/74 (1%)

Query: 1   MLDGN-ESLEDKNRPLVDLRDVADVILVVYEKPEAKRRYICTSFAIRMQALAVKIKIMFL 59
           +L GN E  ++ +  LV + DVAD  +++YEKP A  RYIC+S  +    LA  +   + 
Sbjct: 204 LLKGNAEMYQNGSLALVHVDDVADAHILLYEKPSASGRYICSSHVVTRPELAALLAKKYP 263

Query: 60  NYDYSKSFTKVDEG 73
            Y+    F     G
Sbjct: 264 QYNIPTKFEDDQPG 277

This subgroup contains FRs of the extended SDR-type and related proteins. These FRs act in the NADP-dependent reduction of flavonoids, ketone-containing plant secondary metabolites; they have the characteristic active site triad of the SDRs (though not the upstream active site Asn) and a NADP-binding motif that is very similar to the typical extended SDR motif. Extended SDRs are distinct from classical SDRs. In addition to the Rossmann fold (alpha/beta folding pattern with a central beta-sheet) core region typical of all SDRs, extended SDRs have a less conserved C-terminal extension of approximately 100 amino acids. Extended SDRs are a diverse collection of proteins, and include isomerases, epimerases, oxidoreductases, and lyases; they typically have a TGXXGXXG cofactor binding motif. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold, an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Sequence identity between different SDR enzymes is typically in the 15-30% range; they catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase numbering). In addition to the Tyr and Lys, there is often an upstream Ser and/or an Asn, contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. Atypical SDRs generally lack the catalytic residues characteristic of the SDRs, and their glycine-rich NAD(P)-binding motif is often different from the forms normally seen in classical or extended SDRs. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif. Length = 293
>gnl|CDD|178268 PLN02662, PLN02662, cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>gnl|CDD|187538 cd05227, AR_SDR_e, aldehyde reductase, extended (e) SDRs Back     alignment and domain information
>gnl|CDD|178256 PLN02650, PLN02650, dihydroflavonol-4-reductase Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 102
KOG1502327 consensus Flavonol reductase/cinnamoyl-CoA reducta 99.83
PLN02214342 cinnamoyl-CoA reductase 99.81
PLN02986322 cinnamyl-alcohol dehydrogenase family protein 99.74
PLN02662322 cinnamyl-alcohol dehydrogenase family protein 99.71
PLN00198338 anthocyanidin reductase; Provisional 99.67
PLN02650351 dihydroflavonol-4-reductase 99.66
PLN02989325 cinnamyl-alcohol dehydrogenase family protein 99.66
PLN02896353 cinnamyl-alcohol dehydrogenase 99.6
COG1087329 GalE UDP-glucose 4-epimerase [Cell envelope biogen 99.52
TIGR03466328 HpnA hopanoid-associated sugar epimerase. The sequ 99.48
COG1088340 RfbB dTDP-D-glucose 4,6-dehydratase [Cell envelope 99.46
PLN02427386 UDP-apiose/xylose synthase 99.44
PLN02653340 GDP-mannose 4,6-dehydratase 99.43
TIGR01472343 gmd GDP-mannose 4,6-dehydratase. Excluded from thi 99.43
PRK15181348 Vi polysaccharide biosynthesis protein TviC; Provi 99.42
PRK10217355 dTDP-glucose 4,6-dehydratase; Provisional 99.42
PLN00016378 RNA-binding protein; Provisional 99.41
PLN02240352 UDP-glucose 4-epimerase 99.4
TIGR02622349 CDP_4_6_dhtase CDP-glucose 4,6-dehydratase. Member 99.37
PRK10675338 UDP-galactose-4-epimerase; Provisional 99.36
TIGR01181317 dTDP_gluc_dehyt dTDP-glucose 4,6-dehydratase. This 99.36
PLN02206442 UDP-glucuronate decarboxylase 99.34
PRK11908347 NAD-dependent epimerase/dehydratase family protein 99.34
PLN02166436 dTDP-glucose 4,6-dehydratase 99.33
PRK10084352 dTDP-glucose 4,6 dehydratase; Provisional 99.33
PRK08125660 bifunctional UDP-glucuronic acid decarboxylase/UDP 99.33
KOG0747331 consensus Putative NAD+-dependent epimerases [Carb 99.31
PLN02725306 GDP-4-keto-6-deoxymannose-3,5-epimerase-4-reductas 99.28
TIGR02197314 heptose_epim ADP-L-glycero-D-manno-heptose-6-epime 99.28
PLN02572442 UDP-sulfoquinovose synthase 99.26
PRK11150308 rfaD ADP-L-glycero-D-mannoheptose-6-epimerase; Pro 99.26
PLN02260 668 probable rhamnose biosynthetic enzyme 99.24
PLN02583297 cinnamoyl-CoA reductase 99.24
PLN02695370 GDP-D-mannose-3',5'-epimerase 99.23
TIGR01179328 galE UDP-glucose-4-epimerase. This enzyme intercon 99.18
KOG1429350 consensus dTDP-glucose 4-6-dehydratase/UDP-glucuro 99.17
PRK05865 854 hypothetical protein; Provisional 99.16
TIGR01214287 rmlD dTDP-4-dehydrorhamnose reductase. This enzyme 99.12
KOG1431315 consensus GDP-L-fucose synthetase [Carbohydrate tr 99.05
COG0451314 WcaG Nucleoside-diphosphate-sugar epimerases [Cell 98.98
KOG1371343 consensus UDP-glucose 4-epimerase/UDP-sulfoquinovo 98.98
COG1090297 Predicted nucleoside-diphosphate sugar epimerase [ 98.89
TIGR01777292 yfcH conserved hypothetical protein TIGR01777. Thi 98.85
TIGR03589324 PseB UDP-N-acetylglucosamine 4,6-dehydratase. This 98.8
PLN02686367 cinnamoyl-CoA reductase 98.79
PRK09987299 dTDP-4-dehydrorhamnose reductase; Provisional 98.6
KOG3019315 consensus Predicted nucleoside-diphosphate sugar e 98.35
CHL00194317 ycf39 Ycf39; Provisional 98.31
PF04321286 RmlD_sub_bind: RmlD substrate binding domain; Inte 98.27
COG1089345 Gmd GDP-D-mannose dehydratase [Cell envelope bioge 98.22
TIGR03649285 ergot_EASG ergot alkaloid biosynthesis protein, AF 98.16
PF01073280 3Beta_HSD: 3-beta hydroxysteroid dehydrogenase/iso 98.16
PLN02996491 fatty acyl-CoA reductase 97.97
PLN02778298 3,5-epimerase/4-reductase 97.84
PRK12320 699 hypothetical protein; Provisional 97.83
PRK07201 657 short chain dehydrogenase; Provisional 97.78
KOG1372376 consensus GDP-mannose 4,6 dehydratase [Carbohydrat 97.74
TIGR01746367 Thioester-redct thioester reductase domain. It has 97.72
COG1091281 RfbD dTDP-4-dehydrorhamnose reductase [Cell envelo 97.59
PF01370236 Epimerase: NAD dependent epimerase/dehydratase fam 97.58
PLN02657390 3,8-divinyl protochlorophyllide a 8-vinyl reductas 97.56
PF1395062 Epimerase_Csub: UDP-glucose 4-epimerase C-term sub 97.48
KOG2865391 consensus NADH:ubiquinone oxidoreductase, NDUFA9/3 97.14
KOG1430361 consensus C-3 sterol dehydrogenase/3-beta-hydroxys 96.61
PF05368233 NmrA: NmrA-like family; InterPro: IPR008030 NmrA i 95.9
PLN02260668 probable rhamnose biosynthetic enzyme 95.82
KOG2774366 consensus NAD dependent epimerase [General functio 95.39
TIGR034431389 alpha_am_amid L-aminoadipate-semialdehyde dehydrog 95.13
PLN02503605 fatty acyl-CoA reductase 2 95.02
PRK06482276 short chain dehydrogenase; Provisional 94.95
PRK07806248 short chain dehydrogenase; Provisional 93.82
PRK08263275 short chain dehydrogenase; Provisional 93.4
PRK06077252 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 92.84
PRK07074257 short chain dehydrogenase; Provisional 92.8
PLN00141251 Tic62-NAD(P)-related group II protein; Provisional 92.21
TIGR01963255 PHB_DH 3-hydroxybutyrate dehydrogenase. This model 91.76
PRK13394262 3-hydroxybutyrate dehydrogenase; Provisional 91.16
COG0702275 Predicted nucleoside-diphosphate-sugar epimerases 90.62
PRK07775274 short chain dehydrogenase; Provisional 89.71
PRK12429258 3-hydroxybutyrate dehydrogenase; Provisional 89.11
PRK05875276 short chain dehydrogenase; Provisional 87.47
PRK06914280 short chain dehydrogenase; Provisional 86.66
PRK12935247 acetoacetyl-CoA reductase; Provisional 84.76
PRK05876275 short chain dehydrogenase; Provisional 84.66
PRK06180277 short chain dehydrogenase; Provisional 84.15
PRK08219227 short chain dehydrogenase; Provisional 83.46
PF02719293 Polysacc_synt_2: Polysaccharide biosynthesis prote 81.98
PRK12826251 3-ketoacyl-(acyl-carrier-protein) reductase; Revie 81.08
>KOG1502 consensus Flavonol reductase/cinnamoyl-CoA reductase [Defense mechanisms] Back     alignment and domain information 
Probab=99.83  E-value=3.9e-20  Score=127.77  Aligned_cols=100  Identities=32%  Similarity=0.533  Sum_probs=87.5

Q ss_pred             CCCCCcccCCCCCCceeHHHHHHHHHHHhcCCCCCccEEEecCcccHHHHHHHHHHHcCCCcCCCcccCC----------
Q 036612            1 MLDGNESLEDKNRPLVDLRDVADVILVVYEKPEAKRRYICTSFAIRMQALAVKIKIMFLNYDYSKSFTKV----------   70 (102)
Q Consensus         1 ~~g~~~~~~~~~~~~v~V~Dva~a~v~a~~~~~~~~~~~~~~~~~s~~ei~~~i~~~~p~~~~p~~~~~~----------   70 (102)
                      |+|....+++.+..||||+|||+||++|++++.+.|||+|.++..++.|+++++.+.+|.+++|....+.          
T Consensus       214 i~G~~~~~~n~~~~~VdVrDVA~AHv~a~E~~~a~GRyic~~~~~~~~ei~~~l~~~~P~~~ip~~~~~~~~~~~~~~~~  293 (327)
T KOG1502|consen  214 IKGLAETYPNFWLAFVDVRDVALAHVLALEKPSAKGRYICVGEVVSIKEIADILRELFPDYPIPKKNAEEHEGFLTSFKV  293 (327)
T ss_pred             HhcccccCCCCceeeEeHHHHHHHHHHHHcCcccCceEEEecCcccHHHHHHHHHHhCCCCCCCCCCCcccccccccccc
Confidence            5788889999999999999999999999999999999999998888999999999999988887654322          


Q ss_pred             --C-cCcCC-CeecCHHHHHHHHHHHHHHcCCCC
Q 036612           71 --D-EGNLG-WKYRPLEESIHDSDKNYEESGILH  100 (102)
Q Consensus        71 --~-~~~lg-~~~~~l~e~i~~~~~~~~~~~~~~  100 (102)
                        + .+.|| |++++++|++.+++.++++.|.+.
T Consensus       294 ~~~k~k~lg~~~~~~l~e~~~dt~~sl~~~~~l~  327 (327)
T KOG1502|consen  294 SSEKLKSLGGFKFRPLEETLSDTVESLREKGLLL  327 (327)
T ss_pred             ccHHHHhcccceecChHHHHHHHHHHHHHhcCCC
Confidence              1 25666 899999999999999999998763

>PLN02214 cinnamoyl-CoA reductase Back     alignment and domain information
>PLN02986 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>PLN02662 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>PLN00198 anthocyanidin reductase; Provisional Back     alignment and domain information
>PLN02650 dihydroflavonol-4-reductase Back     alignment and domain information
>PLN02989 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>PLN02896 cinnamyl-alcohol dehydrogenase Back     alignment and domain information
>COG1087 GalE UDP-glucose 4-epimerase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>TIGR03466 HpnA hopanoid-associated sugar epimerase Back     alignment and domain information
>COG1088 RfbB dTDP-D-glucose 4,6-dehydratase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PLN02427 UDP-apiose/xylose synthase Back     alignment and domain information
>PLN02653 GDP-mannose 4,6-dehydratase Back     alignment and domain information
>TIGR01472 gmd GDP-mannose 4,6-dehydratase Back     alignment and domain information
>PRK15181 Vi polysaccharide biosynthesis protein TviC; Provisional Back     alignment and domain information
>PRK10217 dTDP-glucose 4,6-dehydratase; Provisional Back     alignment and domain information
>PLN00016 RNA-binding protein; Provisional Back     alignment and domain information
>PLN02240 UDP-glucose 4-epimerase Back     alignment and domain information
>TIGR02622 CDP_4_6_dhtase CDP-glucose 4,6-dehydratase Back     alignment and domain information
>PRK10675 UDP-galactose-4-epimerase; Provisional Back     alignment and domain information
>TIGR01181 dTDP_gluc_dehyt dTDP-glucose 4,6-dehydratase Back     alignment and domain information
>PLN02206 UDP-glucuronate decarboxylase Back     alignment and domain information
>PRK11908 NAD-dependent epimerase/dehydratase family protein; Provisional Back     alignment and domain information
>PLN02166 dTDP-glucose 4,6-dehydratase Back     alignment and domain information
>PRK10084 dTDP-glucose 4,6 dehydratase; Provisional Back     alignment and domain information
>PRK08125 bifunctional UDP-glucuronic acid decarboxylase/UDP-4-amino-4-deoxy-L-arabinose formyltransferase; Validated Back     alignment and domain information
>KOG0747 consensus Putative NAD+-dependent epimerases [Carbohydrate transport and metabolism] Back     alignment and domain information
>PLN02725 GDP-4-keto-6-deoxymannose-3,5-epimerase-4-reductase Back     alignment and domain information
>TIGR02197 heptose_epim ADP-L-glycero-D-manno-heptose-6-epimerase Back     alignment and domain information
>PLN02572 UDP-sulfoquinovose synthase Back     alignment and domain information
>PRK11150 rfaD ADP-L-glycero-D-mannoheptose-6-epimerase; Provisional Back     alignment and domain information
>PLN02260 probable rhamnose biosynthetic enzyme Back     alignment and domain information
>PLN02583 cinnamoyl-CoA reductase Back     alignment and domain information
>PLN02695 GDP-D-mannose-3',5'-epimerase Back     alignment and domain information
>TIGR01179 galE UDP-glucose-4-epimerase Back     alignment and domain information
>KOG1429 consensus dTDP-glucose 4-6-dehydratase/UDP-glucuronic acid decarboxylase [Carbohydrate transport and metabolism; Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>PRK05865 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01214 rmlD dTDP-4-dehydrorhamnose reductase Back     alignment and domain information
>KOG1431 consensus GDP-L-fucose synthetase [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0451 WcaG Nucleoside-diphosphate-sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG1371 consensus UDP-glucose 4-epimerase/UDP-sulfoquinovose synthase [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>COG1090 Predicted nucleoside-diphosphate sugar epimerase [General function prediction only] Back     alignment and domain information
>TIGR01777 yfcH conserved hypothetical protein TIGR01777 Back     alignment and domain information
>TIGR03589 PseB UDP-N-acetylglucosamine 4,6-dehydratase Back     alignment and domain information
>PLN02686 cinnamoyl-CoA reductase Back     alignment and domain information
>PRK09987 dTDP-4-dehydrorhamnose reductase; Provisional Back     alignment and domain information
>KOG3019 consensus Predicted nucleoside-diphosphate sugar epimerase [Nucleotide transport and metabolism] Back     alignment and domain information
>CHL00194 ycf39 Ycf39; Provisional Back     alignment and domain information
>PF04321 RmlD_sub_bind: RmlD substrate binding domain; InterPro: IPR005913 dTDP-4-dehydrorhamnose reductase (1 Back     alignment and domain information
>COG1089 Gmd GDP-D-mannose dehydratase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>TIGR03649 ergot_EASG ergot alkaloid biosynthesis protein, AFUA_2G17970 family Back     alignment and domain information
>PF01073 3Beta_HSD: 3-beta hydroxysteroid dehydrogenase/isomerase family; InterPro: IPR002225 The enzyme 3 beta-hydroxysteroid dehydrogenase/5-ene-4-ene isomerase (3 beta-HSD) catalyses the oxidation and isomerisation of 5-ene-3 beta-hydroxypregnene and 5-ene-hydroxyandrostene steroid precursors into the corresponding 4-ene-ketosteroids necessary for the formation of all classes of steroid hormones Back     alignment and domain information
>PLN02996 fatty acyl-CoA reductase Back     alignment and domain information
>PLN02778 3,5-epimerase/4-reductase Back     alignment and domain information
>PRK12320 hypothetical protein; Provisional Back     alignment and domain information
>PRK07201 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG1372 consensus GDP-mannose 4,6 dehydratase [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR01746 Thioester-redct thioester reductase domain Back     alignment and domain information
>COG1091 RfbD dTDP-4-dehydrorhamnose reductase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PF01370 Epimerase: NAD dependent epimerase/dehydratase family; InterPro: IPR001509 This family of proteins utilise NAD as a cofactor Back     alignment and domain information
>PLN02657 3,8-divinyl protochlorophyllide a 8-vinyl reductase Back     alignment and domain information
>PF13950 Epimerase_Csub: UDP-glucose 4-epimerase C-term subunit; PDB: 1EK5_A 1I3K_B 1I3M_B 1HZJ_A 1EK6_A 1I3N_A 1I3L_A 2CNB_B 1GY8_D 1NAI_A Back     alignment and domain information
>KOG2865 consensus NADH:ubiquinone oxidoreductase, NDUFA9/39kDa subunit [Energy production and conversion] Back     alignment and domain information
>KOG1430 consensus C-3 sterol dehydrogenase/3-beta-hydroxysteroid dehydrogenase and related dehydrogenases [Lipid transport and metabolism; Amino acid transport and metabolism] Back     alignment and domain information
>PF05368 NmrA: NmrA-like family; InterPro: IPR008030 NmrA is a negative transcriptional regulator involved in the post-translational modification of the transcription factor AreA Back     alignment and domain information
>PLN02260 probable rhamnose biosynthetic enzyme Back     alignment and domain information
>KOG2774 consensus NAD dependent epimerase [General function prediction only] Back     alignment and domain information
>TIGR03443 alpha_am_amid L-aminoadipate-semialdehyde dehydrogenase Back     alignment and domain information
>PLN02503 fatty acyl-CoA reductase 2 Back     alignment and domain information
>PRK06482 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07806 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08263 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06077 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK07074 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN00141 Tic62-NAD(P)-related group II protein; Provisional Back     alignment and domain information
>TIGR01963 PHB_DH 3-hydroxybutyrate dehydrogenase Back     alignment and domain information
>PRK13394 3-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>COG0702 Predicted nucleoside-diphosphate-sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK07775 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12429 3-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>PRK05875 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06914 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12935 acetoacetyl-CoA reductase; Provisional Back     alignment and domain information
>PRK05876 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06180 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08219 short chain dehydrogenase; Provisional Back     alignment and domain information
>PF02719 Polysacc_synt_2: Polysaccharide biosynthesis protein; InterPro: IPR003869 This domain is found in diverse bacterial polysaccharide biosynthesis proteins including the CapD protein from Staphylococcus aureus [], the WalL protein, mannosyl-transferase [], and several putative epimerases Back     alignment and domain information
>PRK12826 3-ketoacyl-(acyl-carrier-protein) reductase; Reviewed Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query102
2p4h_X322 Vestitone reductase; NADPH-dependent reductase, is 3e-19
2rh8_A338 Anthocyanidin reductase; flavonoids, rossmann fold 4e-19
2c29_D337 Dihydroflavonol 4-reductase; flavonoids, short deh 6e-19
1y1p_A342 ARII, aldehyde reductase II; rossmann fold, short 9e-11
2x4g_A342 Nucleoside-diphosphate-sugar epimerase; isomerase; 7e-07
3dhn_A227 NAD-dependent epimerase/dehydratase; reductase, PF 3e-05
>2p4h_X Vestitone reductase; NADPH-dependent reductase, isoflavonoid, plant protein; 1.40A {Medicago sativa} Length = 322 Back     alignment and structure
 Score = 78.8 bits (195), Expect = 3e-19
 Identities = 18/114 (15%), Positives = 43/114 (37%), Gaps = 15/114 (13%)

Query: 1   MLDGN-ESLEDKNRPLVDLRDVADVILVVYEKPEAKRRYICTSFAIRMQALAVKIKIMFL 59
           ++ G  E +      +V + DVA   + + E      RY C+ F + ++ ++  +   + 
Sbjct: 209 LVLGKKEQIGVTRFHMVHVDDVARAHIYLLENSVPGGRYNCSPFIVPIEEMSQLLSAKYP 268

Query: 60  NYDYSKSFTKVDEG-------------NLGWKYR-PLEESIHDSDKNYEESGIL 99
            Y         +               + G+ ++  +E+   D+ +  +E G L
Sbjct: 269 EYQILTVDELKEIKGARLPDLNTKKLVDAGFDFKYTIEDMFDDAIQCCKEKGYL 322
>2rh8_A Anthocyanidin reductase; flavonoids, rossmann fold, short chain dehydrogenase/reductase, oxidoreductase; 2.22A {Vitis vinifera} PDB: 3hfs_A Length = 338 Back     alignment and structure
>2c29_D Dihydroflavonol 4-reductase; flavonoids, short dehydrogenase reductase, NADPH, dihydroquercetin, rossmann fold, oxidoreductase; HET: NAP DQH; 1.81A {Vitis vinifera} PDB: 2iod_A* 2nnl_D* 3bxx_A* 3c1t_A* Length = 337 Back     alignment and structure
>1y1p_A ARII, aldehyde reductase II; rossmann fold, short chain dehydrogenase reductase, oxidoreductase; HET: NMN AMP; 1.60A {Sporidiobolus salmonicolor} SCOP: c.2.1.2 PDB: 1ujm_A* 1zze_A Length = 342 Back     alignment and structure
>2x4g_A Nucleoside-diphosphate-sugar epimerase; isomerase; 2.65A {Pseudomonas aeruginosa} Length = 342 Back     alignment and structure
>3dhn_A NAD-dependent epimerase/dehydratase; reductase, PF01370, Q89Z24_bactn, NESG, BTR310, structural genomics, PSI-2; 2.00A {Bacteroides thetaiotaomicron} Length = 227 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query102
2rh8_A338 Anthocyanidin reductase; flavonoids, rossmann fold 99.59
2p4h_X322 Vestitone reductase; NADPH-dependent reductase, is 99.56
2c29_D337 Dihydroflavonol 4-reductase; flavonoids, short deh 99.55
3enk_A341 UDP-glucose 4-epimerase; seattle structural genomi 99.46
3ko8_A312 NAD-dependent epimerase/dehydratase; isomerase, UD 99.43
3m2p_A311 UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J 99.42
4egb_A346 DTDP-glucose 4,6-dehydratase; rhamnose pathway, ce 99.41
3ehe_A313 UDP-glucose 4-epimerase (GALE-1); PSI-II, NYSGXRC, 99.4
4b4o_A298 Epimerase family protein SDR39U1; isomerase; HET: 99.4
3ruf_A351 WBGU; rossmann fold, UDP-hexose 4-epimerase, isome 99.39
4b8w_A319 GDP-L-fucose synthase; oxidoreductase; HET: NAP GD 99.39
2x4g_A342 Nucleoside-diphosphate-sugar epimerase; isomerase; 99.38
1ek6_A348 UDP-galactose 4-epimerase; short-chain dehydrogena 99.38
2yy7_A312 L-threonine dehydrogenase; thermolabIle, flavobact 99.38
2p5y_A311 UDP-glucose 4-epimerase; TTHA0591, structural geno 99.37
3vps_A321 TUNA, NAD-dependent epimerase/dehydratase; tunicam 99.37
1udb_A338 Epimerase, UDP-galactose-4-epimerase; isomerase; H 99.36
3slg_A372 PBGP3 protein; structural genomics, seattle struct 99.36
4id9_A347 Short-chain dehydrogenase/reductase; putative dehy 99.36
3ajr_A317 NDP-sugar epimerase; L-threonine dehydrogenase, L- 99.35
2pzm_A330 Putative nucleotide sugar epimerase/ dehydratase; 99.34
3sxp_A362 ADP-L-glycero-D-mannoheptose-6-epimerase; rossman 99.34
1e6u_A321 GDP-fucose synthetase; epimerase/reductase, SDR, R 99.33
2bll_A345 Protein YFBG; decarboxylase, short chain dehydroge 99.33
2v6g_A364 Progesterone 5-beta-reductase; tyrosine-dependent 99.33
2b69_A343 UDP-glucuronate decarboxylase 1; UDP-glucoronic ac 99.32
3gpi_A286 NAD-dependent epimerase/dehydratase; structural ge 99.31
1rpn_A335 GDP-mannose 4,6-dehydratase; short-chain dehydroge 99.3
1gy8_A397 UDP-galactose 4-epimerase; oxidoreductase; HET: NA 99.29
2c20_A330 UDP-glucose 4-epimerase; carbohydrate metabolism, 99.29
2pk3_A321 GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, shor 99.29
1db3_A372 GDP-mannose 4,6-dehydratase; NADP, GDP-fucose, lya 99.29
1t2a_A375 GDP-mannose 4,6 dehydratase; structural genomics c 99.29
2q1w_A333 Putative nucleotide sugar epimerase/ dehydratase; 99.28
1n7h_A381 GDP-D-mannose-4,6-dehydratase; rossmann fold, SDR, 99.28
2c5a_A379 GDP-mannose-3', 5'-epimerase; short chain dehydrat 99.27
1sb8_A352 WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCN 99.27
1orr_A347 CDP-tyvelose-2-epimerase; rossmann fold, short-cha 99.27
3sc6_A287 DTDP-4-dehydrorhamnose reductase; RFBD, structural 99.27
1rkx_A357 CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 99.27
2hun_A336 336AA long hypothetical DTDP-glucose 4,6-dehydrat; 99.27
3ius_A286 Uncharacterized conserved protein; APC63810, silic 99.26
1oc2_A348 DTDP-glucose 4,6-dehydratase; lyase, NADH, rhamnos 99.26
1vl0_A292 DTDP-4-dehydrorhamnose reductase, RFBD ortholog; s 99.25
1i24_A404 Sulfolipid biosynthesis protein SQD1; SDR, short-c 99.25
1r6d_A337 TDP-glucose-4,6-dehydratase; rossmann fold, short- 99.25
2z1m_A345 GDP-D-mannose dehydratase; short-chain dehydrogena 99.25
2q1s_A377 Putative nucleotide sugar epimerase/ dehydratase; 99.24
1n2s_A299 DTDP-4-, DTDP-glucose oxidoreductase; rossman-fold 99.23
1eq2_A310 ADP-L-glycero-D-mannoheptose 6-epimerase; N-termin 99.21
1z45_A 699 GAL10 bifunctional protein; epimerase, mutarotase, 99.2
1kew_A361 RMLB;, DTDP-D-glucose 4,6-dehydratase; rossmann fo 99.19
2x6t_A357 ADP-L-glycero-D-manno-heptose-6-epimerase; isomera 99.17
1y1p_A342 ARII, aldehyde reductase II; rossmann fold, short 99.17
1z7e_A660 Protein aRNA; rossmann fold, OB-like fold, hydrola 99.13
2hrz_A342 AGR_C_4963P, nucleoside-diphosphate-sugar epimeras 99.09
2zcu_A286 Uncharacterized oxidoreductase YTFG; alpha-beta sa 99.03
2ydy_A315 Methionine adenosyltransferase 2 subunit beta; oxi 99.03
3oh8_A516 Nucleoside-diphosphate sugar epimerase (SULA FAMI; 98.89
2jl1_A287 Triphenylmethane reductase; oxidoreductase, biorem 98.78
2ggs_A273 273AA long hypothetical DTDP-4-dehydrorhamnose red 98.55
3e48_A289 Putative nucleoside-diphosphate-sugar epimerase; a 98.12
3st7_A 369 Capsular polysaccharide synthesis enzyme CAP5F; ro 98.02
4f6c_A427 AUSA reductase domain protein; thioester reductase 97.98
4dqv_A478 Probable peptide synthetase NRP (peptide synthase; 97.96
3dhn_A227 NAD-dependent epimerase/dehydratase; reductase, PF 97.93
3e8x_A236 Putative NAD-dependent epimerase/dehydratase; stru 97.92
3i6i_A346 Putative leucoanthocyanidin reductase 1; rossmann 97.91
1xgk_A352 Nitrogen metabolite repression regulator NMRA; ros 97.88
4f6l_B508 AUSA reductase domain protein; thioester reductase 97.87
3nzo_A399 UDP-N-acetylglucosamine 4,6-dehydratase; structura 97.81
3dqp_A219 Oxidoreductase YLBE; alpha-beta protein., structur 97.8
1qyd_A313 Pinoresinol-lariciresinol reductase; NADPH-depende 97.78
2gn4_A344 FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann 97.75
2wm3_A299 NMRA-like family domain containing protein 1; unkn 97.74
3c1o_A321 Eugenol synthase; phenylpropene, PIP reductase, sh 97.73
1xq6_A253 Unknown protein; structural genomics, protein stru 97.72
1qyc_A308 Phenylcoumaran benzylic ether reductase PT1; NADPH 97.65
2gas_A307 Isoflavone reductase; NADPH-dependent reductase, o 97.63
2r6j_A318 Eugenol synthase 1; phenylpropene, PIP reductase, 97.63
3h2s_A224 Putative NADH-flavin reductase; Q03B84, NESG, LCR1 97.14
3ay3_A267 NAD-dependent epimerase/dehydratase; glucuronic ac 97.06
3ew7_A221 LMO0794 protein; Q8Y8U8_lismo, putative NAD-depend 96.93
2a35_A215 Hypothetical protein PA4017; alpha-beta-alpha sand 96.51
1hdo_A206 Biliverdin IX beta reductase; foetal metabolism, H 95.98
3m1a_A281 Putative dehydrogenase; short, PSI, MCSG, structur 95.9
2bgk_A278 Rhizome secoisolariciresinol dehydrogenase; oxidor 94.73
2dkn_A255 3-alpha-hydroxysteroid dehydrogenase; oxidoreducta 94.37
2bka_A242 CC3, TAT-interacting protein TIP30; NADPH, PEG600, 93.18
1spx_A278 Short-chain reductase family member (5L265); paral 91.93
3qvo_A236 NMRA family protein; structural genomics, PSI-biol 90.45
3d7l_A202 LIN1944 protein; APC89317, structural genomics, PS 89.31
1w6u_A302 2,4-dienoyl-COA reductase, mitochondrial precursor 87.84
1ja9_A274 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; p 87.08
2gdz_A267 NAD+-dependent 15-hydroxyprostaglandin dehydrogen; 86.99
3rft_A267 Uronate dehydrogenase; apoenzyme, rossmann fold, N 85.83
2yut_A207 Putative short-chain oxidoreductase; alpha and bet 84.57
1cyd_A244 Carbonyl reductase; short-chain dehydrogenase, oxi 83.81
1fmc_A255 7 alpha-hydroxysteroid dehydrogenase; short-chain 83.27
3u9l_A324 3-oxoacyl-[acyl-carrier-protein] reductase; struct 82.53
1uay_A242 Type II 3-hydroxyacyl-COA dehydrogenase; beta oxid 80.78
3d3w_A244 L-xylulose reductase; uronate cycle, short-chain d 80.68
3svt_A281 Short-chain type dehydrogenase/reductase; ssgcid, 80.51
>2rh8_A Anthocyanidin reductase; flavonoids, rossmann fold, short chain dehydrogenase/reductase, oxidoreductase; 2.22A {Vitis vinifera} PDB: 3hfs_A Back     alignment and structure
Probab=99.59  E-value=5.7e-15  Score=100.85  Aligned_cols=88  Identities=23%  Similarity=0.411  Sum_probs=70.0

Q ss_pred             CCceeHHHHHHHHHHHhcCCCCCccEEEecCcccHHHHHHHHHHHcCCCcCCCcc----------cCCC-cCcCCCeec-
Q 036612           13 RPLVDLRDVADVILVVYEKPEAKRRYICTSFAIRMQALAVKIKIMFLNYDYSKSF----------TKVD-EGNLGWKYR-   80 (102)
Q Consensus        13 ~~~v~V~Dva~a~v~a~~~~~~~~~~~~~~~~~s~~ei~~~i~~~~p~~~~p~~~----------~~~~-~~~lg~~~~-   80 (102)
                      ++||||+|||++++.+++.+...|+|+++++.+|++|+++.+.+.+|..++|...          .+.+ .+.|||+|+ 
T Consensus       238 ~~~i~v~Dva~a~~~~~~~~~~~~~~~~~~~~~s~~e~~~~l~~~~~~~~~~~~~~~~~~~~~~~~d~~k~~~lG~~p~~  317 (338)
T 2rh8_A          238 VSIAHVEDVCRAHIFVAEKESASGRYICCAANTSVPELAKFLSKRYPQYKVPTDFGDFPPKSKLIISSEKLVKEGFSFKY  317 (338)
T ss_dssp             EEEEEHHHHHHHHHHHHHCTTCCEEEEECSEEECHHHHHHHHHHHCTTSCCCCCCTTSCSSCSCCCCCHHHHHHTCCCSC
T ss_pred             ccEEEHHHHHHHHHHHHcCCCcCCcEEEecCCCCHHHHHHHHHHhCCCCCCCCCCCCCCcCcceeechHHHHHhCCCCCC
Confidence            4899999999999999987666568988877799999999999987644333211          1221 256999999 


Q ss_pred             CHHHHHHHHHHHHHHcCCCC
Q 036612           81 PLEESIHDSDKNYEESGILH  100 (102)
Q Consensus        81 ~l~e~i~~~~~~~~~~~~~~  100 (102)
                      +++|+|+++++|+++.|+++
T Consensus       318 ~l~~gl~~~~~~~~~~~~~~  337 (338)
T 2rh8_A          318 GIEEIYDESVEYFKAKGLLQ  337 (338)
T ss_dssp             CHHHHHHHHHHHHHHTTCC-
T ss_pred             CHHHHHHHHHHHHHHcCCCC
Confidence            99999999999999998874
>2p4h_X Vestitone reductase; NADPH-dependent reductase, isoflavonoid, plant protein; 1.40A {Medicago sativa} Back     alignment and structure
>2c29_D Dihydroflavonol 4-reductase; flavonoids, short dehydrogenase reductase, NADPH, dihydroquercetin, rossmann fold, oxidoreductase; HET: NAP DQH; 1.81A {Vitis vinifera} PDB: 2iod_A* 2nnl_D* 3bxx_A* 3c1t_A* Back     alignment and structure
>3enk_A UDP-glucose 4-epimerase; seattle structural genomics center for infectious disease, ssgcid, isomerase, NAD; HET: NAD GUD; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0 Back     alignment and structure
>3ko8_A NAD-dependent epimerase/dehydratase; isomerase, UDP-galactose 4-epimerase; HET: NAD; 1.80A {Pyrobaculum calidifontis} SCOP: c.2.1.0 PDB: 3icp_A* 3aw9_A* Back     alignment and structure
>3m2p_A UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J, isomerase, structural genomics, PSI-2, protein structure initiative; HET: UDP; 2.95A {Bacillus cereus} Back     alignment and structure
>4egb_A DTDP-glucose 4,6-dehydratase; rhamnose pathway, center for structural genomics of infectio diseases, csgid, niaid; HET: NAD SUC; 3.00A {Bacillus anthracis} Back     alignment and structure
>3ehe_A UDP-glucose 4-epimerase (GALE-1); PSI-II, NYSGXRC, ST genomics, protein structure initiative, NEW YORK SGX resear for structural genomics; HET: NAD; 1.87A {Archaeoglobus fulgidus} SCOP: c.2.1.0 Back     alignment and structure
>4b4o_A Epimerase family protein SDR39U1; isomerase; HET: NDP PE4; 2.70A {Homo sapiens} Back     alignment and structure
>3ruf_A WBGU; rossmann fold, UDP-hexose 4-epimerase, isomerase; HET: NAD UDP; 2.00A {Plesiomonas shigelloides} SCOP: c.2.1.2 PDB: 3ru9_A* 3rud_A* 3rue_A* 3rua_A* 3ruh_A* 3ruc_A* 3ru7_A* 3lu1_A* Back     alignment and structure
>4b8w_A GDP-L-fucose synthase; oxidoreductase; HET: NAP GDP; 2.75A {Homo sapiens} Back     alignment and structure
>2x4g_A Nucleoside-diphosphate-sugar epimerase; isomerase; 2.65A {Pseudomonas aeruginosa} Back     alignment and structure
>1ek6_A UDP-galactose 4-epimerase; short-chain dehydrogenase, galactosemia, isomerase; HET: NAI UPG; 1.50A {Homo sapiens} SCOP: c.2.1.2 PDB: 1ek5_A* 1hzj_A* 1i3k_A* 1i3l_A* 1i3m_A* 1i3n_A* Back     alignment and structure
>2yy7_A L-threonine dehydrogenase; thermolabIle, flavobacterium FRIG KUC-1, oxidoreductase; HET: PE8 NAD MES; 2.06A {Flavobacterium frigidimaris} Back     alignment and structure
>2p5y_A UDP-glucose 4-epimerase; TTHA0591, structural genomics, PSI; HET: NAD; 1.92A {Thermus thermophilus HB8} PDB: 2p5u_A* Back     alignment and structure
>3vps_A TUNA, NAD-dependent epimerase/dehydratase; tunicamycins, biosynthesis, EXO-glycal, rossman transferase; HET: UD1 NAD; 1.90A {Streptomyces chartreusis} Back     alignment and structure
>1udb_A Epimerase, UDP-galactose-4-epimerase; isomerase; HET: NAD UFG; 1.65A {Escherichia coli} SCOP: c.2.1.2 PDB: 1lrj_A* 1nai_A* 1uda_A* 1nah_A* 1xel_A* 1kvq_A* 1kvs_A* 1udc_A* 2udp_A* 1a9z_A* 1kvt_A* 1kvr_A* 1lrk_A* 1lrl_A* 1kvu_A* 1a9y_A* Back     alignment and structure
>3slg_A PBGP3 protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid, melioidosis, glanders; 2.10A {Burkholderia pseudomallei} Back     alignment and structure
>4id9_A Short-chain dehydrogenase/reductase; putative dehydrogenase, enzyme function initiative, EFI, STR genomics, oxidoreductase; HET: NAD; 1.60A {Agrobacterium fabrum} PDB: 4idg_A* Back     alignment and structure
>3ajr_A NDP-sugar epimerase; L-threonine dehydrogenase, L-3- hydroxynorvaline, oxidoreductase; HET: NAD; 1.77A {Thermoplasma volcanium} PDB: 3a9w_A* 3a4v_A* 3a1n_A* Back     alignment and structure
>2pzm_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, protein-nucleotide comple binding protein; HET: NAD UDP; 2.00A {Bordetella bronchiseptica} PDB: 2pzl_A* 2pzk_A* Back     alignment and structure
>3sxp_A ADP-L-glycero-D-mannoheptose-6-epimerase; rossman fold, NAD binding, isomerase; HET: NAD; 2.55A {Helicobacter pylori} Back     alignment and structure
>1e6u_A GDP-fucose synthetase; epimerase/reductase, SDR, RED; HET: NAP; 1.45A {Escherichia coli} SCOP: c.2.1.2 PDB: 1e7q_A* 1bsv_A* 1fxs_A* 1gfs_A 1e7s_A* 1bws_A* 1e7r_A* Back     alignment and structure
>2bll_A Protein YFBG; decarboxylase, short chain dehydrogenase, L-ARA4N biosynthes methyltransferase, transferase; 2.3A {Escherichia coli} SCOP: c.2.1.2 PDB: 1u9j_A 1z73_A 1z75_A 1z7b_A 1z74_A Back     alignment and structure
>2v6g_A Progesterone 5-beta-reductase; tyrosine-dependent oxidoreductase, oxidoreductase, SDR, cardenolides, cardiac glycosides; HET: NAP; 2.3A {Digitalis lanata} PDB: 2v6f_A* Back     alignment and structure
>2b69_A UDP-glucuronate decarboxylase 1; UDP-glucoronic acid decarboxylase, structural genomics, STRU genomics consortium, SGC, lyase; HET: MSE NAD UDP; 1.21A {Homo sapiens} SCOP: c.2.1.2 PDB: 4ef7_A* Back     alignment and structure
>3gpi_A NAD-dependent epimerase/dehydratase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.44A {Methylobacillus flagellatus KT} Back     alignment and structure
>1rpn_A GDP-mannose 4,6-dehydratase; short-chain dehydrogenase/reductase, rossmann fold, lyase; HET: NDP GDP; 2.15A {Pseudomonas aeruginosa} SCOP: c.2.1.2 Back     alignment and structure
>1gy8_A UDP-galactose 4-epimerase; oxidoreductase; HET: NAD UDP; 2.0A {Trypanosoma brucei} SCOP: c.2.1.2 PDB: 2cnb_A* Back     alignment and structure
>2c20_A UDP-glucose 4-epimerase; carbohydrate metabolism, galactose metabolism, isomerase, NAD, spine; HET: NAD; 2.7A {Bacillus anthracis} Back     alignment and structure
>2pk3_A GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, short-chain dehydrogenase/reductase, rossmann fold, oxidoreductase; HET: A2R GDD; 1.82A {Aneurinibacillus thermoaerophilus} Back     alignment and structure
>1db3_A GDP-mannose 4,6-dehydratase; NADP, GDP-fucose, lyase; 2.30A {Escherichia coli} SCOP: c.2.1.2 Back     alignment and structure
>1t2a_A GDP-mannose 4,6 dehydratase; structural genomics consortium, rossman-fold, short-chain dehydrogenase/reductase, SDR, structural genomics,lyase; HET: NDP GDP; 1.84A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>2q1w_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, sugar binding protein; HET: NAD; 2.19A {Bordetella bronchiseptica} Back     alignment and structure
>1n7h_A GDP-D-mannose-4,6-dehydratase; rossmann fold, SDR, short-chain dehydrogenase/reductase, LYA; HET: NDP GDP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1n7g_A* Back     alignment and structure
>2c5a_A GDP-mannose-3', 5'-epimerase; short chain dehydratase/reductase, GDP-gulose, GDP-galactose, keto intermediate, vitamin C, SDR; HET: GDC NAD BTB; 1.4A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2c59_A* 2c54_A* 2c5e_A* Back     alignment and structure
>1sb8_A WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCNAC, SDR, G SYK, UDP, N-acetylglucosamine, N- acetylgalactosamine, UDP-GLC, isomerase; HET: NAD UD2; 2.10A {Pseudomonas aeruginosa} SCOP: c.2.1.2 PDB: 1sb9_A* Back     alignment and structure
>1orr_A CDP-tyvelose-2-epimerase; rossmann fold, short-chain dehydrogenase/reductase, isomeras; HET: NAD CDP; 1.50A {Salmonella typhi} SCOP: c.2.1.2 Back     alignment and structure
>3sc6_A DTDP-4-dehydrorhamnose reductase; RFBD, structural genomics, infectious diseases, bacillus anthracis STR. AMES, rhamnose biosynthetic pathway; HET: NAP; 2.65A {Bacillus anthracis} SCOP: c.2.1.0 Back     alignment and structure
>1rkx_A CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 1.80A {Yersinia pseudotuberculosis} SCOP: c.2.1.2 PDB: 1wvg_A* Back     alignment and structure
>2hun_A 336AA long hypothetical DTDP-glucose 4,6-dehydrat; rossmann fold, structural genomics, NPPSFA; HET: NAD; 2.07A {Pyrococcus horikoshii} Back     alignment and structure
>3ius_A Uncharacterized conserved protein; APC63810, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.66A {Ruegeria pomeroyi dss-3} Back     alignment and structure
>1oc2_A DTDP-glucose 4,6-dehydratase; lyase, NADH, rhamnose; HET: TDX NAD; 1.5A {Streptococcus suis} SCOP: c.2.1.2 PDB: 1ker_A* 1ket_A* 1kep_A* Back     alignment and structure
>1vl0_A DTDP-4-dehydrorhamnose reductase, RFBD ortholog; structural joint center for structural genomics, JCSG, protein structu initiative; HET: NAI UNL; 2.05A {Clostridium acetobutylicum} SCOP: c.2.1.2 Back     alignment and structure
>1i24_A Sulfolipid biosynthesis protein SQD1; SDR, short-chain dehydrogenase/reductase, rossmann fold, BIO protein; HET: NAD UPG; 1.20A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1i2c_A* 1i2b_A* 1qrr_A* Back     alignment and structure
>1r6d_A TDP-glucose-4,6-dehydratase; rossmann fold, short-chain dehydrogenase/reductase, lyase; HET: NAD DAU; 1.35A {Streptomyces venezuelae} SCOP: c.2.1.2 PDB: 1r66_A* Back     alignment and structure
>2z1m_A GDP-D-mannose dehydratase; short-chain dehydrogenase/reductase, lyase, structural genom NPPSFA; HET: NDP GDP; 2.00A {Aquifex aeolicus} PDB: 2z95_A* Back     alignment and structure
>2q1s_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NADH complex, sugar binding protein; HET: NAI; 1.50A {Bordetella bronchiseptica} PDB: 2pzj_A* 2q1t_A* 2q1u_A* Back     alignment and structure
>1n2s_A DTDP-4-, DTDP-glucose oxidoreductase; rossman-fold, sugar-nucleotide-binding domain; HET: NAD; 2.00A {Salmonella enterica subsp} SCOP: c.2.1.2 PDB: 1kc1_A* 1kc3_A* 1kbz_A* Back     alignment and structure
>1eq2_A ADP-L-glycero-D-mannoheptose 6-epimerase; N-terminal domain rossmann fold, C-terminal mixed alpha/beta domain; HET: NAP ADQ; 2.00A {Escherichia coli} SCOP: c.2.1.2 Back     alignment and structure
>1z45_A GAL10 bifunctional protein; epimerase, mutarotase, metabolism, isomerase; HET: GAL NAD GUD; 1.85A {Saccharomyces cerevisiae} SCOP: b.30.5.4 c.2.1.2 Back     alignment and structure
>1kew_A RMLB;, DTDP-D-glucose 4,6-dehydratase; rossmann fold, lyase; HET: TYD NAD; 1.80A {Salmonella enterica subsp} SCOP: c.2.1.2 PDB: 1g1a_A* 1keu_A* 1bxk_A* Back     alignment and structure
>2x6t_A ADP-L-glycero-D-manno-heptose-6-epimerase; isomerase, carbohydrate metabolism, stress response; HET: NAP ADP BMA; 2.36A {Escherichia coli} PDB: 2x86_A* Back     alignment and structure
>1y1p_A ARII, aldehyde reductase II; rossmann fold, short chain dehydrogenase reductase, oxidoreductase; HET: NMN AMP; 1.60A {Sporidiobolus salmonicolor} SCOP: c.2.1.2 PDB: 1ujm_A* 1zze_A Back     alignment and structure
>1z7e_A Protein aRNA; rossmann fold, OB-like fold, hydrolase; HET: ATP UGA; 3.00A {Escherichia coli} SCOP: b.46.1.1 c.2.1.2 c.65.1.1 Back     alignment and structure
>2hrz_A AGR_C_4963P, nucleoside-diphosphate-sugar epimerase; agrobacterium tumefa structural genomics, PSI-2, protein structure initiative; 1.85A {Agrobacterium tumefaciens} Back     alignment and structure
>2zcu_A Uncharacterized oxidoreductase YTFG; alpha-beta sandwich; 1.80A {Escherichia coli} PDB: 2zcv_A* Back     alignment and structure
>2ydy_A Methionine adenosyltransferase 2 subunit beta; oxidoreductase; 2.25A {Homo sapiens} PDB: 2ydx_A Back     alignment and structure
>3oh8_A Nucleoside-diphosphate sugar epimerase (SULA FAMI; DUF1731_C, northeast structural genomics consortium, NESG, C PSI-biology; 2.00A {Corynebacterium glutamicum} Back     alignment and structure
>2jl1_A Triphenylmethane reductase; oxidoreductase, bioremediation; HET: NAP GOL; 1.96A {Citrobacter SP} PDB: 2vrb_A* 2vrc_A 2vrc_D Back     alignment and structure
>2ggs_A 273AA long hypothetical DTDP-4-dehydrorhamnose reductase; alpha, beta, oxidoreductase; HET: NDP; 1.70A {Sulfolobus tokodaii} Back     alignment and structure
>3e48_A Putative nucleoside-diphosphate-sugar epimerase; alpha-beta protein., structural genomics, PSI-2, protein STR initiative; 1.60A {Staphylococcus aureus subsp} Back     alignment and structure
>3st7_A Capsular polysaccharide synthesis enzyme CAP5F; rossmann fold, cupid domain, short-chain dehydrogenase/reduc NADPH; 2.45A {Staphylococcus aureus} PDB: 2zkl_A 3vhr_A Back     alignment and structure
>4f6c_A AUSA reductase domain protein; thioester reductase, oxidoreductase; 2.81A {Staphylococcus aureus} Back     alignment and structure
>4dqv_A Probable peptide synthetase NRP (peptide synthase; GXXGXXG motif, rossmann fold, short chain dehydrogenase/REDU family, reductase; 2.30A {Mycobacterium tuberculosis} Back     alignment and structure
>3dhn_A NAD-dependent epimerase/dehydratase; reductase, PF01370, Q89Z24_bactn, NESG, BTR310, structural genomics, PSI-2; 2.00A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3e8x_A Putative NAD-dependent epimerase/dehydratase; structural genomics, APC7755, NADP, P protein structure initiative; HET: MSE NAP; 2.10A {Bacillus halodurans} Back     alignment and structure
>3i6i_A Putative leucoanthocyanidin reductase 1; rossmann fold, short chain dehydrogenase reductase, flavonoi oxidoreductase; HET: NDP; 1.75A {Vitis vinifera} PDB: 3i5m_A 3i52_A* 3i6q_A* Back     alignment and structure
>1xgk_A Nitrogen metabolite repression regulator NMRA; rossmann fold, transcriptional regulation, short chain dehyd reductase, NADP binding; 1.40A {Emericella nidulans} SCOP: c.2.1.2 PDB: 1k6x_A* 1k6j_A 1k6i_A* 1ti7_A* 2vus_A 2vut_A* 2vuu_A* Back     alignment and structure
>4f6l_B AUSA reductase domain protein; thioester reductase, oxidoreductase; 3.86A {Staphylococcus aureus} Back     alignment and structure
>3dqp_A Oxidoreductase YLBE; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 1.40A {Lactococcus lactis subsp} Back     alignment and structure
>1qyd_A Pinoresinol-lariciresinol reductase; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.50A {Thuja plicata} SCOP: c.2.1.2 Back     alignment and structure
>2gn4_A FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann fold, TYK triad, SDR, enzyme, NADP, NADPH, lyase; HET: NDP UD1 MES; 1.90A {Helicobacter pylori} PDB: 2gn6_A* 2gn8_A* 2gn9_A* 2gna_A* Back     alignment and structure
>2wm3_A NMRA-like family domain containing protein 1; unknown function; HET: NAP NFL; 1.85A {Homo sapiens} PDB: 2wmd_A* 2exx_A* 3dxf_A 3e5m_A Back     alignment and structure
>3c1o_A Eugenol synthase; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, oxidoreductase; HET: NAP; 1.80A {Clarkia breweri} Back     alignment and structure
>1xq6_A Unknown protein; structural genomics, protein structure initiative, CESG, AT5G02240, NADP, center for eukaryotic structural genomics; HET: NAP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1ybm_A* 2q46_A* 2q4b_A* Back     alignment and structure
>1qyc_A Phenylcoumaran benzylic ether reductase PT1; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.20A {Pinus taeda} SCOP: c.2.1.2 Back     alignment and structure
>2gas_A Isoflavone reductase; NADPH-dependent reductase, oxidoreductase; 1.60A {Medicago sativa} Back     alignment and structure
>2r6j_A Eugenol synthase 1; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, plant protein; HET: NDP; 1.50A {Ocimum basilicum} PDB: 2qys_A 2qx7_A* 2qzz_A* 2r2g_A* 3c3x_A* 2qw8_A* Back     alignment and structure
>3h2s_A Putative NADH-flavin reductase; Q03B84, NESG, LCR19, structural genomics, PSI-2, protein structure initiative; HET: NDP; 1.78A {Lactobacillus casei atcc 334} Back     alignment and structure
>3ay3_A NAD-dependent epimerase/dehydratase; glucuronic acid dehydrogeanse, oxidoreductase; 2.10A {Chromohalobacter salexigens} Back     alignment and structure
>3ew7_A LMO0794 protein; Q8Y8U8_lismo, putative NAD-dependent epimerase/dehydratase, LMR162, NESG, structural genomics, PSI-2; 2.73A {Listeria monocytogenes} Back     alignment and structure
>2a35_A Hypothetical protein PA4017; alpha-beta-alpha sandwich, structura genomics, PSI, protein structure initiative; 1.50A {Pseudomonas aeruginosa} SCOP: c.2.1.2 Back     alignment and structure
>1hdo_A Biliverdin IX beta reductase; foetal metabolism, HAEM degradation, flavin reductase, diaphorase, green HAEM binding protein; HET: NAP; 1.15A {Homo sapiens} SCOP: c.2.1.2 PDB: 1he2_A* 1he3_A* 1he4_A* 1he5_A* Back     alignment and structure
>3m1a_A Putative dehydrogenase; short, PSI, MCSG, structural genomics, midwest center for structural genomics, protein structure initiative; 2.00A {Streptomyces avermitilis} Back     alignment and structure
>2bgk_A Rhizome secoisolariciresinol dehydrogenase; oxidoreductase; 1.6A {Podophyllum peltatum} SCOP: c.2.1.2 PDB: 2bgl_A* 2bgm_A* Back     alignment and structure
>2dkn_A 3-alpha-hydroxysteroid dehydrogenase; oxidoreductase, rossmann fold; HET: NAI; 1.80A {Pseudomonas SP} Back     alignment and structure
>2bka_A CC3, TAT-interacting protein TIP30; NADPH, PEG600, transcription; HET: NDP PE8; 1.7A {Homo sapiens} SCOP: c.2.1.2 PDB: 2fmu_A Back     alignment and structure
>1spx_A Short-chain reductase family member (5L265); parallel beta-sheet of seven strands in the order 3214567; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>3qvo_A NMRA family protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MNB; 2.30A {Shigella flexneri 2A} Back     alignment and structure
>3d7l_A LIN1944 protein; APC89317, structural genomics, PS protein structure initiative, midwest center for structural genomics, MCSG; 2.06A {Listeria innocua} Back     alignment and structure
>1w6u_A 2,4-dienoyl-COA reductase, mitochondrial precursor; short chain dehydrogenase, beta- oxidation, NADP, oxidoreductase; HET: HXC NAP; 1.75A {Homo sapiens} SCOP: c.2.1.2 PDB: 1w73_A* 1w8d_A* Back     alignment and structure
>1ja9_A 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, oxidoreductase, chain dehydrogenase; HET: NDP PYQ; 1.50A {Magnaporthe grisea} SCOP: c.2.1.2 Back     alignment and structure
>2gdz_A NAD+-dependent 15-hydroxyprostaglandin dehydrogen; dehydrogenase, structural genomics, SH dehydrogenase/reductase, inflammation; HET: NAD; 1.65A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>3rft_A Uronate dehydrogenase; apoenzyme, rossmann fold, NAD binding, oxidoreductase; 1.90A {Agrobacterium tumefaciens} PDB: 3rfv_A* 3rfx_A* Back     alignment and structure
>2yut_A Putative short-chain oxidoreductase; alpha and beta proteins (A/B), NAD(P)-binding rossmann-fold structural genomics, NPPSFA; HET: NAP; 2.20A {Thermus thermophilus} Back     alignment and structure
>1cyd_A Carbonyl reductase; short-chain dehydrogenase, oxidoreductase; HET: NAP; 1.80A {Mus musculus} SCOP: c.2.1.2 Back     alignment and structure
>1fmc_A 7 alpha-hydroxysteroid dehydrogenase; short-chain dehydrogenase/reductase, bIle acid catabolism, oxidoreductase; HET: CHO NAD; 1.80A {Escherichia coli} SCOP: c.2.1.2 PDB: 1ahi_A* 1ahh_A* Back     alignment and structure
>3u9l_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.10A {Sinorhizobium meliloti} Back     alignment and structure
>1uay_A Type II 3-hydroxyacyl-COA dehydrogenase; beta oxidation, fatty acid, structural genomi structural genomics/proteomics initiative, RSGI; HET: ADN; 1.40A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>3d3w_A L-xylulose reductase; uronate cycle, short-chain dehydrogenase/reductase(SDR) superfamily, glucose metabolism, acetylation, carbohydrate metabolism; HET: NAP; 1.87A {Homo sapiens} PDB: 1wnt_A* 1pr9_A* Back     alignment and structure
>3svt_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 2.00A {Mycobacterium ulcerans} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 102
d1y1pa1342 c.2.1.2 (A:2-343) Aldehyde reductase II {Sporobolo 1e-04
>d1y1pa1 c.2.1.2 (A:2-343) Aldehyde reductase II {Sporobolomyces salmonicolor [TaxId: 5005]} Length = 342 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: NAD(P)-binding Rossmann-fold domains
superfamily: NAD(P)-binding Rossmann-fold domains
family: Tyrosine-dependent oxidoreductases
domain: Aldehyde reductase II
species: Sporobolomyces salmonicolor [TaxId: 5005]

 Score = 37.5 bits (85), Expect = 1e-04
 Identities = 16/94 (17%), Positives = 32/94 (34%), Gaps = 16/94 (17%)

Query: 12  NRPLVDLRDVADVILVVYEKPEA-KRRYICTSFAIRMQALAVKIKIMFLNYDYSKSFTKV 70
            +  V   D+  + L     P+  +RR   T+       +    + ++ +  +   F   
Sbjct: 243 PQYYVSAVDIGLLHLGCLVLPQIERRRVYGTAGTFDWNTVLATFRKLYPSKTFPADFPDQ 302

Query: 71  DEG--------------NLGWK-YRPLEESIHDS 89
            +               +LG   +R +EESI D 
Sbjct: 303 GQDLSKFDTAPSLEILKSLGRPGWRSIEESIKDL 336

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query102
d1r6da_322 dTDP-glucose 4,6-dehydratase (RmlB) {Streptomyces 99.55
d1y1pa1342 Aldehyde reductase II {Sporobolomyces salmonicolor 99.51
d2blla1342 Polymyxin resistance protein ArnA (PrmI) {Escheric 99.45
d1kewa_361 dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus 99.45
d1ek6a_346 Uridine diphosphogalactose-4-epimerase (UDP-galact 99.44
d1oc2a_346 dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus 99.42
d2c5aa1363 GDP-mannose-3', 5'-epimerase {Thale cress (Arabido 99.42
d2b69a1312 UDP-glucuronate decarboxylase 1 {Human (Homo sapie 99.41
d1rpna_321 GDP-mannose 4,6-dehydratase {Pseudomonas aeruginos 99.4
d1db3a_357 GDP-mannose 4,6-dehydratase {Escherichia coli [Tax 99.37
d1n7ha_339 GDP-mannose 4,6-dehydratase {Thale-cress (Arabidop 99.37
d1gy8a_383 Uridine diphosphogalactose-4-epimerase (UDP-galact 99.36
d1sb8a_341 UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomo 99.33
d1orra_338 CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 99.32
d1udca_338 Uridine diphosphogalactose-4-epimerase (UDP-galact 99.32
d1i24a_393 Sulfolipid biosynthesis protein SQD1 {Thale cress 99.29
d1vl0a_281 DTDP-4-dehydrorhamnose reductase RfbD {Clostridium 99.16
d1eq2a_307 ADP-L-glycero-D-mannoheptose 6-epimerase {Escheric 99.14
d1z45a2347 Uridine diphosphogalactose-4-epimerase (UDP-galact 99.1
d1rkxa_356 CDP-glucose-4,6-dehydratase {Yersinia pseudotuberc 99.06
d1t2aa_347 GDP-mannose 4,6-dehydratase {Human (Homo sapiens) 99.04
d1e6ua_315 GDP-4-keto-6-deoxy-d-mannose epimerase/reductase ( 98.93
d1n2sa_298 dTDP-6-deoxy-L-lyxo-4-hexulose reductase (RmlD) {S 98.52
d1qyca_307 Phenylcoumaran benzylic ether reductase {Loblolly 98.17
d1qyda_312 Pinoresinol-lariciresinol reductase {Giant arborvi 98.07
d2q46a1252 Hypothetical protein At5g02240 (T7H20_290) {Thale 98.0
d1xgka_350 Negative transcriptional regulator NmrA {Aspergill 97.39
d1hdoa_205 Biliverdin IX beta reductase {Human (Homo sapiens) 95.36
d2a35a1212 Hypothetical protein PA4017 {Pseudomonas aeruginos 94.44
d2bkaa1232 TAT-interacting protein TIP30 {Human (Homo sapiens 94.32
>d1r6da_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: NAD(P)-binding Rossmann-fold domains
superfamily: NAD(P)-binding Rossmann-fold domains
family: Tyrosine-dependent oxidoreductases
domain: dTDP-glucose 4,6-dehydratase (RmlB)
species: Streptomyces venezuelae [TaxId: 54571]

Probab=99.55  E-value=3.5e-15  Score=100.06  Aligned_cols=88  Identities=15%  Similarity=0.163  Sum_probs=69.4

Q ss_pred             CCCCCCceeHHHHHHHHHHHhcCCCCCccEEEe-cCcccHHHHHHHHHHHcCC-Cc----CCCc-------ccCCC--cC
Q 036612            9 EDKNRPLVDLRDVADVILVVYEKPEAKRRYICT-SFAIRMQALAVKIKIMFLN-YD----YSKS-------FTKVD--EG   73 (102)
Q Consensus         9 ~~~~~~~v~V~Dva~a~v~a~~~~~~~~~~~~~-~~~~s~~ei~~~i~~~~p~-~~----~p~~-------~~~~~--~~   73 (102)
                      +...|+|+||+|+|++++.+++++..++.||++ ++.+|+.|+++.+.+.++. .+    .+..       ..+.+  .+
T Consensus       211 g~~~r~~i~v~D~a~ai~~~~~~~~~~~~~ni~~~~~~s~~e~~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~d~~k~~~  290 (322)
T d1r6da_         211 GANVREWVHTDDHCRGIALVLAGGRAGEIYHIGGGLELTNRELTGILLDSLGADWSSVRKVADRKGHDLRYSLDGGKIER  290 (322)
T ss_dssp             SCCEEEEEEHHHHHHHHHHHHHHCCTTCEEEECCCCEEEHHHHHHHHHHHHTCCGGGEEEECCCTTCCCBCCBCCHHHHH
T ss_pred             CCeEEccEEHHHHHHHHHHHHhCCCCCCeeEEeecccchhHHHHHHHHHHhCCCccceeecCCCCCCCceeeeCHHHHHH
Confidence            357889999999999999999987765689886 5789999999999998752 21    1110       11222  36


Q ss_pred             cCCCeec-CHHHHHHHHHHHHHHc
Q 036612           74 NLGWKYR-PLEESIHDSDKNYEES   96 (102)
Q Consensus        74 ~lg~~~~-~l~e~i~~~~~~~~~~   96 (102)
                      .|||+|+ +++|||+++++|++++
T Consensus       291 ~lg~~p~~~~eegI~~~i~w~~~n  314 (322)
T d1r6da_         291 ELGYRPQVSFADGLARTVRWYREN  314 (322)
T ss_dssp             HHCCCCCSCHHHHHHHHHHHHHHC
T ss_pred             HHCCCCCCCHHHHHHHHHHHHHHh
Confidence            7999999 9999999999999973
>d1y1pa1 c.2.1.2 (A:2-343) Aldehyde reductase II {Sporobolomyces salmonicolor [TaxId: 5005]} Back     information, alignment and structure
>d2blla1 c.2.1.2 (A:316-657) Polymyxin resistance protein ArnA (PrmI) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kewa_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} Back     information, alignment and structure
>d1ek6a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oc2a_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} Back     information, alignment and structure
>d2c5aa1 c.2.1.2 (A:13-375) GDP-mannose-3', 5'-epimerase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2b69a1 c.2.1.2 (A:4-315) UDP-glucuronate decarboxylase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rpna_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1db3a_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1n7ha_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1gy8a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1sb8a_ c.2.1.2 (A:) UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1orra_ c.2.1.2 (A:) CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 90370]} Back     information, alignment and structure
>d1udca_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1i24a_ c.2.1.2 (A:) Sulfolipid biosynthesis protein SQD1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1vl0a_ c.2.1.2 (A:) DTDP-4-dehydrorhamnose reductase RfbD {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d1eq2a_ c.2.1.2 (A:) ADP-L-glycero-D-mannoheptose 6-epimerase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1z45a2 c.2.1.2 (A:11-357) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1rkxa_ c.2.1.2 (A:) CDP-glucose-4,6-dehydratase {Yersinia pseudotuberculosis [TaxId: 633]} Back     information, alignment and structure
>d1t2aa_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e6ua_ c.2.1.2 (A:) GDP-4-keto-6-deoxy-d-mannose epimerase/reductase (GDP-fucose synthetase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1n2sa_ c.2.1.2 (A:) dTDP-6-deoxy-L-lyxo-4-hexulose reductase (RmlD) {Salmonella enterica serovar typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1qyca_ c.2.1.2 (A:) Phenylcoumaran benzylic ether reductase {Loblolly pine (Pinus taeda) [TaxId: 3352]} Back     information, alignment and structure
>d1qyda_ c.2.1.2 (A:) Pinoresinol-lariciresinol reductase {Giant arborvitae (Thuja plicata) [TaxId: 3316]} Back     information, alignment and structure
>d2q46a1 c.2.1.2 (A:2-253) Hypothetical protein At5g02240 (T7H20_290) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1xgka_ c.2.1.2 (A:) Negative transcriptional regulator NmrA {Aspergillus nidulans [TaxId: 162425]} Back     information, alignment and structure
>d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2a35a1 c.2.1.2 (A:4-215) Hypothetical protein PA4017 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2bkaa1 c.2.1.2 (A:5-236) TAT-interacting protein TIP30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure