Citrus Sinensis ID: 036716

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------21
MIVAFLFIFIGCLWSFKRSSRTRMLSTLVLNAHQLHEFATRVLQKSRGTLEFKGPWFAKMDFIITSDPMNVHYISSKNFSNYPKGPDLRMILEPFGDGVFAADGNLWKMQRKMIHSVMKHNKFESALEKTIYQKLENGLIPVLDHASEVGIKVDLQDVFQRFTFDNICMSVLGIDPNYLSFEFPQVAYANAFNATEQAVFIATLCQRV
cHHHHHHHHHHHHHHHcccccccccHHHHHcccHHHHHHHHHHHHcccEEEEEEcccccccEEEEccHHHHHHHHHcccccccccHHHHHHHHcccccccccccHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHcHHHHHHHHHccccEEcHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHccc
cHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHcccEEEEEccccccccEEEEccHHHHHHHHHcccccccccHHHHHHHHHHccccEcccHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEcHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHcccccc
MIVAFLFIFIGCLWSFKRSSRTRMLSTLVLNAHQLHEFATRVLQKSrgtlefkgpwfakmdfiitsdpmnvhyissknfsnypkgpdlrmilepfgdgvfaadgNLWKMQRKMIHSVMKHNKFESALEKTIYQKLEnglipvldhasevgikVDLQDVFQrftfdnicmsvlgidpnylsfefpqVAYANAFNATEQAVFIATLCQRV
MIVAFLFIFIGCLWSFKRSSRTRMLSTLVLNAHQLHEFATRVLQKSRGTLEFKGPWFAKMDFIITSDPMNVHYISSKNFSNYPKGPDLRMILEPFGDGVFAADGNLWKMQRKMIHSVMKHNKFESALEKTIYQKLENGLIPVLDHASEVGIKVDLQDVFQRFTFDNICMSVLGIDPNYLSFEFPQVAYANAFNATEQAVFIATLCQRV
MIVAFLFIFIGCLWSFKRSSRTRMLSTLVLNAHQLHEFATRVLQKSRGTLEFKGPWFAKMDFIITSDPMNVHYISSKNFSNYPKGPDLRMILEPFGDGVFAADGNLWKMQRKMIHSVMKHNKFESALEKTIYQKLENGLIPVLDHASEVGIKVDLQDVFQRFTFDNICMSVLGIDPNYLSFEFPQVAYANAFNATEQAVFIATLCQRV
*IVAFLFIFIGCLWSFKRSSRTRMLSTLVLNAHQLHEFATRVLQKSRGTLEFKGPWFAKMDFIITSDPMNVHYISSKNFSNYPKGPDLRMILEPFGDGVFAADGNLWKMQRKMIHSVMKHNKFESALEKTIYQKLENGLIPVLDHASEVGIKVDLQDVFQRFTFDNICMSVLGIDPNYLSFEFPQVAYANAFNATEQAVFIATLC***
MIVAFLFIFIGCLWSFKRSSRTRMLSTLVLNAHQLHEFATRVLQKSRGTLEFKGPWFAKMDFIITSDPMNVHYISSKNFSNYPKGPDLRMILEPFGDGVFAADGNLWKMQRKMIHSVMKHNKFESALEKTIYQKLENGLIPVLDHASEVGIKVDLQDVFQRFTFDNICMSVLGIDPNYLSFEFPQVAYANAFNATEQAVFIATLCQRV
MIVAFLFIFIGCLWSFKRSSRTRMLSTLVLNAHQLHEFATRVLQKSRGTLEFKGPWFAKMDFIITSDPMNVHYISSKNFSNYPKGPDLRMILEPFGDGVFAADGNLWKMQRKMIHSVMKHNKFESALEKTIYQKLENGLIPVLDHASEVGIKVDLQDVFQRFTFDNICMSVLGIDPNYLSFEFPQVAYANAFNATEQAVFIATLCQRV
MIVAFLFIFIGCLWSFKRSSRTRMLSTLVLNAHQLHEFATRVLQKSRGTLEFKGPWFAKMDFIITSDPMNVHYISSKNFSNYPKGPDLRMILEPFGDGVFAADGNLWKMQRKMIHSVMKHNKFESALEKTIYQKLENGLIPVLDHASEVGIKVDLQDVFQRFTFDNICMSVLGIDPNYLSFEFPQVAYANAFNATEQAVFIATLCQRV
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MIVAFLFIFIGCLWSFKRSSRTRMLSTLVLNAHQLHEFATRVLQKSRGTLEFKGPWFAKMDFIITSDPMNVHYISSKNFSNYPKGPDLRMILEPFGDGVFAADGNLWKMQRKMIHSVMKHNKFESALEKTIYQKLENGLIPVLDHASEVGIKVDLQDVFQRFTFDNICMSVLGIDPNYLSFEFPQVAYANAFNATEQAVFIATLCQRV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query208 2.2.26 [Sep-21-2011]
Q9FMY1 559 Cytochrome P450 86B1 OS=A no no 0.875 0.325 0.368 9e-29
P98188 513 Cytochrome P450 94A2 OS=V N/A no 0.812 0.329 0.346 2e-22
P48422 513 Cytochrome P450 86A1 OS=A no no 0.846 0.343 0.335 2e-22
O81117 514 Cytochrome P450 94A1 OS=V N/A no 0.841 0.340 0.329 5e-19
O23066 553 Cytochrome P450 86A2 OS=A no no 0.836 0.314 0.3 9e-19
Q50EK3 518 Cytochrome P450 704C1 OS= N/A no 0.774 0.310 0.331 1e-17
Q93VK5 595 Protein LUTEIN DEFICIENT no no 0.562 0.196 0.294 1e-07
O48921 576 Cytochrome P450 97B2, chl no no 0.673 0.243 0.290 4e-07
Q12588 519 Cytochrome P450 52A10 OS= N/A no 0.673 0.269 0.262 1e-06
O23365 580 Cytochrome P450 97B3, chl no no 0.682 0.244 0.285 3e-06
>sp|Q9FMY1|C86B1_ARATH Cytochrome P450 86B1 OS=Arabidopsis thaliana GN=CYP86B1 PE=2 SV=1 Back     alignment and function desciption
 Score =  126 bits (317), Expect = 9e-29,   Method: Compositional matrix adjust.
 Identities = 69/187 (36%), Positives = 102/187 (54%), Gaps = 5/187 (2%)

Query: 24  MLSTLVLNAH-QLHEFATRVLQKSRGTLEFKGPWFAKMDFIITSDPMNVHYISSKNFSNY 82
           ML +L       ++E+ + VL    GT +F+GPWF+ ++  IT DP NV ++    FS +
Sbjct: 70  MLPSLAFGLRGNIYEWLSDVLCLQNGTFQFRGPWFSSLNSTITCDPRNVEHLLKNRFSVF 129

Query: 83  PKGPDLRMILEPF-GDGVFAADGNLWKMQRKMIHSVMKHNKFESALEKTIYQKLENGLIP 141
           PKG   R  L    GDG+F AD   W+ QRK         KF     +++++ +   L+P
Sbjct: 130 PKGSYFRDNLRDLLGDGIFNADDETWQRQRKTASIEFHSAKFRQLTTQSLFELVHKRLLP 189

Query: 142 VLDHASEVGIKVDLQDVFQRFTFDNICMSVLGIDPNYLSFEFPQVAYANAF-NATEQAV- 199
           VL+ + +    +DLQDV  R TFDN+CM   G+DP  L  + P + +A AF +ATE AV 
Sbjct: 190 VLETSVKSSSPIDLQDVLLRLTFDNVCMIAFGVDPGCLGPDQPVIPFAKAFEDATEAAVV 249

Query: 200 -FIATLC 205
            F+   C
Sbjct: 250 RFVMPTC 256
Involved in very long chain fatty acids (VLCFA) omega-hydroxylation. Required for the synthesis of saturated VLCFA alpha, omega-bifunctional suberin monomers.
Arabidopsis thaliana (taxid: 3702)
EC: 1EC: .EC: 1EC: 4EC: .EC: -EC: .EC: -
>sp|P98188|C94A2_VICSA Cytochrome P450 94A2 OS=Vicia sativa GN=CYP94A2 PE=2 SV=1 Back     alignment and function description
>sp|P48422|C86A1_ARATH Cytochrome P450 86A1 OS=Arabidopsis thaliana GN=CYP86A1 PE=1 SV=2 Back     alignment and function description
>sp|O81117|C94A1_VICSA Cytochrome P450 94A1 OS=Vicia sativa GN=CYP94A1 PE=2 SV=2 Back     alignment and function description
>sp|O23066|C86A2_ARATH Cytochrome P450 86A2 OS=Arabidopsis thaliana GN=CYP86A2 PE=2 SV=1 Back     alignment and function description
>sp|Q50EK3|C04C1_PINTA Cytochrome P450 704C1 OS=Pinus taeda GN=CYP704C1 PE=2 SV=1 Back     alignment and function description
>sp|Q93VK5|LUT5_ARATH Protein LUTEIN DEFICIENT 5, chloroplastic OS=Arabidopsis thaliana GN=CYP97A3 PE=1 SV=1 Back     alignment and function description
>sp|O48921|C97B2_SOYBN Cytochrome P450 97B2, chloroplastic OS=Glycine max GN=CYP97B2 PE=2 SV=1 Back     alignment and function description
>sp|Q12588|CP52J_CANMA Cytochrome P450 52A10 OS=Candida maltosa GN=CYP52A10 PE=2 SV=1 Back     alignment and function description
>sp|O23365|C97B3_ARATH Cytochrome P450 97B3, chloroplastic OS=Arabidopsis thaliana GN=CYP97B3 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query208
224080992 518 predicted protein [Populus trichocarpa] 0.961 0.386 0.5 1e-56
224080988 480 cytochrome P450 [Populus trichocarpa] gi 0.850 0.368 0.553 5e-56
224128272 519 cytochrome P450 [Populus trichocarpa] gi 0.850 0.341 0.558 2e-54
356513965 500 PREDICTED: cytochrome P450 86B1-like [Gl 0.884 0.368 0.521 4e-52
255560922 509 cytochrome P450, putative [Ricinus commu 0.798 0.326 0.560 5e-52
224135993 419 cytochrome P450 [Populus trichocarpa] gi 0.846 0.420 0.556 2e-51
356513967 502 PREDICTED: cytochrome P450 86B1-like [Gl 0.875 0.362 0.508 2e-50
356573349 502 PREDICTED: cytochrome P450 86B1-like [Gl 0.850 0.352 0.502 5e-50
356511700 504 PREDICTED: cytochrome P450 86B1-like [Gl 0.884 0.365 0.510 8e-50
255560926 505 cytochrome P450, putative [Ricinus commu 0.937 0.386 0.470 2e-48
>gi|224080992|ref|XP_002306257.1| predicted protein [Populus trichocarpa] gi|222855706|gb|EEE93253.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  224 bits (572), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 103/206 (50%), Positives = 144/206 (69%), Gaps = 6/206 (2%)

Query: 1   MIVAFLFIFIGCLWSFKRSSRTR------MLSTLVLNAHQLHEFATRVLQKSRGTLEFKG 54
           +I+A + I + C W     S         ML  L+  A  +HE+ATR+L++S GT EFKG
Sbjct: 9   IIIALVCILLFCHWCRNTVSPVTNWPVVGMLPGLLFKAQNIHEYATRLLKQSGGTFEFKG 68

Query: 55  PWFAKMDFIITSDPMNVHYISSKNFSNYPKGPDLRMILEPFGDGVFAADGNLWKMQRKMI 114
           PWFA M+  +T+DP+NV +IS+ NF NYPKGP+ + I EP+GDGV  +D   WK  RK+I
Sbjct: 69  PWFANMNIFLTADPLNVRHISTTNFVNYPKGPEYKKIFEPYGDGVLNSDFESWKSFRKLI 128

Query: 115 HSVMKHNKFESALEKTIYQKLENGLIPVLDHASEVGIKVDLQDVFQRFTFDNICMSVLGI 174
           HS++K NKF+ +LE+++ +K+  GLIPVL+H S   I++D+QDVFQRFTFDNIC+ VLG 
Sbjct: 129 HSMIKDNKFQVSLERSLREKILKGLIPVLEHVSRQEIELDMQDVFQRFTFDNICLLVLGF 188

Query: 175 DPNYLSFEFPQVAYANAFNATEQAVF 200
           DP  LS + P++AY  AF+  E+A+F
Sbjct: 189 DPQSLSVDLPEIAYKTAFDVVEEAMF 214

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224080988|ref|XP_002306255.1| cytochrome P450 [Populus trichocarpa] gi|222855704|gb|EEE93251.1| cytochrome P450 [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224128272|ref|XP_002329123.1| cytochrome P450 [Populus trichocarpa] gi|222869792|gb|EEF06923.1| cytochrome P450 [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356513965|ref|XP_003525678.1| PREDICTED: cytochrome P450 86B1-like [Glycine max] Back     alignment and taxonomy information
>gi|255560922|ref|XP_002521474.1| cytochrome P450, putative [Ricinus communis] gi|223539373|gb|EEF40964.1| cytochrome P450, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224135993|ref|XP_002322212.1| cytochrome P450 [Populus trichocarpa] gi|222869208|gb|EEF06339.1| cytochrome P450 [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356513967|ref|XP_003525679.1| PREDICTED: cytochrome P450 86B1-like [Glycine max] Back     alignment and taxonomy information
>gi|356573349|ref|XP_003554824.1| PREDICTED: cytochrome P450 86B1-like [Glycine max] Back     alignment and taxonomy information
>gi|356511700|ref|XP_003524561.1| PREDICTED: cytochrome P450 86B1-like [Glycine max] Back     alignment and taxonomy information
>gi|255560926|ref|XP_002521476.1| cytochrome P450, putative [Ricinus communis] gi|223539375|gb|EEF40966.1| cytochrome P450, putative [Ricinus communis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query208
TAIR|locus:2058558 516 CYP96A1 ""cytochrome P450, fam 0.850 0.343 0.463 9.6e-41
TAIR|locus:2122491 519 CYP96A10 ""cytochrome P450, fa 0.850 0.341 0.429 2.9e-39
TAIR|locus:2122521 508 CYP96A12 ""cytochrome P450, fa 0.850 0.348 0.423 8e-37
TAIR|locus:2122506 469 CYP96A11 ""cytochrome P450, fa 0.850 0.377 0.412 1e-36
TAIR|locus:2052526 510 CYP96A5 ""cytochrome P450, fam 0.846 0.345 0.420 1.7e-36
TAIR|locus:2122477 516 CYP96A9 ""cytochrome P450, fam 0.850 0.343 0.423 2.7e-36
TAIR|locus:2206295 503 CYP96A3 ""cytochrome P450, fam 0.961 0.397 0.382 5.7e-36
TAIR|locus:2156677 502 CYP96A4 ""cytochrome P450, fam 0.961 0.398 0.377 3.1e-35
TAIR|locus:2116550 506 CYP96A2 ""cytochrome P450, fam 0.850 0.349 0.389 3.6e-34
TAIR|locus:2015408 520 CYP96A8 ""cytochrome P450, fam 0.846 0.338 0.386 5.8e-34
TAIR|locus:2058558 CYP96A1 ""cytochrome P450, family 96, subfamily A, polypeptide 1"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 433 (157.5 bits), Expect = 9.6e-41, P = 9.6e-41
 Identities = 82/177 (46%), Positives = 113/177 (63%)

Query:    24 MLSTLVLNAHQLHEFATRVLQKSRGTLEFKGPWFAKMDFIITSDPMNVHYISSKNFSNYP 83
             ML  L++   ++++F T +L+ S  T  FKGP F  +D +IT DP N+H+I S NF+NYP
Sbjct:    42 MLPGLLVEIPRVYDFVTELLEASNLTYPFKGPCFGGLDMLITVDPANIHHIMSSNFANYP 101

Query:    84 KGPDLRMILEPFGDGVFAADGNLWKMQRKMIHSVMKHNKFESALEKTIYQKLENGLIPVL 143
             KG + + I +  GDG+F AD  LWK  RK   S+M H  F+    +TI  KLE GL+P+L
Sbjct:   102 KGTEFKKIFDVLGDGIFNADSELWKDLRKSAQSMMTHQDFQRFTLRTIMSKLEKGLVPLL 161

Query:   144 DHASEVGIKVDLQDVFQRFTFDNICMSVLGIDPNYLSFEFPQVAYANAFNATEQAVF 200
             D+ +E    VDLQDVFQRFTFD   +   G+DP  LS E PQ+ +A A +  E+A+F
Sbjct:   162 DYVAEKKQVVDLQDVFQRFTFDTSFVLATGVDPGCLSTEMPQIEFARALDEAEEAIF 218
GO:0005506 "iron ion binding" evidence=IEA
GO:0005576 "extracellular region" evidence=ISM
GO:0009055 "electron carrier activity" evidence=IEA
GO:0016705 "oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen" evidence=IEA
GO:0019825 "oxygen binding" evidence=ISS
GO:0020037 "heme binding" evidence=IEA
GO:0055114 "oxidation-reduction process" evidence=IEA
TAIR|locus:2122491 CYP96A10 ""cytochrome P450, family 96, subfamily A, polypeptide 10"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2122521 CYP96A12 ""cytochrome P450, family 96, subfamily A, polypeptide 12"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2122506 CYP96A11 ""cytochrome P450, family 96, subfamily A, polypeptide 11"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2052526 CYP96A5 ""cytochrome P450, family 96, subfamily A, polypeptide 5"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2122477 CYP96A9 ""cytochrome P450, family 96, subfamily A, polypeptide 9"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2206295 CYP96A3 ""cytochrome P450, family 96, subfamily A, polypeptide 3"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2156677 CYP96A4 ""cytochrome P450, family 96, subfamily A, polypeptide 4"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2116550 CYP96A2 ""cytochrome P450, family 96, subfamily A, polypeptide 2"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2015408 CYP96A8 ""cytochrome P450, family 96, subfamily A, polypeptide 8"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query208
PLN02169 500 PLN02169, PLN02169, fatty acid (omega-1)-hydroxyla 1e-39
PLN02426 502 PLN02426, PLN02426, cytochrome P450, family 94, su 1e-28
PLN03195 516 PLN03195, PLN03195, fatty acid omega-hydroxylase; 5e-25
PLN02738 633 PLN02738, PLN02738, carotene beta-ring hydroxylase 5e-10
PLN02936 489 PLN02936, PLN02936, epsilon-ring hydroxylase 2e-07
pfam00067 461 pfam00067, p450, Cytochrome P450 1e-04
PTZ00404 482 PTZ00404, PTZ00404, cytochrome P450; Provisional 1e-04
>gnl|CDD|177826 PLN02169, PLN02169, fatty acid (omega-1)-hydroxylase/midchain alkane hydroxylase Back     alignment and domain information 
 Score =  141 bits (356), Expect = 1e-39
 Identities = 74/213 (34%), Positives = 114/213 (53%), Gaps = 14/213 (6%)

Query: 1   MIVAFLFIFIGCLWSF-------------KRSSRTRMLSTLVLNAHQLHEFATRVLQKSR 47
             VAF+F F+ CL++              K      ML  ++    +++++   VL+ S 
Sbjct: 9   FFVAFIF-FLVCLFTCFFIHKKPHGQPILKNWPFLGMLPGMLHQIPRIYDWTVEVLEASN 67

Query: 48  GTLEFKGPWFAKMDFIITSDPMNVHYISSKNFSNYPKGPDLRMILEPFGDGVFAADGNLW 107
            T  FKGPW +  D + T+DP N+H+I S NF NYPKGP+ + I +  G+G+   D  LW
Sbjct: 68  LTFYFKGPWLSGTDMLFTADPKNIHHILSSNFGNYPKGPEFKKIFDVLGEGILTVDFELW 127

Query: 108 KMQRKMIHSVMKHNKFESALEKTIYQKLENGLIPVLDHASEVGIKVDLQDVFQRFTFDNI 167
           +  RK  H++  +  F      +   KL+ GL+P LD+A+   I +DLQDVF RF FD  
Sbjct: 128 EDLRKSNHALFHNQDFIELSLSSNKSKLKEGLVPFLDNAAHENIIIDLQDVFMRFMFDTS 187

Query: 168 CMSVLGIDPNYLSFEFPQVAYANAFNATEQAVF 200
            + + G DP  LS E  +V +  A +  E+A++
Sbjct: 188 SILMTGYDPMSLSIEMLEVEFGEAADIGEEAIY 220

Length = 500
>gnl|CDD|215235 PLN02426, PLN02426, cytochrome P450, family 94, subfamily C protein Back     alignment and domain information
>gnl|CDD|215627 PLN03195, PLN03195, fatty acid omega-hydroxylase; Provisional Back     alignment and domain information
>gnl|CDD|215393 PLN02738, PLN02738, carotene beta-ring hydroxylase Back     alignment and domain information
>gnl|CDD|178524 PLN02936, PLN02936, epsilon-ring hydroxylase Back     alignment and domain information
>gnl|CDD|215689 pfam00067, p450, Cytochrome P450 Back     alignment and domain information
>gnl|CDD|173595 PTZ00404, PTZ00404, cytochrome P450; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 208
PLN02169 500 fatty acid (omega-1)-hydroxylase/midchain alkane h 99.95
PTZ00404 482 cytochrome P450; Provisional 99.94
KOG0158 499 consensus Cytochrome P450 CYP3/CYP5/CYP6/CYP9 subf 99.93
KOG0156 489 consensus Cytochrome P450 CYP2 subfamily [Secondar 99.93
PLN02936 489 epsilon-ring hydroxylase 99.93
PLN02687 517 flavonoid 3'-monooxygenase 99.93
KOG0157 497 consensus Cytochrome P450 CYP4/CYP19/CYP26 subfami 99.93
PLN03195 516 fatty acid omega-hydroxylase; Provisional 99.92
PLN02290 516 cytokinin trans-hydroxylase 99.92
PLN02738 633 carotene beta-ring hydroxylase 99.92
PLN00110 504 flavonoid 3',5'-hydroxylase (F3'5'H); Provisional 99.92
PLN02971 543 tryptophan N-hydroxylase 99.91
PLN02966 502 cytochrome P450 83A1 99.91
PLN03234 499 cytochrome P450 83B1; Provisional 99.91
PLN03112 514 cytochrome P450 family protein; Provisional 99.91
PLN02183 516 ferulate 5-hydroxylase 99.91
PF00067 463 p450: Cytochrome P450 p450 superfamily signature b 99.9
PLN02500 490 cytochrome P450 90B1 99.9
PLN02394 503 trans-cinnamate 4-monooxygenase 99.89
PLN02655 466 ent-kaurene oxidase 99.89
PLN00168 519 Cytochrome P450; Provisional 99.89
KOG0159 519 consensus Cytochrome P450 CYP11/CYP12/CYP24/CYP27 99.88
PLN02196 463 abscisic acid 8'-hydroxylase 99.88
PLN03018 534 homomethionine N-hydroxylase 99.88
PLN03141 452 3-epi-6-deoxocathasterone 23-monooxygenase; Provis 99.86
PLN02774 463 brassinosteroid-6-oxidase 99.86
PLN02426 502 cytochrome P450, family 94, subfamily C protein 99.86
PLN02302 490 ent-kaurenoic acid oxidase 99.85
PLN02648 480 allene oxide synthase 99.83
PLN02987 472 Cytochrome P450, family 90, subfamily A 99.83
KOG0684 486 consensus Cytochrome P450 [Secondary metabolites b 99.28
COG2124 411 CypX Cytochrome P450 [Secondary metabolites biosyn 99.22
>PLN02169 fatty acid (omega-1)-hydroxylase/midchain alkane hydroxylase Back     alignment and domain information 
Probab=99.95  E-value=8.7e-27  Score=190.39  Aligned_cols=188  Identities=35%  Similarity=0.641  Sum_probs=149.6

Q ss_pred             cCCCCccccchHHHHHcccchHHHHHHHHHHcCCceEEeccccCcccEEEecChhHHHHhhhcCCCCCCCChhhhhhhhh
Q 036716           15 SFKRSSRTRMLSTLVLNAHQLHEFATRVLQKSRGTLEFKGPWFAKMDFIITSDPMNVHYISSKNFSNYPKGPDLRMILEP   94 (208)
Q Consensus        15 ~p~~~p~~G~~~~~~~~~~~~~~~~~~~~~~yG~i~~~~~~~~~~~~~v~v~~p~~~~~i~~~~~~~~~~~~~~~~~~~~   94 (208)
                      +|+++|++||++.+........+++.++..+||..+++.|+|+|+.|+|+++|||++++|+.++.+.|+++..+.....+
T Consensus        35 ~p~~~pl~G~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~g~~~~vvv~dpe~i~~il~~~~~~~~k~~~~~~~~~~  114 (500)
T PLN02169         35 ILKNWPFLGMLPGMLHQIPRIYDWTVEVLEASNLTFYFKGPWLSGTDMLFTADPKNIHHILSSNFGNYPKGPEFKKIFDV  114 (500)
T ss_pred             CCCCCCcccchHHHHHccCcHHHHHHHHHHhCCCcEEEEeeccCCCCeEEEcCHHHHHHHHhhCcccCCCcHHHHHHHHh
Confidence            78889999999888655445667777777789988888777999999999999999999999887888998765544566


Q ss_pred             ccCcccccCChhHHHHHHhhhcccchhHHHHH-HHHHHHHHHHhhHHHHHhhhhccCCcccHHHHHHHHHHHHHHHHhhc
Q 036716           95 FGDGVFAADGNLWKMQRKMIHSVMKHNKFESA-LEKTIYQKLENGLIPVLDHASEVGIKVDLQDVFQRFTFDNICMSVLG  173 (208)
Q Consensus        95 ~g~~i~~~~g~~w~~~Rk~l~~~f~~~~l~~~-~~~~~~~~v~~~~~~~l~~~~~~~~~vd~~~~~~~~~~~~i~~~~fg  173 (208)
                      +|+|+++++|+.||++||+++|+|+...++.+ ..+.++++ ++.+++.+++.++.++++|+.+.+.++|+|+|++++||
T Consensus       115 ~g~gl~~~~g~~Wr~~Rk~l~p~F~~~~~~~~~~~~~~~~~-~~~l~~~l~~~~~~~~~vd~~~~~~~~t~dvi~~~~fG  193 (500)
T PLN02169        115 LGEGILTVDFELWEDLRKSNHALFHNQDFIELSLSSNKSKL-KEGLVPFLDNAAHENIIIDLQDVFMRFMFDTSSILMTG  193 (500)
T ss_pred             hcCcccccCcHHHHHHHHHHHHHhhhHHHHHHHHHHHHHHH-HHHHHHHHHHHHhcCCeEeHHHHHHHHHHHHHHhheeC
Confidence            79999999999999999999999999887653 23566666 58898988876556678999999999999999999999


Q ss_pred             CCCCCCCCCCCchHHHHHHHHHHHHHHHHh
Q 036716          174 IDPNYLSFEFPQVAYANAFNATEQAVFIAT  203 (208)
Q Consensus       174 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  203 (208)
                      .+.+..+.+....++.+++....+....+.
T Consensus       194 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  223 (500)
T PLN02169        194 YDPMSLSIEMLEVEFGEAADIGEEAIYYRH  223 (500)
T ss_pred             CCccccCCCCCCCHHHHHHHHHHHHHHhHH
Confidence            988654432223567766665554443333

>PTZ00404 cytochrome P450; Provisional Back     alignment and domain information
>KOG0158 consensus Cytochrome P450 CYP3/CYP5/CYP6/CYP9 subfamilies [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>KOG0156 consensus Cytochrome P450 CYP2 subfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PLN02936 epsilon-ring hydroxylase Back     alignment and domain information
>PLN02687 flavonoid 3'-monooxygenase Back     alignment and domain information
>KOG0157 consensus Cytochrome P450 CYP4/CYP19/CYP26 subfamilies [Secondary metabolites biosynthesis, transport and catabolism; Lipid transport and metabolism] Back     alignment and domain information
>PLN03195 fatty acid omega-hydroxylase; Provisional Back     alignment and domain information
>PLN02290 cytokinin trans-hydroxylase Back     alignment and domain information
>PLN02738 carotene beta-ring hydroxylase Back     alignment and domain information
>PLN00110 flavonoid 3',5'-hydroxylase (F3'5'H); Provisional Back     alignment and domain information
>PLN02971 tryptophan N-hydroxylase Back     alignment and domain information
>PLN02966 cytochrome P450 83A1 Back     alignment and domain information
>PLN03234 cytochrome P450 83B1; Provisional Back     alignment and domain information
>PLN03112 cytochrome P450 family protein; Provisional Back     alignment and domain information
>PLN02183 ferulate 5-hydroxylase Back     alignment and domain information
>PF00067 p450: Cytochrome P450 p450 superfamily signature b-class p450 signature mitochondrial p450 signature E-class p450 group I signature E-class p450 group II signature E-class p450 group IV signature; InterPro: IPR001128 Cytochrome P450 enzymes are a superfamily of haem-containing mono-oxygenases that are found in all kingdoms of life, and which show extraordinary diversity in their reaction chemistry Back     alignment and domain information
>PLN02500 cytochrome P450 90B1 Back     alignment and domain information
>PLN02394 trans-cinnamate 4-monooxygenase Back     alignment and domain information
>PLN02655 ent-kaurene oxidase Back     alignment and domain information
>PLN00168 Cytochrome P450; Provisional Back     alignment and domain information
>KOG0159 consensus Cytochrome P450 CYP11/CYP12/CYP24/CYP27 subfamilies [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PLN02196 abscisic acid 8'-hydroxylase Back     alignment and domain information
>PLN03018 homomethionine N-hydroxylase Back     alignment and domain information
>PLN03141 3-epi-6-deoxocathasterone 23-monooxygenase; Provisional Back     alignment and domain information
>PLN02774 brassinosteroid-6-oxidase Back     alignment and domain information
>PLN02426 cytochrome P450, family 94, subfamily C protein Back     alignment and domain information
>PLN02302 ent-kaurenoic acid oxidase Back     alignment and domain information
>PLN02648 allene oxide synthase Back     alignment and domain information
>PLN02987 Cytochrome P450, family 90, subfamily A Back     alignment and domain information
>KOG0684 consensus Cytochrome P450 [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>COG2124 CypX Cytochrome P450 [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query208
3s79_A 503 Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD 4e-13
3k9v_A 482 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitocho 3e-10
1n97_A 389 CYP175A1; electron transport; HET: SRT HEM; 1.80A 3e-08
2ij2_A 470 Cytochrome P450 BM3; monoxygenase, heme binding pr 2e-07
3dbg_A 467 Putative cytochrome P450; cytochrome P450 oxidored 3e-07
3i3k_A 461 Lanosterol 14-alpha demethylase; cytochrome P450, 5e-07
3mdm_A 456 Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, th 6e-07
2ve3_A 444 Putative cytochrome P450 120; oxidoreductase, mono 6e-07
3n9y_A 487 Cholesterol SIDE-chain cleavage enzyme; cytochrome 1e-06
3dax_A 491 Cytochrome P450 7A1; cholesterol, cholesterol 7-al 1e-06
3gw9_A 450 Sterol 14alpha-demethylase; CYP51, cytochrome P450 1e-06
2cib_A 455 Cytochrome P450 51; heme, heme lipid synthesis, me 1e-05
3b6h_A 498 Prostacyclin synthase; enzyme-inhibitor complex, C 2e-04
3nxu_A 485 Cytochrome P450 3A4; alpha beta protein, cytochrom 6e-04
>3s79_A Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD; 2.75A {Homo sapiens} PDB: 3eqm_A* 3s7s_A* Length = 503 Back     alignment and structure
 Score = 66.2 bits (162), Expect = 4e-13
 Identities = 26/209 (12%), Positives = 56/209 (26%), Gaps = 17/209 (8%)

Query: 1   MIVAFLFIFIGCLWSFKRSSRTRMLST--------LVLNAHQLHEFATRVLQKSRGTLEF 52
            + A     +     F         S+         +        F    +  +      
Sbjct: 20  AMPAATMPVLLLTGLFLLVWNYEGTSSIPGPGYCMGIGPLISHGRFLWMGIGSACNYYNR 79

Query: 53  KGP-----WFAKMDFIITSDPMNVHYISSKNFSNYPKGPDLRMILEPF--GDGVFAADGN 105
                   W +  + +I S   ++ +I   N  +   G  L +          +F  +  
Sbjct: 80  VYGEFMRVWISGEETLIISKSSSMFHIMKHNHYSSRFGSKLGLQCIGMHEKGIIFNNNPE 139

Query: 106 LWKMQRKMIHSVMKHNKFESALEKTIYQKLENGLIPVLDHASEVGIKVDLQDVFQRFTFD 165
           LWK  R      +        +   +  +     +  L+  +     VD+  + +R   D
Sbjct: 140 LWKTTRPFFMKALSGPGLVRMVT--VCAESLKTHLDRLEEVTNESGYVDVLTLLRRVMLD 197

Query: 166 NICMSVLGIDPNYLSFEFPQVAYANAFNA 194
                 L I  +  +       Y +A+ A
Sbjct: 198 TSNTLFLRIPLDESAIVVKIQGYFDAWQA 226
>3k9v_A 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial; mitochondrial cytochrome P450, monotopic membrane protein, monooxygenase; HET: HEM CPS; 2.50A {Rattus norvegicus} PDB: 3k9y_A* Length = 482 Back     alignment and structure
>1n97_A CYP175A1; electron transport; HET: SRT HEM; 1.80A {Thermus thermophilus} SCOP: a.104.1.1 PDB: 1wiy_A* Length = 389 Back     alignment and structure
>2ij2_A Cytochrome P450 BM3; monoxygenase, heme binding protein, atomic resolution, oxidoreductase; HET: HEM; 1.20A {Bacillus megaterium} SCOP: a.104.1.1 PDB: 2hpd_A* 1fag_A* 1jpz_A* 1zo9_A* 1zo4_A* 1zoa_A* 3m4v_A* 3ekb_A* 3ben_A* 1fah_A* 2nnb_A* 3kx3_A* 3ekd_A* 3ekf_A* 1smi_A* 1smj_A* 3kx4_A* 2ij3_A* 2ij4_A* 3hf2_A* ... Length = 470 Back     alignment and structure
>3dbg_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP170A1, molecular mechanism, heme, iron, metal-binding, monooxygenase; HET: HEM; 2.60A {Streptomyces coelicolor A3} PDB: 3el3_A* Length = 467 Back     alignment and structure
>3mdm_A Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, thioperamide, monooxygenase, metab enzyme, oxidoreductase, heme, cholesterol metabolism; HET: HEM FJZ; 1.60A {Homo sapiens} PDB: 2q9g_A* 2q9f_A* 3mdr_A* 3mdt_A* 3mdv_A* Length = 456 Back     alignment and structure
>2ve3_A Putative cytochrome P450 120; oxidoreductase, monooxygenase, metal-binding, heme, iron; HET: HEM REA; 2.10A {Synechocystis SP} PDB: 2ve4_A* Length = 444 Back     alignment and structure
>3n9y_A Cholesterol SIDE-chain cleavage enzyme; cytochrome P450, cholesterol SIDE chain cleavage, structural genomics, structural genomics consortium, SGC; HET: HEM CLR; 2.10A {Homo sapiens} PDB: 3n9z_A* 3na1_A* 3na0_A* 3mzs_A* Length = 487 Back     alignment and structure
>3dax_A Cytochrome P450 7A1; cholesterol, cholesterol 7-alpha hydroxylase, structural genomics, structural genomics consortium, SGC, cholesterol metabolism; HET: HEM; 2.15A {Homo sapiens} PDB: 3sn5_A* Length = 491 Back     alignment and structure
>3gw9_A Sterol 14alpha-demethylase; CYP51, cytochrome P450, heme, oxidoreductase, monooxygenase, sterol biosynthesis, lipids, endoplasmic reticulum; HET: HEM VNI; 1.87A {Trypanosoma brucei} PDB: 3g1q_A* 3p99_A* 2wv2_A* 2x2n_A* 3khm_A* 3k1o_A* 3ksw_A* 2wx2_A* 2wuz_A* 3l4d_A* Length = 450 Back     alignment and structure
>2cib_A Cytochrome P450 51; heme, heme lipid synthesis, metal-binding, monooxygenase, NADP, oxidoreductase, protein-inhibitor complex; HET: HEM CM6; 1.50A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 2bz9_A* 1x8v_A* 2ci0_A* 2vku_A* 2w09_A* 2w0b_A* 2w0a_A* 1h5z_A* 1ea1_A* 1e9x_A* 1u13_A* Length = 455 Back     alignment and structure
>3b6h_A Prostacyclin synthase; enzyme-inhibitor complex, CYP8A1, cytochrome P450, endoplasmic reticulum, fatty acid biosynthesis, heme, iron, isomerase; HET: BOG MXD HEM; 1.62A {Homo sapiens} PDB: 2iag_A* Length = 498 Back     alignment and structure
>3nxu_A Cytochrome P450 3A4; alpha beta protein, cytochrome P450 fold, hemoprotein, monoo cytochrome P450 reductase, endoplasmic reticulum; HET: HEM RIT; 2.00A {Homo sapiens} PDB: 1w0e_A* 1w0g_A* 2j0d_A* 2v0m_A* 1w0f_A* 1tqn_A* 3ua1_A* 3tjs_A* Length = 485 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query208
3nxu_A 485 Cytochrome P450 3A4; alpha beta protein, cytochrom 99.94
3k9v_A 482 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitocho 99.94
3s79_A 503 Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD 99.91
3pm0_A 507 Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase 99.91
3e6i_A 476 CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, mono 99.91
2ij2_A 470 Cytochrome P450 BM3; monoxygenase, heme binding pr 99.9
3swz_A 494 Steroid 17-alpha-hydroxylase/17,20 lyase; cytochro 99.9
3n9y_A 487 Cholesterol SIDE-chain cleavage enzyme; cytochrome 99.9
2fdv_A 476 Cytochrome P450 2A6; CYP2A6, monooxygenase, drug m 99.9
1po5_A 476 Cytochrome P450 2B4; oxidoreductase, membrane prot 99.89
2hi4_A 495 Cytochrome P450 1A2; CYP1A2, monooxygenase, drug m 99.89
3gw9_A 450 Sterol 14alpha-demethylase; CYP51, cytochrome P450 99.89
3ld6_A 461 Lanosterol 14-alpha demethylase; cytochrome P450, 99.88
3czh_A 481 Cytochrome P450 2R1; vitamin D, vitamin S 25-hydro 99.88
3dbg_A 467 Putative cytochrome P450; cytochrome P450 oxidored 99.88
1r9o_A 477 Cytochrome P450 2C9; monooxygenase, drug metaboliz 99.88
1n97_A 389 CYP175A1; electron transport; HET: SRT HEM; 1.80A 99.87
3mdm_A 456 Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, th 99.87
3tbg_A 479 Cytochrome P450 2D6; monooxygenase, thioridazine, 99.87
3i3k_A 461 Lanosterol 14-alpha demethylase; cytochrome P450, 99.86
2ve3_A 444 Putative cytochrome P450 120; oxidoreductase, mono 99.86
2cib_A 455 Cytochrome P450 51; heme, heme lipid synthesis, me 99.86
3qz1_A 496 Steroid 21-hydroxylase; P450 monooxygenase, oxidor 99.84
2cd8_A 436 Cytochrome P450 monooxygenase; oxidoreductase, PIK 99.84
1izo_A 417 P450bsbeta, cytochrome P450 152A1; heme protein, p 99.83
3awm_A 415 Fatty acid alpha-hydroxylase; cytochrome P450, per 99.81
3v8d_A 491 Cholesterol 7-alpha-monooxygenase; cytochrome, oxi 99.8
1jfb_A 404 Nitric-oxide reductase cytochrome P450 55A1; cytoc 99.76
1ued_A 406 P450 OXYC, P450 monooxygenase; cytochrome P450 van 99.75
3b6h_A 498 Prostacyclin synthase; enzyme-inhibitor complex, C 99.74
3dax_A 491 Cytochrome P450 7A1; cholesterol, cholesterol 7-al 99.74
3dsk_A 495 Cytochrome P450 74A, chloroplast; P450 fold, fatty 99.74
2zbx_A 412 Cytochrome P450-SU1; beta prism, heme, iron, metal 99.73
3oo3_A 384 OXY protein; cytochrome P450, monooxygenase, PCD-t 99.72
1s1f_A 406 Putative cytochrome P450; cytochrome P450 oxidored 99.71
3abb_A 408 CYP105D6, cytochrome P450 hydroxylase; oxidoreduct 99.71
3dan_A 473 Cytochrome P450 74A2; AOS heme cytochrome P450 str 99.71
3a4g_A 411 Vitamin D hydroxylase; cytochrome P450, hemoprotei 99.7
1z8o_A 404 6-deoxyerythronolide B hydroxylase; heme, CYP, ery 99.69
2wm5_A 435 CYP124, putative cytochrome P450 124; metal-bindin 99.69
3ejb_B 404 Biotin biosynthesis cytochrome P450-like enzyme; p 99.69
1odo_A 408 Putative cytochrome P450 154A1; P450 monooxygenase 99.69
3b98_A 475 Prostaglandin I2 synthase; prostacyclin synthase, 99.68
2zwu_A 415 Camphor 5-monooxygenase; P450CAM, camphor-hydroxyl 99.68
3aba_A 403 Cytochrome P450; oxidoreductase, heme, monooxygena 99.68
2xkr_A 398 CYP142, putative cytochrome P450 142; oxidoreducta 99.67
2xbk_A 404 PIMD protein; epoxidation, oxidoreductase; HET: HE 99.67
3tyw_A 417 Putative cytochrome P450; P450 monooxygenase, oxid 99.66
2z3t_A 425 Cytochrome P450; monoxygenase, oxydoreductase, hem 99.66
1gwi_A 411 CYP154C1, cytochrome P450 154C1; oxidoreductase, m 99.65
2dkk_A 411 Cytochrome P450; CYP158A1, INHI oxidoreductase; HE 99.65
2uuq_A 414 CYP130, cytochrome P450 130; iron, heme, monooxyge 99.65
2y5n_A 417 MYCG, P-450-like protein; oxidoreductase, mycinami 99.65
2z36_A 413 MOXA, cytochrome P450 type compactin 3'',4''- hydr 99.64
3ivy_A 433 Cytochrome P450 CYP125; cholesterol, monooxygenase 99.64
3tkt_A 450 Cytochrome P450; aromatic hydrocarbon binding of P 99.63
4fb2_A 398 P450CIN; heme, monooxygenase, cindoxin, oxidoreduc 99.63
1cpt_A 428 Cytochrome P450-TERP; oxidoreductase(oxygenase); H 99.61
2jjn_A 411 Cytochrome P450 113A1; oxidoreductase, iron, heme, 99.6
1q5d_A 419 P450 epoxidase; cytochrome P450, epothilone, oxydo 99.59
3buj_A 397 CALO2; heme, iron, metal-binding, monooxygenase, o 99.58
1lfk_A 398 OXYB, P450 monooxygenase; oxidative phenol couplin 99.57
1io7_A 368 Cytochrome P450 CYP119; thermophilic, cytochromo P 99.57
3r9b_A 418 Cytochrome P450 164A2; monooxygenase, oxidoreducta 99.56
3nc3_A 441 Cytochrome P450 CYPX; cytochrome P450 oxidase, HAE 99.56
3mgx_A 415 Putative P450 monooxygenase; cytochrome P450 oxida 99.55
3b4x_A 367 367AA long hypothetical cytochrome P450; HEM prote 99.54
2rfb_A 343 Cytochrome P450; heme, iron, metal-binding, monoox 99.53
3oft_A 396 Cytochrome P450, CYP101C1; oxidoreductase; HET: HE 99.51
1n40_A 396 P450 MT2, cytochrome P450 121; heme binding, oxyge 99.51
3rwl_A 426 Cytochrome P450 alkane hydroxylase 1 CYP153A7; P45 99.51
3lxh_A 421 Cytochrome P450; heme, iron, metal-binding, monoox 99.48
2wiy_A 394 XPLA-heme, cytochrome P450-like protein XPLA; CYT- 99.44
3p3o_A 416 Cytochrome P450; monooxygenase, oxidoreductase; HE 99.36
4dnj_A 412 Putative cytochrome P450; oxidoreductase; HET: HEM 99.24
4dxy_A 417 Cytochrome P450, CYP101D2; cytochrome P450 mutant, 98.95
2yjn_B 381 Erycii, DTDP-4-keto-6-deoxy-hexose 3,4-isomerase; 98.12
>3nxu_A Cytochrome P450 3A4; alpha beta protein, cytochrome P450 fold, hemoprotein, monoo cytochrome P450 reductase, endoplasmic reticulum; HET: HEM RIT; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1w0e_A* 1w0g_A* 2j0d_A* 2v0m_A* 1w0f_A* 1tqn_A* 3ua1_A* 3tjs_A* Back     alignment and structure
Probab=99.94  E-value=2.1e-26  Score=186.38  Aligned_cols=158  Identities=17%  Similarity=0.241  Sum_probs=137.2

Q ss_pred             cCCCCccccchHHHHHcccchHHHHHHHHHHcCCceEEeccccCcccEEEecChhHHHHhhhcC-CCCCCCChhhhhhhh
Q 036716           15 SFKRSSRTRMLSTLVLNAHQLHEFATRVLQKSRGTLEFKGPWFAKMDFIITSDPMNVHYISSKN-FSNYPKGPDLRMILE   93 (208)
Q Consensus        15 ~p~~~p~~G~~~~~~~~~~~~~~~~~~~~~~yG~i~~~~~~~~~~~~~v~v~~p~~~~~i~~~~-~~~~~~~~~~~~~~~   93 (208)
                      ||+++|++||++.+..   +.+.++.+++++||+++++   ++|+.++|+++||+++++|+.++ .+.|.+++.+.. ..
T Consensus        18 GP~~~PliGn~~~~~~---~~~~~~~~~~~~yG~i~~~---~~g~~~~vvv~dp~~i~~il~~~~~~~f~~r~~~~~-~~   90 (485)
T 3nxu_A           18 GPTPLPFLGNILSYHK---GFCMFDMECHKKYGKVWGF---YDGQQPVLAITDPDMIKTVLVKECYSVFTNRRPFGP-VG   90 (485)
T ss_dssp             CCCCBTTTBTGGGGGG---CHHHHHHHHHHHHCSEEEE---EETTEEEEEECCHHHHHHHHTTTTTTTCCCCCCCSC-CG
T ss_pred             CCCCcCeecCcHHhhc---ChHHHHHHHHHHcCCeEEE---EeCCCCEEEECCHHHHHHHHhccchhhccCCccccc-cc
Confidence            8899999999998853   4788889999999999999   89999999999999999999876 566776654322 23


Q ss_pred             hccCcccccCChhHHHHHHhhhcccchhHHHHHHHHHHHHHHHhhHHHHHhhhhccCCcccHHHHHHHHHHHHHHHHhhc
Q 036716           94 PFGDGVFAADGNLWKMQRKMIHSVMKHNKFESALEKTIYQKLENGLIPVLDHASEVGIKVDLQDVFQRFTFDNICMSVLG  173 (208)
Q Consensus        94 ~~g~~i~~~~g~~w~~~Rk~l~~~f~~~~l~~~~~~~~~~~v~~~~~~~l~~~~~~~~~vd~~~~~~~~~~~~i~~~~fg  173 (208)
                      .+++++++.+|+.|+++||+++++|+.++++.+ .+.++++ ++.+++.+.+..+.++++|+.+.+..+++|+|+.++||
T Consensus        91 ~~~~~l~~~~g~~w~~~R~~~~~~fs~~~l~~~-~~~i~~~-~~~l~~~l~~~~~~g~~~d~~~~~~~~~~dvi~~~~fG  168 (485)
T 3nxu_A           91 FMKSAISIAEDEEWKRLRSLLSPTFTSGKLKEM-VPIIAQY-GDVLVRNLRREAETGKPVTLKDVFGAYSMDVITSTSFG  168 (485)
T ss_dssp             GGGGSTTTCCHHHHHHHHHHHGGGGCHHHHHHH-HHHHHHH-HHHHHHHHHHHHHHTCCEEHHHHHHHHHHHHHHHHHHS
T ss_pred             ccccCccccCCcHHHHHHhhcChhcCHHHHHHH-HHHHHHH-HHHHHHHHHHHhccCCcCcHHHHHHHHHHHHHHHHHcC
Confidence            567889999999999999999999999999996 6899998 59999999876666778999999999999999999999


Q ss_pred             CCCCCCCC
Q 036716          174 IDPNYLSF  181 (208)
Q Consensus       174 ~~~~~~~~  181 (208)
                      .+++..++
T Consensus       169 ~~~~~~~~  176 (485)
T 3nxu_A          169 VNIDSLNN  176 (485)
T ss_dssp             CCCCGGGC
T ss_pred             CccccccC
Confidence            99987654
>3k9v_A 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial; mitochondrial cytochrome P450, monotopic membrane protein, monooxygenase; HET: HEM CPS; 2.50A {Rattus norvegicus} PDB: 3k9y_A* Back     alignment and structure
>3s79_A Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD; 2.75A {Homo sapiens} PDB: 3eqm_A* 3s7s_A* 4gl5_A* 4gl7_A* Back     alignment and structure
>3pm0_A Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase, alpha-naphthoflavone, 17BETA-estradiol, oxidoreductase; HET: HEM BHF; 2.70A {Homo sapiens} Back     alignment and structure
>3e6i_A CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, monooxygenase, acetaminophen, oxidoreductase, heme, endoplasmic reticulum, iron, membrane; HET: HEM; 2.20A {Homo sapiens} PDB: 3e4e_A* 3gph_A* 3koh_A* 3lc4_A* 3t3z_A* Back     alignment and structure
>2ij2_A Cytochrome P450 BM3; monoxygenase, heme binding protein, atomic resolution, oxidoreductase; HET: HEM; 1.20A {Bacillus megaterium} SCOP: a.104.1.1 PDB: 2hpd_A* 1fag_A* 1jpz_A* 1zo9_A* 1zo4_A* 1zoa_A* 3m4v_A* 3ekb_A* 3ben_A* 1fah_A* 2nnb_A* 3kx3_A* 3ekd_A* 3ekf_A* 1smi_A* 1smj_A* 3kx4_A* 2ij3_A* 2ij4_A* 3hf2_A* ... Back     alignment and structure
>3swz_A Steroid 17-alpha-hydroxylase/17,20 lyase; cytochrome P450, CYP17A1, P450C17, P450 17A1, monooxyg 17A-hydroxylase, heme protein; HET: HEM TOK; 2.40A {Homo sapiens} PDB: 3ruk_A* Back     alignment and structure
>3n9y_A Cholesterol SIDE-chain cleavage enzyme; cytochrome P450, cholesterol SIDE chain cleavage, structural genomics, structural genomics consortium, SGC; HET: HEM CLR; 2.10A {Homo sapiens} PDB: 3n9z_A* 3na1_A* 3na0_A* 3mzs_A* Back     alignment and structure
>2fdv_A Cytochrome P450 2A6; CYP2A6, monooxygenase, drug metabolizing enzyme, coumarin 7-hydroxylase, nicotine oxidase, oxidoreductase; HET: HEM D2G; 1.65A {Homo sapiens} PDB: 1z11_A* 1z10_A* 2fdu_A* 2fdw_A* 2fdy_A* 3t3r_A* 2pg5_A* 2pg7_A* 2pg6_A* 3t3q_A* 3ebs_A* 2p85_A* 3t3s_A* Back     alignment and structure
>1po5_A Cytochrome P450 2B4; oxidoreductase, membrane protein, CYP 2B4, CYP LM2, cytochro monooxygenase; HET: HEM; 1.60A {Oryctolagus cuniculus} SCOP: a.104.1.1 PDB: 3mvr_A* 2bdm_A* 3g5n_A* 3g93_A* 3kw4_A* 3me6_A* 1suo_A* 3r1a_A* 3r1b_A* 2q6n_A* 3tk3_A* 3ibd_A* 3qoa_A* 3qu8_A* Back     alignment and structure
>2hi4_A Cytochrome P450 1A2; CYP1A2, monooxygenase, drug metabolizing enzyme, alpha-naphthoflavone, benzo(H)flavone, 7,8- benzoflavone, oxidoreductase; HET: HEM BHF; 1.95A {Homo sapiens} Back     alignment and structure
>3gw9_A Sterol 14alpha-demethylase; CYP51, cytochrome P450, heme, oxidoreductase, monooxygenase, sterol biosynthesis, lipids, endoplasmic reticulum; HET: HEM VNI; 1.87A {Trypanosoma brucei} PDB: 3tik_A* 3g1q_A* 3p99_A* 2wv2_A* 2x2n_A* 3khm_A* 3k1o_A* 3ksw_A* 2wx2_A* 2wuz_A* 3l4d_A* Back     alignment and structure
>3ld6_A Lanosterol 14-alpha demethylase; cytochrome P450, ketoconazole, S genomics, structural genomics consortium, SGC; HET: HEM KKK BCD; 2.80A {Homo sapiens} PDB: 3juv_A* 3jus_A* Back     alignment and structure
>3czh_A Cytochrome P450 2R1; vitamin D, vitamin S 25-hydroxylase, drug metabolism, structural genomics, structural genomics consortium, SGC; HET: BCD HEM D2V; 2.30A {Homo sapiens} SCOP: a.104.1.1 PDB: 2ojd_A* 3c6g_A* 3dl9_A* Back     alignment and structure
>3dbg_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP170A1, molecular mechanism, heme, iron, metal-binding, monooxygenase; HET: HEM; 2.60A {Streptomyces coelicolor A3} PDB: 3el3_A* Back     alignment and structure
>1r9o_A Cytochrome P450 2C9; monooxygenase, drug metabolizing enzyme, oxidoreductas; HET: HEM FLP; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1og5_A* 1og2_A* 2nnj_A* 1pq2_A* 2nni_A* 2nnh_A* 2vn0_A* 1nr6_A* 1dt6_A* 1n6b_A* Back     alignment and structure
>1n97_A CYP175A1; electron transport; HET: SRT HEM; 1.80A {Thermus thermophilus} SCOP: a.104.1.1 PDB: 1wiy_A* Back     alignment and structure
>3mdm_A Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, thioperamide, monooxygenase, metab enzyme, oxidoreductase, heme, cholesterol metabolism; HET: HEM FJZ; 1.60A {Homo sapiens} PDB: 2q9g_A* 2q9f_A* 3mdr_A* 3mdt_A* 3mdv_A* 4enh_A* 4fia_A* Back     alignment and structure
>3tbg_A Cytochrome P450 2D6; monooxygenase, thioridazine, oxidoreductase; HET: RTZ HEM; 2.10A {Homo sapiens} PDB: 3qm4_A* 2f9q_A* Back     alignment and structure
>2ve3_A Putative cytochrome P450 120; oxidoreductase, monooxygenase, metal-binding, heme, iron; HET: HEM REA; 2.10A {Synechocystis SP} PDB: 2ve4_A* Back     alignment and structure
>2cib_A Cytochrome P450 51; heme, heme lipid synthesis, metal-binding, monooxygenase, NADP, oxidoreductase, protein-inhibitor complex; HET: HEM CM6; 1.50A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 2bz9_A* 1x8v_A* 2ci0_A* 2vku_A* 2w09_A* 2w0b_A* 2w0a_A* 1h5z_A* 1ea1_A* 1e9x_A* 1u13_A* Back     alignment and structure
>3qz1_A Steroid 21-hydroxylase; P450 monooxygenase, oxidoreductase; HET: HEM 3QZ; 3.00A {Bos taurus} Back     alignment and structure
>2cd8_A Cytochrome P450 monooxygenase; oxidoreductase, PIKC, macrolide monooxygenase, antibiotic biosynthesis, heme, iron, metal-binding; HET: HEM PXI; 1.7A {Streptomyces venezuelae} PDB: 2c6h_A* 2bvj_A* 2ca0_A* 2c7x_A* 2vzm_A* 2vz7_A* 2vsj_A* 2wi9_A* 2whw_A* Back     alignment and structure
>1izo_A P450bsbeta, cytochrome P450 152A1; heme protein, protein-fatty acid complex, riken structural genomics/proteomics initiative, RSGI; HET: HEM PAM; 2.10A {Bacillus subtilis} SCOP: a.104.1.1 PDB: 2zqj_A* 2zqx_A* Back     alignment and structure
>3awm_A Fatty acid alpha-hydroxylase; cytochrome P450, peroxygenase, oxidoreductase; HET: HEM PLM; 1.65A {Sphingomonas paucimobilis} PDB: 3awq_A* 3awp_A* Back     alignment and structure
>3v8d_A Cholesterol 7-alpha-monooxygenase; cytochrome, oxidoreductase; HET: HEM 0GV; 1.90A {Homo sapiens} PDB: 3sn5_A* 3dax_A* Back     alignment and structure
>1jfb_A Nitric-oxide reductase cytochrome P450 55A1; cytochrome P450NOR, atomic resolutio structural genomics/proteomics initiative, RSGI; HET: HEM; 1.00A {Fusarium oxysporum} SCOP: a.104.1.1 PDB: 1jfc_A* 1gej_A* 1ged_A* 1ehe_A* 1gei_A* 1rom_A* 2rom_A* 1ehf_A* 1cl6_A* 1ehg_A* 1cmj_A* 1f25_A* 1f24_A* 1xqd_A* 1f26_A* 1cmn_A* 1ulw_A* Back     alignment and structure
>1ued_A P450 OXYC, P450 monooxygenase; cytochrome P450 vancomycin biosynthesis, oxidoreductase; HET: HEM PG4; 1.90A {Amycolatopsis orientalis} SCOP: a.104.1.1 Back     alignment and structure
>3b6h_A Prostacyclin synthase; enzyme-inhibitor complex, CYP8A1, cytochrome P450, endoplasmic reticulum, fatty acid biosynthesis, heme, iron, isomerase; HET: BOG MXD HEM; 1.62A {Homo sapiens} PDB: 2iag_A* Back     alignment and structure
>3dax_A Cytochrome P450 7A1; cholesterol, cholesterol 7-alpha hydroxylase, structural genomics, structural genomics consortium, SGC, cholesterol metabolism; HET: HEM; 2.15A {Homo sapiens} PDB: 3sn5_A* Back     alignment and structure
>3dsk_A Cytochrome P450 74A, chloroplast; P450 fold, fatty acid biosynthesis, heme, iron, synthesis, lyase, metal-binding, oxylipin biosynthesis; HET: HEM T25; 1.55A {Arabidopsis thaliana} PDB: 2rcm_A* 3dsj_A* 3dsi_A* 2rcl_A* 2rch_A* 3cli_A* Back     alignment and structure
>2zbx_A Cytochrome P450-SU1; beta prism, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.50A {Streptomyces griseolus} PDB: 2zby_A* 2zbz_A* 3cv8_A* 3cv9_A* Back     alignment and structure
>3oo3_A OXY protein; cytochrome P450, monooxygenase, PCD-teicoplanin aglycone, oxidoreductase; HET: HEM; 2.20A {Actinoplanes teichomyceticus} SCOP: a.104.1.0 PDB: 3o1a_A* Back     alignment and structure
>1s1f_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP158A2, anti biosynthesis, oxidoreductase; HET: HEM PIM; 1.50A {Streptomyces coelicolor} SCOP: a.104.1.1 PDB: 1se6_A* 2d0e_A* 1t93_A* 2d09_A* 3tzo_A* Back     alignment and structure
>3abb_A CYP105D6, cytochrome P450 hydroxylase; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding; HET: HEM; 2.30A {Streptomyces avermitilis} Back     alignment and structure
>3dan_A Cytochrome P450 74A2; AOS heme cytochrome P450 structure, fatty acid biosynthesis, heme, iron, lipid synthesis, lyase, metal-binding; HET: HEM; 1.80A {Parthenium argentatum} PDB: 3dam_A* 3dbm_A* Back     alignment and structure
>3a4g_A Vitamin D hydroxylase; cytochrome P450, hemoprotein, monoox oxidoreductase; HET: HEM; 1.75A {Pseudonocardia autotrophica} PDB: 3a4h_A* 3a51_A* 3a4z_A* 3a50_A* Back     alignment and structure
>1z8o_A 6-deoxyerythronolide B hydroxylase; heme, CYP, erythromycin, oxidoreductase; HET: HEM DEB; 1.70A {Saccharopolyspora erythraea} SCOP: a.104.1.1 PDB: 1z8p_A* 1z8q_A* 1jio_A* 1jip_A* 1eup_A* 1egy_A* 1jin_A* 1oxa_A* Back     alignment and structure
>2wm5_A CYP124, putative cytochrome P450 124; metal-binding, oxidoreductase, omega-hydroxylation, iron, heme, fatty acid, monooxygenase; HET: HEM; 1.50A {Mycobacterium tuberculosis} PDB: 2wm4_A* Back     alignment and structure
>3ejb_B Biotin biosynthesis cytochrome P450-like enzyme; protein-protein complex, cytochrome P450 fold, carrier protein, 4-helix bundle, cytoplasm; HET: ZMP HTG HEM; 2.00A {Bacillus subtilis} SCOP: a.104.1.0 PDB: 3ejd_B* 3eje_B* Back     alignment and structure
>1odo_A Putative cytochrome P450 154A1; P450 monooxygenase, oxidoreductase; HET: HEM PIM; 1.85A {Streptomyces coelicolor} SCOP: a.104.1.1 Back     alignment and structure
>3b98_A Prostaglandin I2 synthase; prostacyclin synthase, cytochrome P450 8A1, CYP8A1, isomerase; HET: HEM; 2.08A {Danio rerio} PDB: 3b99_A* Back     alignment and structure
>2zwu_A Camphor 5-monooxygenase; P450CAM, camphor-hydroxylase, heme, iron, metal-binding, oxidoreductase, substrate-soaking, cytoplasm; HET: HEM CAM; 1.30A {Pseudomonas putida} PDB: 1gem_A* 1iwi_A* 2l8m_A* 2z97_A* 1gek_A* 2zax_A* 2zaw_A* 2zwt_A* 1rf9_A* 1lwl_A* 1iwk_A* 1iwj_A* 2zui_A* 2fe6_A* 1geb_A* 1yrc_A* 1noo_A* 1cp4_A* 1pha_A* 1phc_A* ... Back     alignment and structure
>3aba_A Cytochrome P450; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding, oxidoreductase-antibiotic complex; HET: HEM FLI; 1.80A {Streptomyces avermitilis} PDB: 3e5j_A* 3e5k_A* 3e5l_A* Back     alignment and structure
>2xkr_A CYP142, putative cytochrome P450 142; oxidoreductase; HET: HEM; 1.60A {Mycobacterium tuberculosis} Back     alignment and structure
>2xbk_A PIMD protein; epoxidation, oxidoreductase; HET: HEM XBK; 1.95A {Streptomyces natalensis} PDB: 2x9p_A* Back     alignment and structure
>3tyw_A Putative cytochrome P450; P450 monooxygenase, oxidoreductase; HET: HEM; 2.90A {Streptomyces coelicolor} PDB: 4fxb_A* Back     alignment and structure
>2z3t_A Cytochrome P450; monoxygenase, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM; 1.90A {Streptomyces SP} PDB: 2z3u_A* 3a1l_A* Back     alignment and structure
>1gwi_A CYP154C1, cytochrome P450 154C1; oxidoreductase, macrolide antibiotics, 12- and 14- carbon macrolactone monooxygenase, heme; HET: HEM; 1.92A {Streptomyces coelicolor} SCOP: a.104.1.1 Back     alignment and structure
>2dkk_A Cytochrome P450; CYP158A1, INHI oxidoreductase; HET: HEM; 1.97A {Streptomyces coelicolor} PDB: 2nz5_A* 2nza_A* Back     alignment and structure
>2uuq_A CYP130, cytochrome P450 130; iron, heme, monooxygenase, metal-binding, oxidoreductase, hypothetical protein; HET: HEM; 1.46A {Mycobacterium tuberculosis} PDB: 2uvn_A* 2whf_A* 2wh8_A* 2wgy_A* Back     alignment and structure
>2y5n_A MYCG, P-450-like protein; oxidoreductase, mycinamicin biosynthesis; HET: HEM MYV; 1.62A {Micromonospora griseorubida} PDB: 2y46_A* 2y5z_A* 2y98_A* 2yca_A* 2ygx_A* Back     alignment and structure
>2z36_A MOXA, cytochrome P450 type compactin 3'',4''- hydroxylase; CYP105, oxidoreductase; HET: HEM MES; 2.80A {Nonomuraea recticatena} Back     alignment and structure
>3ivy_A Cytochrome P450 CYP125; cholesterol, monooxygenase, H iron, metal-binding, oxidoreductase; HET: HEM; 1.35A {Mycobacterium tuberculosis} PDB: 3iw0_A* 3iw1_A* 3iw2_A* 2x5w_A* 2x5l_A* 2xc3_A* 2xn8_A* Back     alignment and structure
>3tkt_A Cytochrome P450; aromatic hydrocarbon binding of P450 E oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} Back     alignment and structure
>4fb2_A P450CIN; heme, monooxygenase, cindoxin, oxidoreductase; HET: HEM EDO; 1.37A {Citrobacter braakii} PDB: 4fmx_A* 4fyz_A* 1t2b_A* 3bdz_A* 3be0_A* Back     alignment and structure
>1cpt_A Cytochrome P450-TERP; oxidoreductase(oxygenase); HET: HEM; 2.30A {Pseudomonas SP} SCOP: a.104.1.1 Back     alignment and structure
>2jjn_A Cytochrome P450 113A1; oxidoreductase, iron, heme, monooxygenase, metal-binding, AN biosynthesis, TIE-ROD mechanism of action; HET: HEM; 1.59A {Saccharopolyspora erythraea} PDB: 2jjo_A* 2jjp_A* 2xfh_A* 2wio_A* 2vrv_A* Back     alignment and structure
>1q5d_A P450 epoxidase; cytochrome P450, epothilone, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM EPB; 1.93A {Sorangium cellulosum} SCOP: a.104.1.1 PDB: 1q5e_A* 1pkf_A* Back     alignment and structure
>3buj_A CALO2; heme, iron, metal-binding, monooxygenase, oxidoreducta binding protein; HET: HEM; 2.47A {Micromonospora echinospora} Back     alignment and structure
>1lfk_A OXYB, P450 monooxygenase; oxidative phenol coupling reaction P450 vancomycin, oxidoreductase; HET: HEM; 1.70A {Amycolatopsis orientalis} SCOP: a.104.1.1 PDB: 1lg9_A* 1lgf_A* Back     alignment and structure
>1io7_A Cytochrome P450 CYP119; thermophilic, cytochromo P450, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: HEM; 1.50A {Sulfolobus solfataricus} SCOP: a.104.1.1 PDB: 1f4u_A* 1f4t_A* 1io9_A* 1io8_A* Back     alignment and structure
>3r9b_A Cytochrome P450 164A2; monooxygenase, oxidoreductase; HET: HEM D12; 1.89A {Mycobacterium smegmatis} PDB: 3r9c_A* Back     alignment and structure
>3nc3_A Cytochrome P450 CYPX; cytochrome P450 oxidase, HAEM protein, oxidoreductase; HET: HEM; 2.66A {Bacillus subtilis} PDB: 3nc5_A* 3nc6_A* 3nc7_A* Back     alignment and structure
>3mgx_A Putative P450 monooxygenase; cytochrome P450 oxidase, HAEM protein, vancomycin biosynthes carrier protein, oxidoreductase; HET: HEM; 2.10A {Amycolatopsis balhimycina} Back     alignment and structure
>3b4x_A 367AA long hypothetical cytochrome P450; HEM protein, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.94A {Sulfolobus tokodaii} PDB: 1ue8_A* Back     alignment and structure
>2rfb_A Cytochrome P450; heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 2.50A {Picrophilus torridus} PDB: 2rfc_A* Back     alignment and structure
>3oft_A Cytochrome P450, CYP101C1; oxidoreductase; HET: HEM; 1.90A {Novosphingobium aromaticivorans} PDB: 3ofu_A* Back     alignment and structure
>1n40_A P450 MT2, cytochrome P450 121; heme binding, oxygen binding, P450 fold, structural genomics, PSI, protein structure initiative; HET: HEM; 1.06A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 1n4g_A* 2ij5_A* 2ij7_A* 3g5f_A* 3g5h_A* 3cy0_A* 3cy1_A* 3cxv_A* 3cxx_A* 3cxz_A* 3cxy_A* Back     alignment and structure
>3rwl_A Cytochrome P450 alkane hydroxylase 1 CYP153A7; P450 monooxygenase, oxidoreductase; HET: HEM; 2.00A {Sphingopyxis macrogoltabida} Back     alignment and structure
>3lxh_A Cytochrome P450; heme, iron, metal-binding, monooxygena oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} SCOP: a.104.1.0 PDB: 3lxi_A* Back     alignment and structure
>2wiy_A XPLA-heme, cytochrome P450-like protein XPLA; CYT-P450, RDX, bioremediation, electron transport; HET: HEM; 1.49A {Rhodococcus} PDB: 2wiv_A* Back     alignment and structure
>3p3o_A Cytochrome P450; monooxygenase, oxidoreductase; HET: HEM; 1.54A {Streptomyces thioluteus} PDB: 3p3x_A* 3p3z_A* 3p3l_A* Back     alignment and structure
>4dnj_A Putative cytochrome P450; oxidoreductase; HET: HEM ANN; 1.80A {Rhodopseudomonas palustris} PDB: 2fr7_A* 4do1_A* 4dnz_A* Back     alignment and structure
>4dxy_A Cytochrome P450, CYP101D2; cytochrome P450 mutant, HAEM-dependent, mono-oxygenases, oxidoreductase; HET: HEM; 2.00A {Novosphingobium aromaticivorans} PDB: 3nv6_A* 3nv5_A* Back     alignment and structure
>2yjn_B Erycii, DTDP-4-keto-6-deoxy-hexose 3,4-isomerase; transferase, cytochrome P450; 3.09A {Saccharopolyspora erythraea} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 208
d1po5a_ 465 a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabb 9e-12
d1tqna_ 472 a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Huma 5e-10
d3czha1 463 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2 7e-10
d1r9oa_ 467 a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Huma 5e-09
d2ij2a1 453 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus 4e-07
d1n97a_ 385 a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [Tax 6e-05
>d1po5a_ a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 465 Back     information, alignment and structure

class: All alpha proteins
fold: Cytochrome P450
superfamily: Cytochrome P450
family: Cytochrome P450
domain: Mammalian cytochrome p450 2b4
species: Rabbit (Oryctolagus cuniculus) [TaxId: 9986]

 Score = 61.2 bits (147), Expect = 9e-12
 Identities = 23/152 (15%), Positives = 52/152 (34%), Gaps = 3/152 (1%)

Query: 56  WFAKMDFIITSDPMNVHYISSKNFSNYPKGPDLRMILEPF-GDGVFAADGNLWKMQRKMI 114
           +      ++      +          +     + ++   F G GV  A+G  W+  R+  
Sbjct: 42  YLGSRPVVVLCGTDAIREALVDQAEAFSGRGKIAVVDPIFQGYGVIFANGERWRALRRFS 101

Query: 115 HSVMKHNKFESALEKTIYQKLENGLIPVLDHASEVGIKVDLQDVFQRFTFDNICMSVLGI 174
            + M+         +   Q+    L+  L  +   G  +D   +F   T + IC  V G 
Sbjct: 102 LATMRDFGMGKRSVEERIQEEARCLVEELRKSK--GALLDNTLLFHSITSNIICSIVFGK 159

Query: 175 DPNYLSFEFPQVAYANAFNATEQAVFIATLCQ 206
             +Y    F ++      + +  + F + + +
Sbjct: 160 RFDYKDPVFLRLLDLFFQSFSLISSFSSQVFE 191
>d1tqna_ a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Human (Homo sapiens) [TaxId: 9606]} Length = 472 Back     information, alignment and structure
>d3czha1 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapiens) [TaxId: 9606]} Length = 463 Back     information, alignment and structure
>d1r9oa_ a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Human (Homo sapiens) [TaxId: 9606]} Length = 467 Back     information, alignment and structure
>d2ij2a1 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 1404]} Length = 453 Back     information, alignment and structure
>d1n97a_ a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [TaxId: 274]} Length = 385 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query208
d2ij2a1 453 Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 99.95
d1tqna_ 472 Mammalian cytochrome P450 3a4 {Human (Homo sapiens 99.93
d2ciba1 445 Cytochrome p450 14 alpha-sterol demethylase (cyp51 99.89
d1n97a_ 385 Cyp175a1 {Thermus thermophilus [TaxId: 274]} 99.87
d1r9oa_ 467 Mammalian cytochrome p450 2c9 {Human (Homo sapiens 99.86
d3czha1 463 Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapie 99.85
d1po5a_ 465 Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus 99.83
d1izoa_ 411 Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis 99.8
d1odoa_ 401 Cyp154a1 monooxygenase {Streptomyces coelicolor [T 99.66
d1z8oa1 402 Cytochrome P450-ERYF {Saccharopolyspora erythraea 99.52
d1ueda_ 403 p450 monoxygenase OxyC {Amycolatopsis orientalis [ 99.52
d1gwia_ 403 Cyp154c1 monooxygenase {Streptomyces coelicolor [T 99.51
d1jfba_ 399 Cytochrome P450-NOR, nitric reductase {Fungus (Fus 99.48
d1s1fa_ 399 Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]} 99.31
d1q5da_ 401 Cytochrome P450epok {Sorangium cellulosum [TaxId: 99.22
d1lfka_ 394 p450 monoxygenase OxyB {Amycolatopsis orientalis [ 99.2
d1cpta_ 428 Cytochrome P450-TERP {Pseudomonas sp. [TaxId: 306] 99.13
d1re9a_ 404 Cytochrome P450-CAM {Pseudomonas putida [TaxId: 30 99.11
d1io7a_ 366 Cyp119 {Archaeon Sulfolobus solfataricus [TaxId: 2 98.99
d1n40a_ 395 Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tub 98.85
d1ue8a_ 367 Cyp119 {Archaeon Sulfolobus tokodaii [TaxId: 11195 98.64
d1weya_104 Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090 82.3
>d2ij2a1 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
class: All alpha proteins
fold: Cytochrome P450
superfamily: Cytochrome P450
family: Cytochrome P450
domain: Cytochrome P450 bm-3
species: Bacillus megaterium [TaxId: 1404]

Probab=99.95  E-value=5.2e-27  Score=186.57  Aligned_cols=160  Identities=11%  Similarity=0.125  Sum_probs=137.4

Q ss_pred             hcCCCCccccchHHHHHcccchHHHHHHHHHHcCCceEEeccccCcccEEEecChhHHHHhhhcCCCCCCCChhhhhhhh
Q 036716           14 WSFKRSSRTRMLSTLVLNAHQLHEFATRVLQKSRGTLEFKGPWFAKMDFIITSDPMNVHYISSKNFSNYPKGPDLRMILE   93 (208)
Q Consensus        14 ~~p~~~p~~G~~~~~~~~~~~~~~~~~~~~~~yG~i~~~~~~~~~~~~~v~v~~p~~~~~i~~~~~~~~~~~~~~~~~~~   93 (208)
                      -||+++|++||++.+.  ..++++.+.+++++||+||++   ++++.++|+++||++++++++++...+..+..+....+
T Consensus         4 PGP~~~p~lG~l~~l~--~~~~~~~~~~~~~kyG~if~~---~~~~~~~vvl~~~~~i~~v~~~~~~~~~~~~~~~~~~~   78 (453)
T d2ij2a1           4 PQPKTFGELKNLPLLN--TDKPVQALMKIADELGEIFKF---EAPGRVTRYLSSQRLIKEACDESRFDKNLSQALKFVRD   78 (453)
T ss_dssp             CCCCCCGGGTTGGGGC--SSCHHHHHHHHHHHHCSEEEE---EETTEEEEEECCHHHHHHHTCTTTEEECCCHHHHHHHH
T ss_pred             ccCCCcchhhCHHHhC--CCCHHHHHHHHHHHhCCEEEE---EeCCceEEEECCHHHHHHHHhcCCcccccccHhHHHHH
Confidence            3899999999998874  346889999999999999999   99999999999999999999877555666655554457


Q ss_pred             hccCccccc--CChhHHHHHHhhhcccchhHHHHHHHHHHHHHHHhhHHHHHhhhhccCCcccHHHHHHHHHHHHHHHHh
Q 036716           94 PFGDGVFAA--DGNLWKMQRKMIHSVMKHNKFESALEKTIYQKLENGLIPVLDHASEVGIKVDLQDVFQRFTFDNICMSV  171 (208)
Q Consensus        94 ~~g~~i~~~--~g~~w~~~Rk~l~~~f~~~~l~~~~~~~~~~~v~~~~~~~l~~~~~~~~~vd~~~~~~~~~~~~i~~~~  171 (208)
                      +.|+|++++  +|++|+++|++++++|++++++++ .+.++++ ++.+++.|++.. +++++|+.+.+.++++|++++++
T Consensus        79 ~~g~~~~~~~~~g~~wk~~Rk~l~~~fs~~~l~~~-~~~i~~~-~~~li~~l~~~~-~~~~idl~~~~~~~~~~~i~~~~  155 (453)
T d2ij2a1          79 FAGDGLFTSWTHEKNWKKAHNILLPSFSQQAMKGY-HAMMVDI-AVQLVQKWERLN-ADEHIEVPEDMTRLTLDTIGLCG  155 (453)
T ss_dssp             HHTTSGGGSCTTSHHHHHHHHHHGGGGSTTTHHHH-HHHHHHH-HHHHHHHHHTCC-TTCCEEHHHHHHHHHHHHHHHHH
T ss_pred             hcCCcEEecCCChHHHHHHHHHHHHHhhhhhhhhh-hhhHHHH-HHHHHHHhhhcC-CCCccchHHHHHHHhhhcchhcc
Confidence            788998764  699999999999999999999997 4888888 699999997643 46689999999999999999999


Q ss_pred             hcCCCCCCCC
Q 036716          172 LGIDPNYLSF  181 (208)
Q Consensus       172 fg~~~~~~~~  181 (208)
                      ||.+++....
T Consensus       156 fG~~~~~~~~  165 (453)
T d2ij2a1         156 FNYRFNSFYR  165 (453)
T ss_dssp             HSCCCCGGGC
T ss_pred             cccccchhhh
Confidence            9999876544
>d1tqna_ a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ciba1 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-sterol demethylase (cyp51) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1n97a_ a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1r9oa_ a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3czha1 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1po5a_ a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1izoa_ a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1odoa_ a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1z8oa1 a.104.1.1 (A:3-404) Cytochrome P450-ERYF {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1ueda_ a.104.1.1 (A:) p450 monoxygenase OxyC {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d1gwia_ a.104.1.1 (A:) Cyp154c1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1jfba_ a.104.1.1 (A:) Cytochrome P450-NOR, nitric reductase {Fungus (Fusarium oxysporum) [TaxId: 5507]} Back     information, alignment and structure
>d1s1fa_ a.104.1.1 (A:) Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1q5da_ a.104.1.1 (A:) Cytochrome P450epok {Sorangium cellulosum [TaxId: 56]} Back     information, alignment and structure
>d1lfka_ a.104.1.1 (A:) p450 monoxygenase OxyB {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d1cpta_ a.104.1.1 (A:) Cytochrome P450-TERP {Pseudomonas sp. [TaxId: 306]} Back     information, alignment and structure
>d1re9a_ a.104.1.1 (A:) Cytochrome P450-CAM {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1io7a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1n40a_ a.104.1.1 (A:) Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ue8a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1weya_ d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure