Citrus Sinensis ID: 036860

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------16

MADVILVDSKFTANTFADTFKKLHARGIRLVVLYLAVNVYQFDKPHSCGCDKLLRENVEYLEELKSLAERNGMSDRVNFITSCSTTERNALLFECLCVFYTPKDEHFGIVPLEAMAAYKPVSACDSGGPVETIKNEEFSLSMAKLIQEPQMAKNMGENA

cccEEEEcccccHHHHHHHHHHHHcccccEEEEEEEcccccccccccccccccccccHHHHHHHHHHHHHccccccEEEcccccHHHHHHHHHHccEEEEcccccccccHHHHHHcccccEEEcccccccEEEcccHHHHHHHHHHccHHHHHHHHHcc

cccEEEEEcHHHHHHHHHHHHHHccccccEEEEEEEEcccccccccccccccHHHHHHHHHHHHHHHHHHcccccEEEEEccccHHHHHHHHHHccEEEEccccccccccEHHHHHccccEEEEcccccccEEEccccHHHHHHHHccHHHHHHHcccc

MADVILVDSKFTANTFADTFKKLHARGIRLVVLYLAVNvyqfdkphscgcdKLLRENVEYLEELKSLAErngmsdrvnFITSCSTTERNALLFECLCvfytpkdehfgivpleamaaykpvsacdsggpvetiknEEFSLSMAKLIQEPQMAKNMGENA

madvilvdskftantFADTFKKLHARGIRLVVLYLAVNVYQFDKPHSCGCDKLLRENVEYLEELKSlaerngmsdrVNFITSCSTTERNALLFECLCVFYTPKDEHFGIVPLEAMAAYKPVSACDSGGPVETIKNEEFSLSMAkliqepqmaknmgena

MADVILVDSKFTANTFADTFKKLHARGIRLVVLYLAVNVYQFDKPHSCGCDKLLRENVEYLEELKSLAERNGMSDRVNFITSCSTTERNALLFECLCVFYTPKDEHFGIVPLEAMAAYKPVSACDSGGPVETIKNEEFSLSMAKLIQEPQMAKNMGENA

***VILVDSKFTANTFADTFKKLHARGIRLVVLYLAVNVYQFDKPHSCGCDKLLRENVEYLEELKSLAERNGMSDRVNFITSCSTTERNALLFECLCVFYTPKDEHFGIVPLEAMAAYKPVSACD**********************************

MADVILVDSKFTANTFADTFKKLHARGIRLVVLYLAVNVYQFDKPHSCGCDKLLRENVEYLEELKSLAERNGMSDRVNFITSCSTTERNALLFECLCVFYTPKDEHFGIVPLEAMAAYKPVSACDSGGPVETIKNEEFSLSMAKLIQEPQMAKNMGE**

MADVILVDSKFTANTFADTFKKLHARGIRLVVLYLAVNVYQFDKPHSCGCDKLLRENVEYLEELKSLAERNGMSDRVNFITSCSTTERNALLFECLCVFYTPKDEHFGIVPLEAMAAYKPVSACDSGGPVETIKNEEFSLSMAKLIQEPQMAKNMGENA

*ADVILVDSKFTANTFADTFKKLHARGIRLVVLYLAVNVYQFDKPHSCGCDKLLRENVEYLEELKSLAERNGMSDRVNFITSCSTTERNALLFECLCVFYTPKDEHFGIVPLEAMAAYKPVSACDSGGPVETIKNEEFSLSMAKLIQEPQMAKN*G***

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MADVILVDSKFTANTFADTFKKLHARGIRLVVLYLAVNVYQFDKPHSCGxxxxxxxxxxxxxxxxxxxxxNGMSDRVNFITSCSTTERNALLFECLCVFYTPKDEHFGIVPLEAMAAYKPVSACDSGGPVETIKNEEFSLSMAKLIQEPQMAKNMGENA

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		159	2.2.26 [Sep-21-2011]
Q9DBE8		415	Alpha-1,3/1,6-mannosyltra	yes	no	0.981	0.375	0.324	3e-23
Q9H553		416	Alpha-1,3/1,6-mannosyltra	yes	no	0.968	0.370	0.316	1e-21
Q7KWM5		420	Alpha-1,3/1,6-mannosyltra	yes	no	0.698	0.264	0.409	7e-21
O94738		455	Alpha-1,3/1,6-mannosyltra	N/A	no	0.698	0.243	0.381	4e-16
P43636		503	Alpha-1,3/1,6-mannosyltra	yes	no	0.842	0.266	0.308	2e-15
Q59LF2		428	Alpha-1,3/1,6-mannosyltra	N/A	no	0.842	0.313	0.306	1e-13
Q6CWQ0		503	Alpha-1,3/1,6-mannosyltra	yes	no	0.830	0.262	0.305	9e-13
Q6FJJ9		458	Alpha-1,3/1,6-mannosyltra	yes	no	0.534	0.185	0.385	5e-12
Q6C3V7		460	Alpha-1,3/1,6-mannosyltra	yes	no	0.547	0.189	0.368	2e-11
Q96WW6		506	Alpha-1,3/1,6-mannosyltra	yes	no	0.830	0.260	0.287	3e-11

>sp\|Q9DBE8\|ALG2_MOUSE Alpha-1,3/1,6-mannosyltransferase ALG2 OS=Mus musculus GN=Alg2 PE=2 SV=2	Back alignment and function desciption

 Score =  107 bits (267), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 71/219 (32%), Positives = 105/219 (47%), Gaps = 63/219 (28%)

Query: 1   MADVILVDSKFTANTFADTFKKLHARGIRLV--------------------------VLY 34
           MAD ILV+S++TA+ F +TFK L  R   ++                           L+
Sbjct: 169 MADRILVNSQYTASVFKETFKTLSHRNPDVLYPSLNIGSFDLAIPEKIDDLVPKGKQFLF 228

Query: 35  LAVNVYQ-----------------------FDKPH---SCGCDKLLRENVEYLEELKSLA 68
           L++N Y+                       +DK H   + G D  + ENVE+ +ELK + 
Sbjct: 229 LSINRYERKKNLPLALRSLVQLRNRLPSQEWDKVHLFMAGGYDDRIPENVEHYKELKKMV 288

Query: 69  ERNGMSDRVNFITSCSTTERNALLFECLCVFYTPKDEHFGIVPLEAMAAYKPVSACDSGG 128
           + + +   V F+ S S  ++ +LL  CLCV YTP +EHFGIVPLEAM    PV A ++GG
Sbjct: 289 QESDLERHVTFLRSFSDRQKISLLHGCLCVLYTPSNEHFGIVPLEAMYMQCPVIAVNNGG 348

Query: 129 PVETIKNE-----------EFSLSMAKLIQEPQMAKNMG 156
           P+E+I ++            FS +M K I +P +   MG
Sbjct: 349 PLESIVHKVTGFLCEPDPVHFSEAMEKFIHKPSLKATMG 387

Mannosylates Man(2)GlcNAc(2)-dolichol diphosphate and Man(1)GlcNAc(2)-dolichol diphosphate to form Man(3)GlcNAc(2)-dolichol diphosphate.
Mus musculus (taxid: 10090)
EC: 2EC: .EC: 4EC: .EC: 1EC: .EC: 2EC: 5EC: 7

>sp\|Q9H553\|ALG2_HUMAN Alpha-1,3/1,6-mannosyltransferase ALG2 OS=Homo sapiens GN=ALG2 PE=1 SV=1	Back alignment and function description

>sp\|Q7KWM5\|ALG2_DICDI Alpha-1,3/1,6-mannosyltransferase ALG2 OS=Dictyostelium discoideum GN=alg2 PE=3 SV=1	Back alignment and function description

>sp\|O94738\|ALG2_RHIPU Alpha-1,3/1,6-mannosyltransferase ALG2 OS=Rhizomucor pusillus GN=ALG2 PE=1 SV=1	Back alignment and function description

>sp\|P43636\|ALG2_YEAST Alpha-1,3/1,6-mannosyltransferase ALG2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ALG2 PE=1 SV=2	Back alignment and function description

>sp\|Q59LF2\|ALG2_CANAL Alpha-1,3/1,6-mannosyltransferase ALG2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ALG2 PE=3 SV=1	Back alignment and function description

>sp\|Q6CWQ0\|ALG2_KLULA Alpha-1,3/1,6-mannosyltransferase ALG2 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ALG2 PE=3 SV=1	Back alignment and function description

>sp\|Q6FJJ9\|ALG2_CANGA Alpha-1,3/1,6-mannosyltransferase ALG2 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=ALG2 PE=3 SV=1	Back alignment and function description

>sp\|Q6C3V7\|ALG2_YARLI Alpha-1,3/1,6-mannosyltransferase ALG2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=ALG2 PE=3 SV=1	Back alignment and function description

>sp\|Q96WW6\|ALG2_SCHPO Alpha-1,3/1,6-mannosyltransferase alg2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=alg2 PE=3 SV=2	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		159
255569305		408	alpha-1,3-mannosyltransferase, putative	1.0	0.389	0.577	8e-59
302142886		396	unnamed protein product [Vitis vinifera]	1.0	0.401	0.577	1e-55
449438921		407	PREDICTED: alpha-1,3/1,6-mannosyltransfe	1.0	0.390	0.555	7e-55
449524204		260	PREDICTED: alpha-1,3/1,6-mannosyltransfe	1.0	0.611	0.555	7e-55
225461697		408	PREDICTED: alpha-1,3/1,6-mannosyltransfe	1.0	0.389	0.545	3e-54
359807347		407	uncharacterized protein LOC100809168 [Gl	1.0	0.390	0.539	2e-52
3834314		405	Similar to gene pi010 glycosyltransferas	1.0	0.392	0.523	4e-52
356549651		407	PREDICTED: alpha-1,3/1,6-mannosyltransfe	1.0	0.390	0.539	1e-51
22330726		403	alpha-1,3/alpha-1,6-mannosyltransferase	1.0	0.394	0.523	3e-51
20856587		403	At1g78800/F9K20_16 [Arabidopsis thaliana	1.0	0.394	0.518	1e-50

>gi\|255569305\|ref\|XP_002525620.1\| alpha-1,3-mannosyltransferase, putative [Ricinus communis] gi\|223535056\|gb\|EEF36738.1\| alpha-1,3-mannosyltransferase, putative [Ricinus communis]	Back alignment and taxonomy information

 Score =  231 bits (589), Expect = 8e-59,   Method: Compositional matrix adjust.
 Identities = 126/218 (57%), Positives = 140/218 (64%), Gaps = 59/218 (27%)

Query: 1   MADVILVDSKFTANTFADTFKKLHARGIRLVVLYLAVNVYQFDKPHSC------------ 48
           MAD+ILV+SKFTA+TFA TFK+LH+RGIR  VLY AVNV QFDKPHS             
Sbjct: 161 MADMILVNSKFTASTFAKTFKRLHSRGIRPAVLYPAVNVDQFDKPHSSKLSFLSINRFER 220

Query: 49  ------------------------------------GCDKLLRENVEYLEELKSLAERNG 72
                                               G DK LRENVEYLEELK LAER G
Sbjct: 221 KKSIELAVSAFAMLHALDGHTFQNNNVADATLTIAGGYDKRLRENVEYLEELKMLAEREG 280

Query: 73  MSDRVNFITSCSTTERNALLFECLCVFYTPKDEHFGIVPLEAMAAYKPVSACDSGGPVET 132
           +S RVNFITSCSTTERNALL +CLCV YTPKDEHFGIVPLEAMAAYKPV AC+SGGPVET
Sbjct: 281 VSHRVNFITSCSTTERNALLSQCLCVIYTPKDEHFGIVPLEAMAAYKPVIACNSGGPVET 340

Query: 133 IKN-----------EEFSLSMAKLIQEPQMAKNMGENA 159
           + +           + FSL+MAK IQ+P+MAK MGE A
Sbjct: 341 VIDGVTGFLCDSTPQSFSLAMAKFIQDPEMAKRMGEEA 378

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|302142886\|emb\|CBI20181.3\| unnamed protein product [Vitis vinifera]	Back alignment and taxonomy information

>gi\|449438921\|ref\|XP_004137236.1\| PREDICTED: alpha-1,3/1,6-mannosyltransferase ALG2-like [Cucumis sativus]	Back alignment and taxonomy information

>gi\|449524204\|ref\|XP_004169113.1\| PREDICTED: alpha-1,3/1,6-mannosyltransferase ALG2-like, partial [Cucumis sativus]	Back alignment and taxonomy information

>gi\|225461697\|ref\|XP_002285480.1\| PREDICTED: alpha-1,3/1,6-mannosyltransferase ALG2-like isoform 1 [Vitis vinifera] gi\|359493768\|ref\|XP_003634662.1\| PREDICTED: alpha-1,3/1,6-mannosyltransferase ALG2-like isoform 2 [Vitis vinifera]	Back alignment and taxonomy information

>gi\|359807347\|ref\|NP_001241379.1\| uncharacterized protein LOC100809168 [Glycine max] gi\|255642391\|gb\|ACU21459.1\| unknown [Glycine max]	Back alignment and taxonomy information

>gi\|3834314\|gb\|AAC83030.1\| Similar to gene pi010 glycosyltransferase gi\|2257490 from S. pombe clone 1750 gb\|AB004534. ESTs gb\|T46079 and gb\|AA394466 come from this gene [Arabidopsis thaliana]	Back alignment and taxonomy information

>gi\|356549651\|ref\|XP_003543205.1\| PREDICTED: alpha-1,3/1,6-mannosyltransferase ALG2-like [Glycine max]	Back alignment and taxonomy information

>gi\|22330726\|ref\|NP_178001.2\| alpha-1,3/alpha-1,6-mannosyltransferase [Arabidopsis thaliana] gi\|332198034\|gb\|AEE36155.1\| alpha-1,3/alpha-1,6-mannosyltransferase [Arabidopsis thaliana]	Back alignment and taxonomy information

>gi\|20856587\|gb\|AAM26674.1\| At1g78800/F9K20_16 [Arabidopsis thaliana] gi\|23308431\|gb\|AAN18185.1\| At1g78800/F9K20_16 [Arabidopsis thaliana]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		159
TAIR\|locus:2037608		403	AT1G78800 [Arabidopsis thalian	0.698	0.275	0.663	6.1e-52
UNIPROTKB\|F1NWX1		398	ALG2 "Uncharacterized protein"	0.679	0.271	0.436	5.5e-28
UNIPROTKB\|A4FUG6		416	ALG2 "ALG2 protein" [Bos tauru	0.798	0.305	0.390	9e-27
UNIPROTKB\|Q9H553		416	ALG2 "Alpha-1,3/1,6-mannosyltr	0.679	0.259	0.411	1.3e-25
DICTYBASE\|DDB_G0272730		420	alg2 "alpha-1,3-mannosyltransf	0.691	0.261	0.413	4.5e-24
FB\|FBgn0035401		424	CG1291 [Drosophila melanogaste	0.685	0.257	0.4	1.3e-21
UNIPROTKB\|F1SSE6		416	ALG2 "Uncharacterized protein"	0.798	0.305	0.390	4.5e-19
RGD\|1309940		209	Alg2 "ALG2, alpha-1,3/1,6-mann	0.798	0.607	0.390	8.3e-19
ZFIN\|ZDB-GENE-060502-2		455	alg2 "asparagine-linked glycos	0.761	0.265	0.377	1.7e-18
MGI\|MGI:1914731		415	Alg2 "asparagine-linked glycos	0.729	0.279	0.4	2.7e-18

TAIR\|locus:2037608 AT1G78800 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 406 (148.0 bits), Expect = 6.1e-52, Sum P(2) = 6.1e-52
 Identities = 81/122 (66%), Positives = 94/122 (77%)

Query:    49 GCDKLLRENVEYLEELKSLAERNGMSDRVNFITSCSTTERNALLFECLCVFYTPKDEHFG 108
             G D+ L+ENVEYLEEL+SLAE+ G+SDRVNFITSCST ERN LL  CLCV YTP DEHFG
Sbjct:   251 GYDERLKENVEYLEELRSLAEKEGVSDRVNFITSCSTAERNELLSSCLCVLYTPTDEHFG 310

Query:   109 IVPLEAMAAYKPVSACDSGGPVETIKN-----------EEFSLSMAKLIQEPQMAKNMGE 157
             IVPLEAMAAYKPV AC+SGGPVET+KN           E+FS +MA+ I+ P++A  MG 
Sbjct:   311 IVPLEAMAAYKPVIACNSGGPVETVKNGVTGYLCEPTPEDFSSAMARFIENPELANRMGA 370

Query:   158 NA 159
              A
Sbjct:   371 EA 372

GO:0009058 "biosynthetic process" evidence=IEA

GO:0016757 "transferase activity, transferring glycosyl groups" evidence=ISS

UNIPROTKB\|F1NWX1 ALG2 "Uncharacterized protein" [Gallus gallus (taxid:9031)]	Back alignment and assigned GO terms

UNIPROTKB\|A4FUG6 ALG2 "ALG2 protein" [Bos taurus (taxid:9913)]	Back alignment and assigned GO terms

UNIPROTKB\|Q9H553 ALG2 "Alpha-1,3/1,6-mannosyltransferase ALG2" [Homo sapiens (taxid:9606)]	Back alignment and assigned GO terms

DICTYBASE\|DDB_G0272730 alg2 "alpha-1,3-mannosyltransferase" [Dictyostelium discoideum (taxid:44689)]	Back alignment and assigned GO terms

FB\|FBgn0035401 CG1291 [Drosophila melanogaster (taxid:7227)]	Back alignment and assigned GO terms

UNIPROTKB\|F1SSE6 ALG2 "Uncharacterized protein" [Sus scrofa (taxid:9823)]	Back alignment and assigned GO terms

RGD\|1309940 Alg2 "ALG2, alpha-1,3/1,6-mannosyltransferase" [Rattus norvegicus (taxid:10116)]	Back alignment and assigned GO terms

ZFIN\|ZDB-GENE-060502-2 alg2 "asparagine-linked glycosylation 2 homolog (S. cerevisiae, alpha-1,3-mannosyltransferase)" [Danio rerio (taxid:7955)]	Back alignment and assigned GO terms

MGI\|MGI:1914731 Alg2 "asparagine-linked glycosylation 2 (alpha-1,3-mannosyltransferase)" [Mus musculus (taxid:10090)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Your Input:
	GSVIVG00027830001	SubName- Full=Chromosome chr19 scaffold_4, whole genome shotgun sequence; (396 aa)
		(Vitis vinifera)
Predicted Functional Partners:
	GSVIVG00014968001	SubName- Full=Chromosome chr18 scaffold_1, whole genome shotgun sequence; (437 aa)	•	•	•		0.973
	GSVIVG00029320001	SubName- Full=Chromosome chr13 scaffold_48, whole genome shotgun sequence; (463 aa)	•	•	•	•	0.961
	GSVIVG00026780001	SubName- Full=Chromosome chr15 scaffold_40, whole genome shotgun sequence; (249 aa)			•		0.435

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		159
cd03805		392	cd03805, GT1_ALG2_like, This family is most closel	2e-53
pfam00534		158	pfam00534, Glycos_transf_1, Glycosyl transferases	2e-15
cd03795		357	cd03795, GT1_like_4, This family is most closely r	2e-14
COG0438		381	COG0438, RfaG, Glycosyltransferase [Cell envelope	9e-14
cd03801		374	cd03801, GT1_YqgM_like, This family is most closel	8e-12
cd03800		398	cd03800, GT1_Sucrose_synthase, This family is most	4e-11
cd03806		419	cd03806, GT1_ALG11_like, This family is most close	3e-10
cd03804		351	cd03804, GT1_wbaZ_like, This family is most closel	1e-09
cd03821		375	cd03821, GT1_Bme6_like, This family is most closel	6e-09
cd01635		229	cd01635, Glycosyltransferase_GTB_type, Glycosyltra	1e-08
cd03798		377	cd03798, GT1_wlbH_like, This family is most closel	2e-08
cd03819		355	cd03819, GT1_WavL_like, This family is most closel	2e-06
cd03808		359	cd03808, GT1_cap1E_like, This family is most close	2e-06
cd03814		364	cd03814, GT1_like_2, This family is most closely r	2e-06
TIGR02149		388	TIGR02149, glgA_Coryne, glycogen synthase, Coryneb	6e-06
cd03809		365	cd03809, GT1_mtfB_like, This family is most closel	1e-05
cd03817		374	cd03817, GT1_UGDG_like, This family is most closel	1e-05
cd03820		348	cd03820, GT1_amsD_like, This family is most closel	2e-05
cd04951		360	cd04951, GT1_WbdM_like, This family is most closel	2e-05
cd03811		353	cd03811, GT1_WabH_like, This family is most closel	3e-05
TIGR03449		405	TIGR03449, mycothiol_MshA, D-inositol-3-phosphate	7e-05
PLN02949		463	PLN02949, PLN02949, transferase, transferring glyc	1e-04
cd04962		371	cd04962, GT1_like_5, This family is most closely r	1e-04
cd03794		394	cd03794, GT1_wbuB_like, This family is most closel	2e-04
cd03823		359	cd03823, GT1_ExpE7_like, This family is most close	4e-04
TIGR03999		374	TIGR03999, thiol_BshA, N-acetyl-alpha-D-glucosamin	5e-04
cd03792		372	cd03792, GT1_Trehalose_phosphorylase, Trehalose ph	0.002
cd03807		365	cd03807, GT1_WbnK_like, This family is most closel	0.002
TIGR02470		784	TIGR02470, sucr_synth, sucrose synthase	0.003
cd03802		335	cd03802, GT1_AviGT4_like, This family is most clos	0.004

>gnl\|CDD\|99977 cd03805, GT1_ALG2_like, This family is most closely related to the GT1 family of glycosyltransferases	Back alignment and domain information

 Score =  173 bits (440), Expect = 2e-53
 Identities = 74/224 (33%), Positives = 98/224 (43%), Gaps = 67/224 (29%)

Query: 1   MADVILVDSKFTANTFADTFKKLHARGIRLVVLYLAVNVYQFDKPHSC------------ 48
           MAD I+V+S FTA+ F  TF  L        V+Y  V+   F+                 
Sbjct: 154 MADKIVVNSNFTASVFKKTFPSLAKNPRE--VVYPCVDTDSFESTSEDPDPGLLIPKSGK 211

Query: 49  -----------------------------------------GCDKLLRENVEYLEELKSL 67
                                                    G D  + ENVEYLEEL+ L
Sbjct: 212 KTFLSINRFERKKNIALAIEAFAILKDKLAEFKNVRLVIAGGYDPRVAENVEYLEELQRL 271

Query: 68  AER-NGMSDRVNFITSCSTTERNALLFECLCVFYTPKDEHFGIVPLEAMAAYKPVSACDS 126
           AE    + D+V F+ S S +++  LL     + YTP +EHFGIVPLEAM A KPV AC+S
Sbjct: 272 AEELLLLEDQVIFLPSISDSQKELLLSSARALLYTPSNEHFGIVPLEAMYAGKPVIACNS 331

Query: 127 GGPVETIKN-----------EEFSLSMAKLIQEPQMAKNMGENA 159
           GGP+ET+ +           EEF+ +M KL  +P +A  MG   
Sbjct: 332 GGPLETVVDGETGFLCEPTPEEFAEAMLKLANDPDLADRMGAAG 375

ALG2, a 1,3-mannosyltransferase, in yeast catalyzes the mannosylation of Man(2)GlcNAc(2)-dolichol diphosphate and Man(1)GlcNAc(2)-dolichol diphosphate to form Man(3)GlcNAc(2)-dolichol diphosphate. A deficiency of this enzyme causes an abnormal accumulation of Man1GlcNAc2-PP-dolichol and Man2GlcNAc2-PP-dolichol, which is associated with a type of congenital disorders of glycosylation (CDG), designated CDG-Ii, in humans. Length = 392

>gnl\|CDD\|215979 pfam00534, Glycos_transf_1, Glycosyl transferases group 1	Back alignment and domain information

>gnl\|CDD\|99969 cd03795, GT1_like_4, This family is most closely related to the GT1 family of glycosyltransferases	Back alignment and domain information

>gnl\|CDD\|223515 COG0438, RfaG, Glycosyltransferase [Cell envelope biogenesis, outer membrane]	Back alignment and domain information

>gnl\|CDD\|99974 cd03801, GT1_YqgM_like, This family is most closely related to the GT1 family of glycosyltransferases and named after YqgM in Bacillus licheniformis about which little is known	Back alignment and domain information

>gnl\|CDD\|99973 cd03800, GT1_Sucrose_synthase, This family is most closely related to the GT1 family of glycosyltransferases	Back alignment and domain information

>gnl\|CDD\|99978 cd03806, GT1_ALG11_like, This family is most closely related to the GT1 family of glycosyltransferases	Back alignment and domain information

>gnl\|CDD\|99976 cd03804, GT1_wbaZ_like, This family is most closely related to the GT1 family of glycosyltransferases	Back alignment and domain information

>gnl\|CDD\|99991 cd03821, GT1_Bme6_like, This family is most closely related to the GT1 family of glycosyltransferases	Back alignment and domain information

>gnl\|CDD\|99959 cd01635, Glycosyltransferase_GTB_type, Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds	Back alignment and domain information

>gnl\|CDD\|99971 cd03798, GT1_wlbH_like, This family is most closely related to the GT1 family of glycosyltransferases	Back alignment and domain information

>gnl\|CDD\|99989 cd03819, GT1_WavL_like, This family is most closely related to the GT1 family of glycosyltransferases	Back alignment and domain information

>gnl\|CDD\|99980 cd03808, GT1_cap1E_like, This family is most closely related to the GT1 family of glycosyltransferases	Back alignment and domain information

>gnl\|CDD\|99985 cd03814, GT1_like_2, This family is most closely related to the GT1 family of glycosyltransferases	Back alignment and domain information

>gnl\|CDD\|233748 TIGR02149, glgA_Coryne, glycogen synthase, Corynebacterium family	Back alignment and domain information

>gnl\|CDD\|99981 cd03809, GT1_mtfB_like, This family is most closely related to the GT1 family of glycosyltransferases	Back alignment and domain information

>gnl\|CDD\|99987 cd03817, GT1_UGDG_like, This family is most closely related to the GT1 family of glycosyltransferases	Back alignment and domain information

>gnl\|CDD\|99990 cd03820, GT1_amsD_like, This family is most closely related to the GT1 family of glycosyltransferases	Back alignment and domain information

>gnl\|CDD\|100000 cd04951, GT1_WbdM_like, This family is most closely related to the GT1 family of glycosyltransferases and is named after WbdM in Escherichia coli	Back alignment and domain information

>gnl\|CDD\|99982 cd03811, GT1_WabH_like, This family is most closely related to the GT1 family of glycosyltransferases	Back alignment and domain information

>gnl\|CDD\|132490 TIGR03449, mycothiol_MshA, D-inositol-3-phosphate glycosyltransferase	Back alignment and domain information

>gnl\|CDD\|215511 PLN02949, PLN02949, transferase, transferring glycosyl groups	Back alignment and domain information

>gnl\|CDD\|100002 cd04962, GT1_like_5, This family is most closely related to the GT1 family of glycosyltransferases	Back alignment and domain information

>gnl\|CDD\|99968 cd03794, GT1_wbuB_like, This family is most closely related to the GT1 family of glycosyltransferases	Back alignment and domain information

>gnl\|CDD\|99993 cd03823, GT1_ExpE7_like, This family is most closely related to the GT1 family of glycosyltransferases	Back alignment and domain information

>gnl\|CDD\|234438 TIGR03999, thiol_BshA, N-acetyl-alpha-D-glucosaminyl L-malate synthase BshA	Back alignment and domain information

>gnl\|CDD\|99966 cd03792, GT1_Trehalose_phosphorylase, Trehalose phosphorylase (TP) reversibly catalyzes trehalose synthesis and degradation from alpha-glucose-1-phosphate (alpha-Glc-1-P) and glucose	Back alignment and domain information

>gnl\|CDD\|99979 cd03807, GT1_WbnK_like, This family is most closely related to the GT1 family of glycosyltransferases	Back alignment and domain information

>gnl\|CDD\|233881 TIGR02470, sucr_synth, sucrose synthase	Back alignment and domain information

>gnl\|CDD\|99975 cd03802, GT1_AviGT4_like, This family is most closely related to the GT1 family of glycosyltransferases	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		159
PRK15427		406	colanic acid biosynthesis glycosyltransferase WcaL	99.97
cd04946		407	GT1_AmsK_like This family is most closely related	99.95
cd05844		367	GT1_like_7 Glycosyltransferases catalyze the trans	99.95
TIGR03449		405	mycothiol_MshA UDP-N-acetylglucosamine: 1L-myo-ino	99.95
PLN02949		463	transferase, transferring glycosyl groups	99.95
cd03796		398	GT1_PIG-A_like This family is most closely related	99.95
TIGR03088		374	stp2 sugar transferase, PEP-CTERM/EpsH1 system ass	99.94
PLN02871		465	UDP-sulfoquinovose:DAG sulfoquinovosyltransferase	99.94
cd03818		396	GT1_ExpC_like This family is most closely related	99.94
cd03805		392	GT1_ALG2_like This family is most closely related	99.94
cd03806		419	GT1_ALG11_like This family is most closely related	99.94
PRK09922		359	UDP-D-galactose:(glucosyl)lipopolysaccharide-1,6-D	99.94
TIGR02468		1050	sucrsPsyn_pln sucrose phosphate synthase/possible	99.94
cd03799		355	GT1_amsK_like This is a family of GT1 glycosyltran	99.93
TIGR02472		439	sucr_P_syn_N sucrose-phosphate synthase, putative,	99.93
cd03812		358	GT1_CapH_like This family is most closely related	99.93
PRK15484		380	lipopolysaccharide 1,2-N-acetylglucosaminetransfer	99.93
PRK15490		578	Vi polysaccharide biosynthesis protein TviE; Provi	99.93
cd03804		351	GT1_wbaZ_like This family is most closely related	99.93
cd03813		475	GT1_like_3 This family is most closely related to	99.93
cd04962		371	GT1_like_5 This family is most closely related to	99.93
TIGR02918		500	accessory Sec system glycosylation protein GtfA. M	99.93
PRK10307		412	putative glycosyl transferase; Provisional	99.93
cd03795		357	GT1_like_4 This family is most closely related to	99.92
PLN02939		977	transferase, transferring glycosyl groups	99.92
PRK15179		694	Vi polysaccharide biosynthesis protein TviE; Provi	99.92
cd03800		398	GT1_Sucrose_synthase This family is most closely r	99.92
cd04955		363	GT1_like_6 This family is most closely related to	99.92
PRK14098		489	glycogen synthase; Provisional	99.92
cd03819		355	GT1_WavL_like This family is most closely related	99.91
cd03816		415	GT1_ALG1_like This family is most closely related	99.91
TIGR02149		388	glgA_Coryne glycogen synthase, Corynebacterium fam	99.91
cd04949		372	GT1_gtfA_like This family is most closely related	99.91
cd03817		374	GT1_UGDG_like This family is most closely related	99.91
TIGR02095		473	glgA glycogen/starch synthases, ADP-glucose type.	99.91
cd03809		365	GT1_mtfB_like This family is most closely related	99.91
cd03801		374	GT1_YqgM_like This family is most closely related	99.91
PRK14099		485	glycogen synthase; Provisional	99.91
PRK00654		466	glgA glycogen synthase; Provisional	99.9
TIGR02470		784	sucr_synth sucrose synthase. This model represents	99.9
TIGR03087		397	stp1 sugar transferase, PEP-CTERM/EpsH1 system ass	99.9
cd03821		375	GT1_Bme6_like This family is most closely related	99.9
PHA01630		331	putative group 1 glycosyl transferase	99.9
cd03823		359	GT1_ExpE7_like This family is most closely related	99.89
cd03820		348	GT1_amsD_like This family is most closely related	99.89
cd04951		360	GT1_WbdM_like This family is most closely related	99.89
cd03811		353	GT1_WabH_like This family is most closely related	99.89
cd03825		365	GT1_wcfI_like This family is most closely related	99.89
cd03802		335	GT1_AviGT4_like This family is most closely relate	99.88
cd03814		364	GT1_like_2 This family is most closely related to	99.88
cd03798		377	GT1_wlbH_like This family is most closely related	99.88
cd03791		476	GT1_Glycogen_synthase_DULL1_like This family is mo	99.88
PLN02316		1036	synthase/transferase	99.87
cd03807		365	GT1_WbnK_like This family is most closely related	99.87
cd03808		359	GT1_cap1E_like This family is most closely related	99.87
cd03822		366	GT1_ecORF704_like This family is most closely rela	99.87
PLN00142		815	sucrose synthase	99.87
KOG1111		426	consensus N-acetylglucosaminyltransferase complex,	99.87
cd03794		394	GT1_wbuB_like This family is most closely related	99.87
PHA01633		335	putative glycosyl transferase group 1	99.87
cd03792		372	GT1_Trehalose_phosphorylase Trehalose phosphorylas	99.87
PLN02501		794	digalactosyldiacylglycerol synthase	99.86
PLN02275		371	transferase, transferring glycosyl groups	99.85
PF00534		172	Glycos_transf_1: Glycosyl transferases group 1; In	99.85
PRK10125		405	putative glycosyl transferase; Provisional	99.84
PLN02846		462	digalactosyldiacylglycerol synthase	99.83
KOG0853		495	consensus Glycosyltransferase [Cell wall/membrane/	99.81
TIGR02400		456	trehalose_OtsA alpha,alpha-trehalose-phosphate syn	99.79
cd04950		373	GT1_like_1 Glycosyltransferases catalyze the trans	99.78
cd03788		460	GT1_TPS Trehalose-6-Phosphate Synthase (TPS) is a	99.76
KOG1387		465	consensus Glycosyltransferase [Cell wall/membrane/	99.75
cd03793		590	GT1_Glycogen_synthase_GSY2_like Glycogen synthase,	99.75
PRK05749		425	3-deoxy-D-manno-octulosonic-acid transferase; Revi	99.71
PLN02605		382	monogalactosyldiacylglycerol synthase	99.67
PLN03063		797	alpha,alpha-trehalose-phosphate synthase (UDP-form	99.65
cd03785		350	GT1_MurG MurG is an N-acetylglucosaminyltransferas	99.63
PRK13609		380	diacylglycerol glucosyltransferase; Provisional	99.61
PRK09814		333	beta-1,6-galactofuranosyltransferase; Provisional	99.59
TIGR01133		348	murG undecaprenyldiphospho-muramoylpentapeptide be	99.56
PRK14501		726	putative bifunctional trehalose-6-phosphate syntha	99.55
PRK13608		391	diacylglycerol glucosyltransferase; Provisional	99.55
PRK00726		357	murG undecaprenyldiphospho-muramoylpentapeptide be	99.51
COG0297		487	GlgA Glycogen synthase [Carbohydrate transport and	99.5
TIGR00236		365	wecB UDP-N-acetylglucosamine 2-epimerase. Epimeras	99.48
cd01635		229	Glycosyltransferase_GTB_type Glycosyltransferases	99.48
TIGR02398		487	gluc_glyc_Psyn glucosylglycerol-phosphate synthase	99.44
cd03786		363	GT1_UDP-GlcNAc_2-Epimerase Bacterial members of th	99.44
COG0438		381	RfaG Glycosyltransferase [Cell envelope biogenesis	99.44
PF13692		135	Glyco_trans_1_4: Glycosyl transferases group 1; PD	99.38
TIGR03713		519	acc_sec_asp1 accessory Sec system protein Asp1. Th	99.36
PF05693		633	Glycogen_syn: Glycogen synthase; InterPro: IPR0086	99.36
PRK00025		380	lpxB lipid-A-disaccharide synthase; Reviewed	99.3
PF13524		92	Glyco_trans_1_2: Glycosyl transferases group 1	99.24
TIGR02919		438	accessory Sec system glycosyltransferase GtfB. Mem	99.22
PLN03064		934	alpha,alpha-trehalose-phosphate synthase (UDP-form	99.08
KOG2941		444	consensus Beta-1,4-mannosyltransferase [Posttransl	99.06
TIGR00215		385	lpxB lipid-A-disaccharide synthase. Lipid-A precur	98.68
TIGR02094		601	more_P_ylases alpha-glucan phosphorylases. This fa	98.57
PF13844		468	Glyco_transf_41: Glycosyl transferase family 41; P	98.35
PF00982		474	Glyco_transf_20: Glycosyltransferase family 20; In	98.19
COG0380		486	OtsA Trehalose-6-phosphate synthase [Carbohydrate	98.18
PRK10117		474	trehalose-6-phosphate synthase; Provisional	98.06
COG1519		419	KdtA 3-deoxy-D-manno-octulosonic-acid transferase	98.01
COG0707		357	MurG UDP-N-acetylglucosamine:LPS N-acetylglucosami	98.0
COG3914		620	Spy Predicted O-linked N-acetylglucosamine transfe	97.99
TIGR01426		392	MGT glycosyltransferase, MGT family. This model de	97.92
TIGR03492		396	conserved hypothetical protein. This protein famil	97.9
KOG3742		692	consensus Glycogen synthase [Carbohydrate transpor	97.89
cd04299		778	GT1_Glycogen_Phosphorylase_like This family is mos	97.88
PLN02205		854	alpha,alpha-trehalose-phosphate synthase [UDP-form	97.87
PF04101		167	Glyco_tran_28_C: Glycosyltransferase family 28 C-t	97.87
COG4641		373	Uncharacterized protein conserved in bacteria [Fun	97.62
TIGR03568		365	NeuC_NnaA UDP-N-acetyl-D-glucosamine 2-epimerase,	97.44
cd03784		401	GT1_Gtf_like This family includes the Gtfs, a grou	97.44
TIGR03590		279	PseG pseudaminic acid biosynthesis-associated prot	97.43
TIGR00661		321	MJ1255 conserved hypothetical protein. This model	97.37
PHA03392		507	egt ecdysteroid UDP-glucosyltransferase; Provision	97.23
PRK12446		352	undecaprenyldiphospho-muramoylpentapeptide beta-N-	97.13
PF07429		360	Glyco_transf_56: 4-alpha-L-fucosyltransferase glyc	97.11
COG1819		406	Glycosyl transferases, related to UDP-glucuronosyl	97.07
COG0763		381	LpxB Lipid A disaccharide synthetase [Cell envelop	97.0
PF02684		373	LpxB: Lipid-A-disaccharide synthetase; InterPro: I	96.81
PF00201		500	UDPGT: UDP-glucoronosyl and UDP-glucosyl transfera	96.59
PF13528		318	Glyco_trans_1_3: Glycosyl transferase family 1	96.57
PF02350		346	Epimerase_2: UDP-N-acetylglucosamine 2-epimerase;	96.54
PLN02562		448	UDP-glycosyltransferase	96.51
PRK02797		322	4-alpha-L-fucosyltransferase; Provisional	96.48
PLN03004		451	UDP-glycosyltransferase	96.47
COG0381		383	WecB UDP-N-acetylglucosamine 2-epimerase [Cell env	96.46
PLN02208		442	glycosyltransferase family protein	96.43
PLN02410		451	UDP-glucoronosyl/UDP-glucosyl transferase family p	96.34
PLN02173		449	UDP-glucosyl transferase family protein	96.34
PLN02448		459	UDP-glycosyltransferase family protein	96.28
PF10087		97	DUF2325: Uncharacterized protein conserved in bact	96.26
PF04464		369	Glyphos_transf: CDP-Glycerol:Poly(glycerophosphate	95.94
PF03016		302	Exostosin: Exostosin family; InterPro: IPR004263 H	95.76
PF15024		559	Glyco_transf_18: Glycosyltransferase family 18	95.74
PLN00414		446	glycosyltransferase family protein	95.7
PLN00164		480	glucosyltransferase; Provisional	95.54
PLN03007		482	UDP-glucosyltransferase family protein	95.44
COG3980		318	spsG Spore coat polysaccharide biosynthesis protei	95.36
PLN02207		468	UDP-glycosyltransferase	95.18
PLN02152		455	indole-3-acetate beta-glucosyltransferase	95.13
PLN02670		472	transferase, transferring glycosyl groups	95.08
PLN02764		453	glycosyltransferase family protein	94.95
PLN02992		481	coniferyl-alcohol glucosyltransferase	94.87
PF11071		141	DUF2872: Protein of unknown function (DUF2872); In	94.68
cd03789		279	GT1_LPS_heptosyltransferase Lipopolysaccharide hep	94.59
PRK10017		426	colanic acid biosynthesis protein; Provisional	94.51
PLN02210		456	UDP-glucosyl transferase	94.39
PLN02554		481	UDP-glycosyltransferase family protein	94.22
PLN02863		477	UDP-glucoronosyl/UDP-glucosyl transferase family p	94.21
PLN02555		480	limonoid glucosyltransferase	94.06
TIGR02195		334	heptsyl_trn_II lipopolysaccharide heptosyltransfer	93.41
PLN03015		470	UDP-glucosyl transferase	93.39
PRK10422		352	lipopolysaccharide core biosynthesis protein; Prov	93.38
PLN02534		491	UDP-glycosyltransferase	93.35
PRK01021		608	lpxB lipid-A-disaccharide synthase; Reviewed	93.25
TIGR02201		344	heptsyl_trn_III lipopolysaccharide heptosyltransfe	93.15
KOG4626		966	consensus O-linked N-acetylglucosamine transferase	92.9
PLN02167		475	UDP-glycosyltransferase family protein	92.84
PRK10916		348	ADP-heptose:LPS heptosyltransferase II; Provisiona	92.77
KOG1021		464	consensus Acetylglucosaminyltransferase EXT1/exost	92.57
TIGR03646		144	YtoQ_fam YtoQ family protein. Members of this fami	92.09
PF04007		335	DUF354: Protein of unknown function (DUF354); Inte	91.57
PF01075		247	Glyco_transf_9: Glycosyltransferase family 9 (hept	91.53
KOG1192		496	consensus UDP-glucuronosyl and UDP-glucosyl transf	91.47
PF05159		269	Capsule_synth: Capsule polysaccharide biosynthesis	91.07
PF06258		311	Mito_fiss_Elm1: Mitochondrial fission ELM1; InterP	90.4
COG3660		329	Predicted nucleoside-diphosphate-sugar epimerase [	89.74
TIGR02193		319	heptsyl_trn_I lipopolysaccharide heptosyltransfera	88.81
PRK10964		322	ADP-heptose:LPS heptosyl transferase I; Provisiona	88.78
KOG1050		732	consensus Trehalose-6-phosphate synthase component	87.65
COG0859		334	RfaF ADP-heptose:LPS heptosyltransferase [Cell env	87.59
COG0111		324	SerA Phosphoglycerate dehydrogenase and related de	84.5
PF04230		286	PS_pyruv_trans: Polysaccharide pyruvyl transferase	83.76
PF01113		124	DapB_N: Dihydrodipicolinate reductase, N-terminus;	82.41
PF04392		294	ABC_sub_bind: ABC transporter substrate binding pr	81.45
PRK08410		311	2-hydroxyacid dehydrogenase; Provisional	80.88
PF02826		178	2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehy	80.07

>PRK15427 colanic acid biosynthesis glycosyltransferase WcaL; Provisional	Back alignment and domain information

Probab=99.97  E-value=1.6e-29  Score=188.64  Aligned_cols=154  Identities=18%  Similarity=0.169  Sum_probs=134.2

Q ss_pred             ccEEEEcCHhhHHHHHHHhhhhhccCceeEEEecCCccccccCCCC-----C----------------------------
Q 036860            2 ADVILVDSKFTANTFADTFKKLHARGIRLVVLYLAVNVYQFDKPHS-----C----------------------------   48 (159)
Q Consensus         2 ad~ii~~s~~~~~~~~~~~~~~~~~~i~~~vi~~~vd~~~~~~~~~-----~----------------------------   48 (159)
                      ||.++++|+..++.+.+. +....+   +.+++||+|.+.|.+...     .                            
T Consensus       175 ad~vv~~S~~~~~~l~~~-g~~~~k---i~vi~nGvd~~~f~~~~~~~~~~~~~il~vGrl~~~Kg~~~ll~a~~~l~~~  250 (406)
T PRK15427        175 GDLMLPISDLWAGRLQKM-GCPPEK---IAVSRMGVDMTRFSPRPVKAPATPLEIISVARLTEKKGLHVAIEACRQLKEQ  250 (406)
T ss_pred             CCEEEECCHHHHHHHHHc-CCCHHH---EEEcCCCCCHHHcCCCccccCCCCeEEEEEeCcchhcCHHHHHHHHHHHHhh
Confidence            789999999999998764 443444   779999999988754321     1                            


Q ss_pred             --cccccccccHHHHHHHHHHHHHcCCCCcEEEccCCCHHHHHHHHHhCcEEEeCCCC------CCCccHHHHhhhcCCc
Q 036860           49 --GCDKLLRENVEYLEELKSLAERNGMSDRVNFITSCSTTERNALLFECLCVFYTPKD------EHFGIVPLEAMAAYKP  120 (159)
Q Consensus        49 --~~~~~i~~~~~~~~~~~~~~~~~~~~~~v~~~g~~~~~~l~~~~~~a~~~i~~s~~------e~~g~~~lEama~G~P  120 (159)
                        .+...+.|+|++.+.++++++++++.++|.|+|+++++++.++|+.||++++||..      ||+|++++|||+||+|
T Consensus       251 ~~~~~l~ivG~G~~~~~l~~~~~~~~l~~~V~~~G~~~~~el~~~l~~aDv~v~pS~~~~~g~~Eg~p~~llEAma~G~P  330 (406)
T PRK15427        251 GVAFRYRILGIGPWERRLRTLIEQYQLEDVVEMPGFKPSHEVKAMLDDADVFLLPSVTGADGDMEGIPVALMEAMAVGIP  330 (406)
T ss_pred             CCCEEEEEEECchhHHHHHHHHHHcCCCCeEEEeCCCCHHHHHHHHHhCCEEEECCccCCCCCccCccHHHHHHHhCCCC
Confidence              23455779999999999999999999999999999999999999999999999974      9999999999999999


Q ss_pred             EEEeCCCCCceeecc------------HHHHHHHHHHhc-CHHHHHHhhhcC
Q 036860          121 VSACDSGGPVETIKN------------EEFSLSMAKLIQ-EPQMAKNMGENA  159 (159)
Q Consensus       121 vi~~~~~~~~e~i~~------------~~l~~~i~~l~~-~~~~~~~~~~~a  159 (159)
                      ||+|+.+|..|++.+            ++++++|.++++ |++++++|+++|
T Consensus       331 VI~t~~~g~~E~v~~~~~G~lv~~~d~~~la~ai~~l~~~d~~~~~~~~~~a  382 (406)
T PRK15427        331 VVSTLHSGIPELVEADKSGWLVPENDAQALAQRLAAFSQLDTDELAPVVKRA  382 (406)
T ss_pred             EEEeCCCCchhhhcCCCceEEeCCCCHHHHHHHHHHHHhCCHHHHHHHHHHH
Confidence            999999999999976            899999999999 999999998764

>cd04946 GT1_AmsK_like This family is most closely related to the GT1 family of glycosyltransferases	Back alignment and domain information

>cd05844 GT1_like_7 Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds	Back alignment and domain information

>TIGR03449 mycothiol_MshA UDP-N-acetylglucosamine: 1L-myo-inositol-1-phosphate 1-alpha-D-N-acetylglucosaminyltransferase	Back alignment and domain information

>PLN02949 transferase, transferring glycosyl groups	Back alignment and domain information

>cd03796 GT1_PIG-A_like This family is most closely related to the GT1 family of glycosyltransferases	Back alignment and domain information

>TIGR03088 stp2 sugar transferase, PEP-CTERM/EpsH1 system associated	Back alignment and domain information

>PLN02871 UDP-sulfoquinovose:DAG sulfoquinovosyltransferase	Back alignment and domain information

>cd03818 GT1_ExpC_like This family is most closely related to the GT1 family of glycosyltransferases	Back alignment and domain information

>cd03805 GT1_ALG2_like This family is most closely related to the GT1 family of glycosyltransferases	Back alignment and domain information

>cd03806 GT1_ALG11_like This family is most closely related to the GT1 family of glycosyltransferases	Back alignment and domain information

>PRK09922 UDP-D-galactose:(glucosyl)lipopolysaccharide-1,6-D-galactosyltransferase; Provisional	Back alignment and domain information

>TIGR02468 sucrsPsyn_pln sucrose phosphate synthase/possible sucrose phosphate phosphatase, plant	Back alignment and domain information

>cd03799 GT1_amsK_like This is a family of GT1 glycosyltransferases found specifically in certain bacteria	Back alignment and domain information

>TIGR02472 sucr_P_syn_N sucrose-phosphate synthase, putative, glycosyltransferase domain	Back alignment and domain information

>cd03812 GT1_CapH_like This family is most closely related to the GT1 family of glycosyltransferases	Back alignment and domain information

>PRK15484 lipopolysaccharide 1,2-N-acetylglucosaminetransferase; Provisional	Back alignment and domain information

>PRK15490 Vi polysaccharide biosynthesis protein TviE; Provisional	Back alignment and domain information

>cd03804 GT1_wbaZ_like This family is most closely related to the GT1 family of glycosyltransferases	Back alignment and domain information

>cd03813 GT1_like_3 This family is most closely related to the GT1 family of glycosyltransferases	Back alignment and domain information

>cd04962 GT1_like_5 This family is most closely related to the GT1 family of glycosyltransferases	Back alignment and domain information

>TIGR02918 accessory Sec system glycosylation protein GtfA	Back alignment and domain information

>PRK10307 putative glycosyl transferase; Provisional	Back alignment and domain information

>cd03795 GT1_like_4 This family is most closely related to the GT1 family of glycosyltransferases	Back alignment and domain information

>PLN02939 transferase, transferring glycosyl groups	Back alignment and domain information

>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional	Back alignment and domain information

>cd03800 GT1_Sucrose_synthase This family is most closely related to the GT1 family of glycosyltransferases	Back alignment and domain information

>cd04955 GT1_like_6 This family is most closely related to the GT1 family of glycosyltransferases	Back alignment and domain information

>PRK14098 glycogen synthase; Provisional	Back alignment and domain information

>cd03819 GT1_WavL_like This family is most closely related to the GT1 family of glycosyltransferases	Back alignment and domain information

>cd03816 GT1_ALG1_like This family is most closely related to the GT1 family of glycosyltransferases	Back alignment and domain information

>TIGR02149 glgA_Coryne glycogen synthase, Corynebacterium family	Back alignment and domain information

>cd04949 GT1_gtfA_like This family is most closely related to the GT1 family of glycosyltransferases and is named after gtfA in Streptococcus gordonii, where it plays a role in the O-linked glycosylation of GspB, a cell surface glycoprotein involved in platelet binding	Back alignment and domain information

>cd03817 GT1_UGDG_like This family is most closely related to the GT1 family of glycosyltransferases	Back alignment and domain information

>TIGR02095 glgA glycogen/starch synthases, ADP-glucose type	Back alignment and domain information

>cd03809 GT1_mtfB_like This family is most closely related to the GT1 family of glycosyltransferases	Back alignment and domain information

>cd03801 GT1_YqgM_like This family is most closely related to the GT1 family of glycosyltransferases and named after YqgM in Bacillus licheniformis about which little is known	Back alignment and domain information

>PRK14099 glycogen synthase; Provisional	Back alignment and domain information

>PRK00654 glgA glycogen synthase; Provisional	Back alignment and domain information

>TIGR02470 sucr_synth sucrose synthase	Back alignment and domain information

>TIGR03087 stp1 sugar transferase, PEP-CTERM/EpsH1 system associated	Back alignment and domain information

>cd03821 GT1_Bme6_like This family is most closely related to the GT1 family of glycosyltransferases	Back alignment and domain information

>PHA01630 putative group 1 glycosyl transferase	Back alignment and domain information

>cd03823 GT1_ExpE7_like This family is most closely related to the GT1 family of glycosyltransferases	Back alignment and domain information

>cd03820 GT1_amsD_like This family is most closely related to the GT1 family of glycosyltransferases	Back alignment and domain information

>cd04951 GT1_WbdM_like This family is most closely related to the GT1 family of glycosyltransferases and is named after WbdM in Escherichia coli	Back alignment and domain information

>cd03811 GT1_WabH_like This family is most closely related to the GT1 family of glycosyltransferases	Back alignment and domain information

>cd03825 GT1_wcfI_like This family is most closely related to the GT1 family of glycosyltransferases	Back alignment and domain information

>cd03802 GT1_AviGT4_like This family is most closely related to the GT1 family of glycosyltransferases	Back alignment and domain information

>cd03814 GT1_like_2 This family is most closely related to the GT1 family of glycosyltransferases	Back alignment and domain information

>cd03798 GT1_wlbH_like This family is most closely related to the GT1 family of glycosyltransferases	Back alignment and domain information

>cd03791 GT1_Glycogen_synthase_DULL1_like This family is most closely related to the GT1 family of glycosyltransferases	Back alignment and domain information

>PLN02316 synthase/transferase	Back alignment and domain information

>cd03807 GT1_WbnK_like This family is most closely related to the GT1 family of glycosyltransferases	Back alignment and domain information

>cd03808 GT1_cap1E_like This family is most closely related to the GT1 family of glycosyltransferases	Back alignment and domain information

>cd03822 GT1_ecORF704_like This family is most closely related to the GT1 family of glycosyltransferases	Back alignment and domain information

>PLN00142 sucrose synthase	Back alignment and domain information

>KOG1111 consensus N-acetylglucosaminyltransferase complex, subunit PIG-A/SPT14, required for phosphatidylinositol biosynthesis/Sulfolipid synthase [Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones; Lipid transport and metabolism]	Back alignment and domain information

>cd03794 GT1_wbuB_like This family is most closely related to the GT1 family of glycosyltransferases	Back alignment and domain information

>PHA01633 putative glycosyl transferase group 1	Back alignment and domain information

>cd03792 GT1_Trehalose_phosphorylase Trehalose phosphorylase (TP) reversibly catalyzes trehalose synthesis and degradation from alpha-glucose-1-phosphate (alpha-Glc-1-P) and glucose	Back alignment and domain information

>PLN02501 digalactosyldiacylglycerol synthase	Back alignment and domain information

>PLN02275 transferase, transferring glycosyl groups	Back alignment and domain information

>PF00534 Glycos_transf_1: Glycosyl transferases group 1; InterPro: IPR001296 The biosynthesis of disaccharides, oligosaccharides and polysaccharides involves the action of hundreds of different glycosyltransferases	Back alignment and domain information

>PRK10125 putative glycosyl transferase; Provisional	Back alignment and domain information

>PLN02846 digalactosyldiacylglycerol synthase	Back alignment and domain information

>KOG0853 consensus Glycosyltransferase [Cell wall/membrane/envelope biogenesis]	Back alignment and domain information

>TIGR02400 trehalose_OtsA alpha,alpha-trehalose-phosphate synthase [UDP-forming]	Back alignment and domain information

>cd04950 GT1_like_1 Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds	Back alignment and domain information

>cd03788 GT1_TPS Trehalose-6-Phosphate Synthase (TPS) is a glycosyltransferase that catalyses the synthesis of alpha,alpha-1,1-trehalose-6-phosphate from glucose-6-phosphate using a UDP-glucose donor	Back alignment and domain information

>KOG1387 consensus Glycosyltransferase [Cell wall/membrane/envelope biogenesis]	Back alignment and domain information

>cd03793 GT1_Glycogen_synthase_GSY2_like Glycogen synthase, which is most closely related to the GT1 family of glycosyltransferases, catalyzes the transfer of a glucose molecule from UDP-glucose to a terminal branch of a glycogen molecule, a rate-limit step of glycogen biosynthesis	Back alignment and domain information

>PRK05749 3-deoxy-D-manno-octulosonic-acid transferase; Reviewed	Back alignment and domain information

>PLN02605 monogalactosyldiacylglycerol synthase	Back alignment and domain information

>PLN03063 alpha,alpha-trehalose-phosphate synthase (UDP-forming); Provisional	Back alignment and domain information

>cd03785 GT1_MurG MurG is an N-acetylglucosaminyltransferase, the last enzyme involved in the intracellular phase of peptidoglycan biosynthesis	Back alignment and domain information

>PRK13609 diacylglycerol glucosyltransferase; Provisional	Back alignment and domain information

>PRK09814 beta-1,6-galactofuranosyltransferase; Provisional	Back alignment and domain information

>TIGR01133 murG undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase	Back alignment and domain information

>PRK14501 putative bifunctional trehalose-6-phosphate synthase/HAD hydrolase subfamily IIB; Provisional	Back alignment and domain information

>PRK13608 diacylglycerol glucosyltransferase; Provisional	Back alignment and domain information

>PRK00726 murG undecaprenyldiphospho-muramoylpentapeptide beta-N- acetylglucosaminyltransferase; Provisional	Back alignment and domain information

>COG0297 GlgA Glycogen synthase [Carbohydrate transport and metabolism]	Back alignment and domain information

>TIGR00236 wecB UDP-N-acetylglucosamine 2-epimerase	Back alignment and domain information

>cd01635 Glycosyltransferase_GTB_type Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds	Back alignment and domain information

>TIGR02398 gluc_glyc_Psyn glucosylglycerol-phosphate synthase	Back alignment and domain information

>cd03786 GT1_UDP-GlcNAc_2-Epimerase Bacterial members of the UDP-N-Acetylglucosamine (GlcNAc) 2-Epimerase family are known to catalyze the reversible interconversion of UDP-GlcNAc and UDP-N-acetylmannosamine (UDP-ManNAc)	Back alignment and domain information

>COG0438 RfaG Glycosyltransferase [Cell envelope biogenesis, outer membrane]	Back alignment and domain information

>PF13692 Glyco_trans_1_4: Glycosyl transferases group 1; PDB: 3OY2_A 3OY7_B 2Q6V_A 2HY7_A 3CV3_A 3CUY_A	Back alignment and domain information

>TIGR03713 acc_sec_asp1 accessory Sec system protein Asp1	Back alignment and domain information

>PF05693 Glycogen_syn: Glycogen synthase; InterPro: IPR008631 This family consists of the eukaryotic glycogen synthase proteins GYS1, GYS2 and GYS3	Back alignment and domain information

>PRK00025 lpxB lipid-A-disaccharide synthase; Reviewed	Back alignment and domain information

>PF13524 Glyco_trans_1_2: Glycosyl transferases group 1	Back alignment and domain information

>TIGR02919 accessory Sec system glycosyltransferase GtfB	Back alignment and domain information

>PLN03064 alpha,alpha-trehalose-phosphate synthase (UDP-forming); Provisional	Back alignment and domain information

>KOG2941 consensus Beta-1,4-mannosyltransferase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>TIGR00215 lpxB lipid-A-disaccharide synthase	Back alignment and domain information

>TIGR02094 more_P_ylases alpha-glucan phosphorylases	Back alignment and domain information

>PF13844 Glyco_transf_41: Glycosyl transferase family 41; PDB: 3PE4_C 3PE3_D 3TAX_C 2XGO_A 2JLB_B 2XGM_A 2VSY_B 2XGS_B 2VSN_A	Back alignment and domain information

>PF00982 Glyco_transf_20: Glycosyltransferase family 20; InterPro: IPR001830 The biosynthesis of disaccharides, oligosaccharides and polysaccharides involves the action of hundreds of different glycosyltransferases	Back alignment and domain information

>COG0380 OtsA Trehalose-6-phosphate synthase [Carbohydrate transport and metabolism]	Back alignment and domain information

>PRK10117 trehalose-6-phosphate synthase; Provisional	Back alignment and domain information

>COG1519 KdtA 3-deoxy-D-manno-octulosonic-acid transferase [Cell envelope biogenesis, outer membrane]	Back alignment and domain information

>COG0707 MurG UDP-N-acetylglucosamine:LPS N-acetylglucosamine transferase [Cell envelope biogenesis, outer membrane]	Back alignment and domain information

>COG3914 Spy Predicted O-linked N-acetylglucosamine transferase, SPINDLY family [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>TIGR01426 MGT glycosyltransferase, MGT family	Back alignment and domain information

>TIGR03492 conserved hypothetical protein	Back alignment and domain information

>KOG3742 consensus Glycogen synthase [Carbohydrate transport and metabolism]	Back alignment and domain information

>cd04299 GT1_Glycogen_Phosphorylase_like This family is most closely related to the oligosaccharide phosphorylase domain family and other unidentified sequences	Back alignment and domain information

>PLN02205 alpha,alpha-trehalose-phosphate synthase [UDP-forming]	Back alignment and domain information

>PF04101 Glyco_tran_28_C: Glycosyltransferase family 28 C-terminal domain; InterPro: IPR007235 The biosynthesis of disaccharides, oligosaccharides and polysaccharides involves the action of hundreds of different glycosyltransferases	Back alignment and domain information

>COG4641 Uncharacterized protein conserved in bacteria [Function unknown]	Back alignment and domain information

>TIGR03568 NeuC_NnaA UDP-N-acetyl-D-glucosamine 2-epimerase, UDP-hydrolysing	Back alignment and domain information

>cd03784 GT1_Gtf_like This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin	Back alignment and domain information

>TIGR03590 PseG pseudaminic acid biosynthesis-associated protein PseG	Back alignment and domain information

>TIGR00661 MJ1255 conserved hypothetical protein	Back alignment and domain information

>PHA03392 egt ecdysteroid UDP-glucosyltransferase; Provisional	Back alignment and domain information

>PRK12446 undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase; Reviewed	Back alignment and domain information

>PF07429 Glyco_transf_56: 4-alpha-L-fucosyltransferase glycosyl transferase group 56; InterPro: IPR009993 This family contains the bacterial enzyme 4-alpha-L-fucosyltransferase (Fuc4NAc transferase) (approximately 360 residues long)	Back alignment and domain information

>COG1819 Glycosyl transferases, related to UDP-glucuronosyltransferase [Carbohydrate transport and metabolism / Signal transduction mechanisms]	Back alignment and domain information

>COG0763 LpxB Lipid A disaccharide synthetase [Cell envelope biogenesis, outer membrane]	Back alignment and domain information

>PF02684 LpxB: Lipid-A-disaccharide synthetase; InterPro: IPR003835 The biosynthesis of disaccharides, oligosaccharides and polysaccharides involves the action of hundreds of different glycosyltransferases	Back alignment and domain information

>PF00201 UDPGT: UDP-glucoronosyl and UDP-glucosyl transferase; InterPro: IPR002213 UDP glycosyltransferases (UGT) are a superfamily of enzymes that catalyzes the addition of the glycosyl group from a UTP-sugar to a small hydrophobic molecule	Back alignment and domain information

>PF13528 Glyco_trans_1_3: Glycosyl transferase family 1	Back alignment and domain information

>PF02350 Epimerase_2: UDP-N-acetylglucosamine 2-epimerase; InterPro: IPR003331 UDP-N-acetylglucosamine 2-epimerase 5	Back alignment and domain information

>PLN02562 UDP-glycosyltransferase	Back alignment and domain information

>PRK02797 4-alpha-L-fucosyltransferase; Provisional	Back alignment and domain information

>PLN03004 UDP-glycosyltransferase	Back alignment and domain information

>COG0381 WecB UDP-N-acetylglucosamine 2-epimerase [Cell envelope biogenesis, outer membrane]	Back alignment and domain information

>PLN02208 glycosyltransferase family protein	Back alignment and domain information

>PLN02410 UDP-glucoronosyl/UDP-glucosyl transferase family protein	Back alignment and domain information

>PLN02173 UDP-glucosyl transferase family protein	Back alignment and domain information

>PLN02448 UDP-glycosyltransferase family protein	Back alignment and domain information

>PF10087 DUF2325: Uncharacterized protein conserved in bacteria (DUF2325); InterPro: IPR016772 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function	Back alignment and domain information

>PF04464 Glyphos_transf: CDP-Glycerol:Poly(glycerophosphate) glycerophosphotransferase ; InterPro: IPR007554 Wall-associated teichoic acids are a heterogeneous class of phosphate-rich polymers that are covalently linked to the cell wall peptidoglycan of Gram-positive bacteria	Back alignment and domain information

>PF03016 Exostosin: Exostosin family; InterPro: IPR004263 Hereditary multiple exostoses (EXT) is an autosomal dominant disorder that is characterised by the appearance of multiple outgrowths of the long bones (exostoses) at their epiphyses []	Back alignment and domain information

>PF15024 Glyco_transf_18: Glycosyltransferase family 18	Back alignment and domain information

>PLN00414 glycosyltransferase family protein	Back alignment and domain information

>PLN00164 glucosyltransferase; Provisional	Back alignment and domain information

>PLN03007 UDP-glucosyltransferase family protein	Back alignment and domain information

>COG3980 spsG Spore coat polysaccharide biosynthesis protein, predicted glycosyltransferase [Cell envelope biogenesis, outer membrane]	Back alignment and domain information

>PLN02207 UDP-glycosyltransferase	Back alignment and domain information

>PLN02152 indole-3-acetate beta-glucosyltransferase	Back alignment and domain information

>PLN02670 transferase, transferring glycosyl groups	Back alignment and domain information

>PLN02764 glycosyltransferase family protein	Back alignment and domain information

>PLN02992 coniferyl-alcohol glucosyltransferase	Back alignment and domain information

>PF11071 DUF2872: Protein of unknown function (DUF2872); InterPro: IPR019884 This entry represents a family of uncharacterised proteins, including YtoQ from Bacillus subtilis	Back alignment and domain information

>cd03789 GT1_LPS_heptosyltransferase Lipopolysaccharide heptosyltransferase is involved in the biosynthesis of lipooligosaccharide (LOS)	Back alignment and domain information

>PRK10017 colanic acid biosynthesis protein; Provisional	Back alignment and domain information

>PLN02210 UDP-glucosyl transferase	Back alignment and domain information

>PLN02554 UDP-glycosyltransferase family protein	Back alignment and domain information

>PLN02863 UDP-glucoronosyl/UDP-glucosyl transferase family protein	Back alignment and domain information

>PLN02555 limonoid glucosyltransferase	Back alignment and domain information

>TIGR02195 heptsyl_trn_II lipopolysaccharide heptosyltransferase II	Back alignment and domain information

>PLN03015 UDP-glucosyl transferase	Back alignment and domain information

>PRK10422 lipopolysaccharide core biosynthesis protein; Provisional	Back alignment and domain information

>PLN02534 UDP-glycosyltransferase	Back alignment and domain information

>PRK01021 lpxB lipid-A-disaccharide synthase; Reviewed	Back alignment and domain information

>TIGR02201 heptsyl_trn_III lipopolysaccharide heptosyltransferase III, putative	Back alignment and domain information

>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms]	Back alignment and domain information

>PLN02167 UDP-glycosyltransferase family protein	Back alignment and domain information

>PRK10916 ADP-heptose:LPS heptosyltransferase II; Provisional	Back alignment and domain information

>KOG1021 consensus Acetylglucosaminyltransferase EXT1/exostosin 1 [Carbohydrate transport and metabolism; Cell wall/membrane/envelope biogenesis; Extracellular structures]	Back alignment and domain information

>TIGR03646 YtoQ_fam YtoQ family protein	Back alignment and domain information

>PF04007 DUF354: Protein of unknown function (DUF354); InterPro: IPR007152 Members of this family are around 350 amino acids in length	Back alignment and domain information

>PF01075 Glyco_transf_9: Glycosyltransferase family 9 (heptosyltransferase); InterPro: IPR002201 The biosynthesis of disaccharides, oligosaccharides and polysaccharides involves the action of hundreds of different glycosyltransferases	Back alignment and domain information

>KOG1192 consensus UDP-glucuronosyl and UDP-glucosyl transferase [Carbohydrate transport and metabolism; Energy production and conversion]	Back alignment and domain information

>PF05159 Capsule_synth: Capsule polysaccharide biosynthesis protein; InterPro: IPR007833 This family includes export proteins involved in capsule polysaccharide biosynthesis, such as KpsS P42218 from SWISSPROT and LipB P57038 from SWISSPROT	Back alignment and domain information

>PF06258 Mito_fiss_Elm1: Mitochondrial fission ELM1; InterPro: IPR009367 This family consists of several hypothetical eukaryotic and prokaryotic proteins	Back alignment and domain information

>COG3660 Predicted nucleoside-diphosphate-sugar epimerase [Cell envelope biogenesis, outer membrane]	Back alignment and domain information

>TIGR02193 heptsyl_trn_I lipopolysaccharide heptosyltransferase I	Back alignment and domain information

>PRK10964 ADP-heptose:LPS heptosyl transferase I; Provisional	Back alignment and domain information

>KOG1050 consensus Trehalose-6-phosphate synthase component TPS1 and related subunits [Carbohydrate transport and metabolism]	Back alignment and domain information

>COG0859 RfaF ADP-heptose:LPS heptosyltransferase [Cell envelope biogenesis, outer membrane]	Back alignment and domain information

>COG0111 SerA Phosphoglycerate dehydrogenase and related dehydrogenases [Amino acid transport and metabolism]	Back alignment and domain information

>PF04230 PS_pyruv_trans: Polysaccharide pyruvyl transferase; InterPro: IPR007345 Pyruvyl-transferases are involved in peptidoglycan-associated polymer biosynthesis	Back alignment and domain information

>PF01113 DapB_N: Dihydrodipicolinate reductase, N-terminus; InterPro: IPR000846 Dihydrodipicolinate reductase catalyzes the second step in the biosynthesis of diaminopimelic acid and lysine, the NAD or NADP-dependent reduction of 2,3-dihydrodipicolinate into 2,3,4,5-tetrahydrodipicolinate [, , ]	Back alignment and domain information

>PF04392 ABC_sub_bind: ABC transporter substrate binding protein; InterPro: IPR007487 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems	Back alignment and domain information

>PRK08410 2-hydroxyacid dehydrogenase; Provisional	Back alignment and domain information

>PF02826 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain; InterPro: IPR006140 A number of NAD-dependent 2-hydroxyacid dehydrogenases which seem to be specific for the D-isomer of their substrate have been shown to be functionally and structurally related	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

ID	Alignment Graph	Length	Definition	E-value
Query		159
2f9f_A		177	Crystal Structure Of The Putative Mannosyl Transfer		2e-07

>pdb|2F9F|A Chain A, Crystal Structure Of The Putative Mannosyl Transferase (Wbaz-1)from Archaeoglobus Fulgidus, Northeast Structural Genomics Target Gr29a Length = 177

Back alignment and structure

Iteration: 1

Score = 51.2 bits (121), Expect = 2e-07, Method: Compositional matrix adjust. Identities = 28/63 (44%), Positives = 36/63 (57%) Query: 75 DRVNFITSCSTTERNALLFECLCVFYTPKDEHFGIVPLEAMAAYKPVSACDSGGPVETIK 134 D V F+ S S E L C + T KDE FG+ P+EA A+ KPV A + GG ET+ Sbjct: 78 DNVKFLGSVSEEELIDLYSRCKGLLCTAKDEDFGLTPIEAXASGKPVIAVNEGGFKETVI 137 Query: 135 NEE 137 NE+ Sbjct: 138 NEK 140

PyMOL of 2f9f

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		159
2f9f_A		177	First mannosyl transferase (WBAZ-1); alpha-beta pr	3e-24
3c48_A		438	Predicted glycosyltransferases; retaining glycosyl	1e-16
2x6q_A		416	Trehalose-synthase TRET; biosynthetic protein; 2.2	2e-16
3s28_A		816	Sucrose synthase 1; glycosyltransferase, sucrose m	3e-16
2r60_A		499	Glycosyl transferase, group 1; rossmann-fold; 1.80	4e-16
2jjm_A		394	Glycosyl transferase, group 1 family protein; anth	3e-15
2iw1_A		374	Lipopolysaccharide core biosynthesis protein RFAG;	1e-13
3qhp_A		166	Type 1 capsular polysaccharide biosynthesis prote	2e-13
3okp_A		394	GDP-mannose-dependent alpha-(1-6)-phosphatidylino	4e-13
2iuy_A		342	Avigt4, glycosyltransferase; antibiotics, family G	2e-09
2gek_A		406	Phosphatidylinositol mannosyltransferase (PIMA); G	1e-08
2x0d_A		413	WSAF; GT4 family, transferase; HET: MSE; 2.28A {Ge	1e-07
3oy2_A		413	Glycosyltransferase B736L; rossmann fold, GDP-mann	5e-07

>2f9f_A First mannosyl transferase (WBAZ-1); alpha-beta protein, structural genomics, PSI, protein struct initiative; 1.80A {Archaeoglobus fulgidus} SCOP: c.87.1.8 Length = 177	Back alignment and structure

 Score = 91.8 bits (229), Expect = 3e-24
 Identities = 36/116 (31%), Positives = 51/116 (43%), Gaps = 17/116 (14%)

Query: 56  ENVEYLEELKSLAERNGMSDRVNFITSCSTTERNALLFECLCVFYTPKDEHFGIVPLEAM 115
               Y  ++  +A      D V F+ S S  E   L   C  +  T KDE FG+ P+EAM
Sbjct: 64  HAERYARKIMKIAP-----DNVKFLGSVSEEELIDLYSRCKGLLCTAKDEDFGLTPIEAM 118

Query: 116 AAYKPVSACDSGGPVETIKN-----------EEFSLSMAKLIQEP-QMAKNMGENA 159
           A+ KPV A + GG  ET+ N            E   +M K+ + P +  K+    A
Sbjct: 119 ASGKPVIAVNEGGFKETVINEKTGYLVNADVNEIIDAMKKVSKNPDKFKKDCFRRA 174

PyMOL of 2f9f

>3c48_A Predicted glycosyltransferases; retaining glycosyltransferase, beta alpha beta, substrate AS catalysis; 2.10A {Corynebacterium glutamicum} PDB: 3c4v_A* 3c4q_A* Length = 438	Back alignment and structure

>2x6q_A Trehalose-synthase TRET; biosynthetic protein; 2.20A {Pyrococcus horikoshii} PDB: 2x6r_A 2xa1_A 2xa2_A* 2xa9_A* 2xmp_A* Length = 416	Back alignment and structure

>3s28_A Sucrose synthase 1; glycosyltransferase, sucrose metabolism, sugar donar complex rossmann fold, GT-B fold, glycosyltansferase, UDP-glucose; HET: UDP LCN NHF; 2.80A {Arabidopsis thaliana} PDB: 3s27_A* 3s29_A* Length = 816	Back alignment and structure

>2r60_A Glycosyl transferase, group 1; rossmann-fold; 1.80A {Halothermothrix orenii} PDB: 2r66_A* 2r68_A* Length = 499	Back alignment and structure

>2jjm_A Glycosyl transferase, group 1 family protein; anthrax, nucleotide, carbohydrate; 3.10A {Bacillus anthracis} PDB: 3mbo_A* Length = 394	Back alignment and structure

>2iw1_A Lipopolysaccharide core biosynthesis protein RFAG; transferase, lipopolysaccharide biosynthesis, family GT-4, glycosyltransferase, LPS; HET: U2F; 1.5A {Escherichia coli} SCOP: c.87.1.8 PDB: 2iv7_A* Length = 374	Back alignment and structure

>3qhp_A Type 1 capsular polysaccharide biosynthesis prote (CAPJ); rossmann fold, glycosyltransferase, transferase; 1.50A {Helicobacter pylori} Length = 166	Back alignment and structure

>3okp_A GDP-mannose-dependent alpha-(1-6)-phosphatidylino monomannoside mannosyltransferase...; GT-B fold, alpha-mannosyltransferase; HET: GDD; 2.00A {Corynebacterium glutamicum} PDB: 3okc_A* 3oka_A* Length = 394	Back alignment and structure

>2iuy_A Avigt4, glycosyltransferase; antibiotics, family GT-4, avilamycin A; HET: MES; 2.1A {Streptomyces viridochromogenes} PDB: 2iv3_A* Length = 342	Back alignment and structure

>2gek_A Phosphatidylinositol mannosyltransferase (PIMA); GT4 glycosyltransferase, rossmann fold, complex; HET: GDP; 2.40A {Mycobacterium smegmatis} PDB: 2gej_A* Length = 406	Back alignment and structure

>2x0d_A WSAF; GT4 family, transferase; HET: MSE; 2.28A {Geobacillus stearothermophilus} PDB: 2x0f_A* 2x0e_A* Length = 413	Back alignment and structure

>3oy2_A Glycosyltransferase B736L; rossmann fold, GDP-mannose, sugar, VIRU proteins, viral protein,transferase; 2.31A {Paramecium bursaria chlorella virus NY} PDB: 3oy7_A* Length = 413	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		159
3c48_A		438	Predicted glycosyltransferases; retaining glycosyl	99.95
2r60_A		499	Glycosyl transferase, group 1; rossmann-fold; 1.80	99.95
3okp_A		394	GDP-mannose-dependent alpha-(1-6)-phosphatidylino	99.94
2jjm_A		394	Glycosyl transferase, group 1 family protein; anth	99.94
2iw1_A		374	Lipopolysaccharide core biosynthesis protein RFAG;	99.94
3vue_A		536	GBSS-I, granule-bound starch synthase 1, chloropla	99.94
3fro_A		439	GLGA glycogen synthase; glycosyltransferase family	99.93
3oy2_A		413	Glycosyltransferase B736L; rossmann fold, GDP-mann	99.93
3s28_A		816	Sucrose synthase 1; glycosyltransferase, sucrose m	99.93
1rzu_A		485	Glycogen synthase 1; glycosyl-transferase, GT-B fo	99.93
2qzs_A		485	Glycogen synthase; glycosyl-transferase, GT-B fold	99.92
2gek_A		406	Phosphatidylinositol mannosyltransferase (PIMA); G	99.92
2iuy_A		342	Avigt4, glycosyltransferase; antibiotics, family G	99.9
2x6q_A		416	Trehalose-synthase TRET; biosynthetic protein; 2.2	99.9
3qhp_A		166	Type 1 capsular polysaccharide biosynthesis prote	99.89
2x0d_A		413	WSAF; GT4 family, transferase; HET: MSE; 2.28A {Ge	99.88
2bfw_A		200	GLGA glycogen synthase; glycosyltransferase family	99.87
2f9f_A		177	First mannosyl transferase (WBAZ-1); alpha-beta pr	99.86
2hy7_A		406	Glucuronosyltransferase GUMK; glycosyltransferases	99.84
2vsy_A		568	XCC0866; transferase, glycosyl transferase, GT-B,	99.83
3beo_A		375	UDP-N-acetylglucosamine 2-epimerase; UDP-GLCNAC, a	99.8
3nb0_A		725	Glycogen [starch] synthase isoform 2; glycogen syn	99.78
2xci_A		374	KDO-transferase, 3-deoxy-D-manno-2-octulosonic aci	99.78
1vgv_A		384	UDP-N-acetylglucosamine 2-epimerase; structural ge	99.76
3t5t_A		496	Putative glycosyltransferase; GTB fold, pseudoglyc	99.75
1uqt_A		482	Alpha, alpha-trehalose-phosphate synthase; glycosy	99.75
1f0k_A		364	MURG, UDP-N-acetylglucosamine-N-acetylmuramyl- (pe	99.68
3rhz_A		339	GTF3, nucleotide sugar synthetase-like protein; gl	99.66
1v4v_A		376	UDP-N-acetylglucosamine 2-epimerase; UDP-GLCNAC, t	99.66
3dzc_A		396	UDP-N-acetylglucosamine 2-epimerase; structural ge	99.45
3ot5_A		403	UDP-N-acetylglucosamine 2-epimerase; structural ge	99.41
3q3e_A		631	HMW1C-like glycosyltransferase; N-glycosylation; 2	99.26
3s2u_A		365	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentape	99.04
3otg_A		412	CALG1; calicheamicin, TDP, structural genomics, PS	98.99
2o6l_A		170	UDP-glucuronosyltransferase 2B7; drug metabolism,	98.93
2iyf_A		430	OLED, oleandomycin glycosyltransferase; antibiotic	98.88
4fzr_A		398	SSFS6; structural genomics, PSI-biology, protein s	98.87
2p6p_A		384	Glycosyl transferase; X-RAY-diffraction,urdamycina	98.74
4hwg_A		385	UDP-N-acetylglucosamine 2-epimerase; ssgcid, struc	98.72
3ia7_A		402	CALG4; glycosysltransferase, calicheamicin, enediy	98.58
3oti_A		398	CALG3; calicheamicin, TDP, structural genomics, PS	98.54
3rsc_A		415	CALG2; TDP, enediyne, structural genomics, PSI-2,	98.54
2yjn_A		441	ERYCIII, glycosyltransferase; transferase, cytochr	98.54
3tsa_A		391	SPNG, NDP-rhamnosyltransferase; glycosyltransferas	98.5
4gyw_A		723	UDP-N-acetylglucosamine--peptide N- acetylglucosam	98.42
2iya_A		424	OLEI, oleandomycin glycosyltransferase; carbohydra	98.37
1iir_A		415	Glycosyltransferase GTFB; rossmann fold; 1.80A {Am	98.32
1rrv_A		416	Glycosyltransferase GTFD; GT-B, glycosyltransferas	98.32
4amg_A		400	Snogd; transferase, polyketide biosynthesis, GT1 f	98.17
3h4t_A		404	Glycosyltransferase GTFA, glycosyltransferase; van	98.04
2c1x_A		456	UDP-glucose flavonoid 3-O glycosyltransferase; WIN	97.25
3hbf_A		454	Flavonoid 3-O-glucosyltransferase; glycosyltransfe	97.06
2pq6_A		482	UDP-glucuronosyl/UDP-glucosyltransferase; glycosyl	97.04
3hbm_A		282	UDP-sugar hydrolase; PSEG; 1.80A {Campylobacter je	96.64
1l5w_A		796	Maltodextrin phosphorylase; enzymatic catalysis, s	96.37
2c4m_A		796	Glycogen phosphorylase; allosteric control, phosph	96.34
2gj4_A		824	Glycogen phosphorylase, muscle form; transferase;	96.06
3tov_A		349	Glycosyl transferase family 9; structural genomics	95.88
1psw_A		348	ADP-heptose LPS heptosyltransferase II; structural	95.29
2vch_A		480	Hydroquinone glucosyltransferase; glycosyltransfer	94.98
2acv_A		463	Triterpene UDP-glucosyl transferase UGT71G1; glyco	94.93
2jzc_A		224	UDP-N-acetylglucosamine transferase subunit ALG13;	93.4
2gt1_A		326	Lipopolysaccharide heptosyltransferase-1; GT-B fol	92.57
3l7i_A		729	Teichoic acid biosynthesis protein F; GT-B fold, m	80.86

>3c48_A Predicted glycosyltransferases; retaining glycosyltransferase, beta alpha beta, substrate AS catalysis; 2.10A {Corynebacterium glutamicum} PDB: 3c4v_A* 3c4q_A*	Back alignment and structure

Probab=99.95  E-value=1.4e-27  Score=178.10  Aligned_cols=155  Identities=21%  Similarity=0.314  Sum_probs=131.6

Q ss_pred             ccEEEEcCHhhHHHHHHHhhhhhccCceeEEEecCCccccccCCC---------------CC------------------
Q 036860            2 ADVILVDSKFTANTFADTFKKLHARGIRLVVLYLAVNVYQFDKPH---------------SC------------------   48 (159)
Q Consensus         2 ad~ii~~s~~~~~~~~~~~~~~~~~~i~~~vi~~~vd~~~~~~~~---------------~~------------------   48 (159)
                      ||.++++|+..++.+.+.++....+   +.+++||+|...|.+..               ..                  
T Consensus       185 ~d~ii~~s~~~~~~~~~~~g~~~~k---~~vi~ngvd~~~~~~~~~~~~~~~r~~~~~~~~~~~i~~~G~~~~~Kg~~~l  261 (438)
T 3c48_A          185 ADVLAVNTQEEMQDLMHHYDADPDR---ISVVSPGADVELYSPGNDRATERSRRELGIPLHTKVVAFVGRLQPFKGPQVL  261 (438)
T ss_dssp             CSEEEESSHHHHHHHHHHHCCCGGG---EEECCCCCCTTTSCCC----CHHHHHHTTCCSSSEEEEEESCBSGGGCHHHH
T ss_pred             CCEEEEcCHHHHHHHHHHhCCChhh---eEEecCCccccccCCcccchhhhhHHhcCCCCCCcEEEEEeeecccCCHHHH
Confidence            7999999999999998877654454   88999999988776531               11                  


Q ss_pred             --------------ccccccccc----HHHHHHHHHHHHHcCCCCcEEEccCCCHHHHHHHHHhCcEEEeCCCCCCCccH
Q 036860           49 --------------GCDKLLREN----VEYLEELKSLAERNGMSDRVNFITSCSTTERNALLFECLCVFYTPKDEHFGIV  110 (159)
Q Consensus        49 --------------~~~~~i~~~----~~~~~~~~~~~~~~~~~~~v~~~g~~~~~~l~~~~~~a~~~i~~s~~e~~g~~  110 (159)
                                    .+...+.|+    +++.+.++++++++++.++|.|+|+++++++.++|+.||++++||..|+||++
T Consensus       262 i~a~~~l~~~~p~~~~~l~i~G~~~~~g~~~~~l~~~~~~~~l~~~v~~~g~~~~~~~~~~~~~adv~v~ps~~e~~~~~  341 (438)
T 3c48_A          262 IKAVAALFDRDPDRNLRVIICGGPSGPNATPDTYRHMAEELGVEKRIRFLDPRPPSELVAVYRAADIVAVPSFNESFGLV  341 (438)
T ss_dssp             HHHHHHHHHHCTTCSEEEEEECCBC------CHHHHHHHHTTCTTTEEEECCCCHHHHHHHHHHCSEEEECCSCCSSCHH
T ss_pred             HHHHHHHHhhCCCcceEEEEEeCCCCCCcHHHHHHHHHHHcCCCCcEEEcCCCChHHHHHHHHhCCEEEECccccCCchH
Confidence                          123455677    78889999999999998999999999999999999999999999999999999


Q ss_pred             HHHhhhcCCcEEEeCCCCCceeecc------------HHHHHHHHHHhcCHHHHHHhhhcC
Q 036860          111 PLEAMAAYKPVSACDSGGPVETIKN------------EEFSLSMAKLIQEPQMAKNMGENA  159 (159)
Q Consensus       111 ~lEama~G~Pvi~~~~~~~~e~i~~------------~~l~~~i~~l~~~~~~~~~~~~~a  159 (159)
                      ++|||+||+|||+++.++..|++.+            ++++++|.++++|++.+++|+++|
T Consensus       342 ~~Eama~G~PvI~~~~~~~~e~i~~~~~g~~~~~~d~~~la~~i~~l~~~~~~~~~~~~~~  402 (438)
T 3c48_A          342 AMEAQASGTPVIAARVGGLPIAVAEGETGLLVDGHSPHAWADALATLLDDDETRIRMGEDA  402 (438)
T ss_dssp             HHHHHHTTCCEEEESCTTHHHHSCBTTTEEEESSCCHHHHHHHHHHHHHCHHHHHHHHHHH
T ss_pred             HHHHHHcCCCEEecCCCChhHHhhCCCcEEECCCCCHHHHHHHHHHHHcCHHHHHHHHHHH
Confidence            9999999999999999999988865            899999999999999999888753

PyMOL of 3c48

>2r60_A Glycosyl transferase, group 1; rossmann-fold; 1.80A {Halothermothrix orenii} PDB: 2r66_A* 2r68_A*	Back alignment and structure

>3okp_A GDP-mannose-dependent alpha-(1-6)-phosphatidylino monomannoside mannosyltransferase...; GT-B fold, alpha-mannosyltransferase; HET: GDD; 2.00A {Corynebacterium glutamicum} PDB: 3okc_A* 3oka_A*	Back alignment and structure

>2jjm_A Glycosyl transferase, group 1 family protein; anthrax, nucleotide, carbohydrate; 3.10A {Bacillus anthracis} PDB: 3mbo_A*	Back alignment and structure

>2iw1_A Lipopolysaccharide core biosynthesis protein RFAG; transferase, lipopolysaccharide biosynthesis, family GT-4, glycosyltransferase, LPS; HET: U2F; 1.5A {Escherichia coli} SCOP: c.87.1.8 PDB: 2iv7_A*	Back alignment and structure

>3vue_A GBSS-I, granule-bound starch synthase 1, chloroplastic/amyloplastic; rossmann fold, glycosyltransferase, transferase; 2.70A {Oryza sativa japonica group} PDB: 3vuf_A*	Back alignment and structure

>3fro_A GLGA glycogen synthase; glycosyltransferase family, UDP/ADP-glucose-glycogen synthas rossman folds, transferase; HET: NHF; 2.50A {Pyrococcus abyssi} SCOP: c.87.1.8 PDB: 2bis_A* 3l01_A*	Back alignment and structure

>3oy2_A Glycosyltransferase B736L; rossmann fold, GDP-mannose, sugar, VIRU proteins, viral protein,transferase; 2.31A {Paramecium bursaria chlorella virus NY} PDB: 3oy7_A*	Back alignment and structure

>3s28_A Sucrose synthase 1; glycosyltransferase, sucrose metabolism, sugar donar complex rossmann fold, GT-B fold, glycosyltansferase, UDP-glucose; HET: UDP LCN NHF; 2.80A {Arabidopsis thaliana} PDB: 3s27_A* 3s29_A*	Back alignment and structure

>1rzu_A Glycogen synthase 1; glycosyl-transferase, GT-B fold, rossmann fold, ADP-binding, transferase; HET: ADP; 2.30A {Agrobacterium tumefaciens} SCOP: c.87.1.8 PDB: 1rzv_A	Back alignment and structure

>2qzs_A Glycogen synthase; glycosyl-transferase, GT-B fold, rossmann fold, closed-form, ADP and glucose binding, glycogen biosynthesis; HET: GLC ADP 250; 2.20A {Escherichia coli} PDB: 2r4t_A* 2r4u_A* 3guh_A* 3cx4_A* 3cop_A* 3d1j_A	Back alignment and structure

>2gek_A Phosphatidylinositol mannosyltransferase (PIMA); GT4 glycosyltransferase, rossmann fold, complex; HET: GDP; 2.40A {Mycobacterium smegmatis} PDB: 2gej_A*	Back alignment and structure

>2iuy_A Avigt4, glycosyltransferase; antibiotics, family GT-4, avilamycin A; HET: MES; 2.1A {Streptomyces viridochromogenes} PDB: 2iv3_A*	Back alignment and structure

>2x6q_A Trehalose-synthase TRET; biosynthetic protein; 2.20A {Pyrococcus horikoshii} PDB: 2x6r_A 2xa1_A 2xa2_A* 2xa9_A* 2xmp_A*	Back alignment and structure

>3qhp_A Type 1 capsular polysaccharide biosynthesis prote (CAPJ); rossmann fold, glycosyltransferase, transferase; 1.50A {Helicobacter pylori}	Back alignment and structure

>2x0d_A WSAF; GT4 family, transferase; HET: MSE; 2.28A {Geobacillus stearothermophilus} PDB: 2x0f_A* 2x0e_A*	Back alignment and structure

>2bfw_A GLGA glycogen synthase; glycosyltransferase family 5 UDP/ADP-glucose-glycogen syntha rossman folds, transferase; 1.8A {Pyrococcus abyssi} SCOP: c.87.1.8	Back alignment and structure

>2f9f_A First mannosyl transferase (WBAZ-1); alpha-beta protein, structural genomics, PSI, protein struct initiative; 1.80A {Archaeoglobus fulgidus} SCOP: c.87.1.8	Back alignment and structure

>2hy7_A Glucuronosyltransferase GUMK; glycosyltransferases, xanthan, membrane-associated proteins; 1.90A {Xanthomonas campestris} PDB: 2q6v_A* 3cv3_A* 3cuy_A*	Back alignment and structure

>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A*	Back alignment and structure

>3beo_A UDP-N-acetylglucosamine 2-epimerase; UDP-GLCNAC, allosteric, regulation, isomerase; HET: UD1 UDP; 1.70A {Bacillus anthracis} PDB: 1o6c_A	Back alignment and structure

>3nb0_A Glycogen [starch] synthase isoform 2; glycogen synthase, glucose-6-phosphate, yeast, allosteric AC transferase; HET: G6P; 2.41A {Saccharomyces cerevisiae} PDB: 3rt1_A* 3nch_A 3naz_A 3o3c_A* 3rsz_A*	Back alignment and structure

>2xci_A KDO-transferase, 3-deoxy-D-manno-2-octulosonic acid transferase; KDTA, GSEA, glycosyltransferase superfamily B,; HET: PG4; 2.00A {Aquifex aeolicus} PDB: 2xcu_A*	Back alignment and structure

>1vgv_A UDP-N-acetylglucosamine 2-epimerase; structural genomics, isomerase; HET: UD1; 2.31A {Escherichia coli} SCOP: c.87.1.3 PDB: 1f6d_A*	Back alignment and structure

>3t5t_A Putative glycosyltransferase; GTB fold, pseudoglycosyltransferase; 1.70A {Streptomyces hygroscopicus} PDB: 4f97_A* 4f96_B* 4f9f_A* 3t7d_A*	Back alignment and structure

>1uqt_A Alpha, alpha-trehalose-phosphate synthase; glycosyltransferase, transferase; HET: U2F; 2.0A {Escherichia coli} SCOP: c.87.1.6 PDB: 1uqu_A* 2wtx_A* 1gz5_A*	Back alignment and structure

>1f0k_A MURG, UDP-N-acetylglucosamine-N-acetylmuramyl- (pentapeptide) pyrophosphoryl-undecaprenol...; rossmann fold, transferase; 1.90A {Escherichia coli} SCOP: c.87.1.2 PDB: 1nlm_A*	Back alignment and structure

>3rhz_A GTF3, nucleotide sugar synthetase-like protein; glycosyltransferase, transferase; HET: UDP; 1.90A {Streptococcus parasanguinis} PDB: 3qkw_A*	Back alignment and structure

>1v4v_A UDP-N-acetylglucosamine 2-epimerase; UDP-GLCNAC, two domains, homodimer, riken structural genomics/proteomics initiative, RSGI; HET: MSE; 1.80A {Thermus thermophilus} SCOP: c.87.1.3	Back alignment and structure

>3dzc_A UDP-N-acetylglucosamine 2-epimerase; structural genomics, in diseases, isomerase, center for structural genomics of INFE diseases, csgid; 2.35A {Vibrio cholerae}	Back alignment and structure

>3ot5_A UDP-N-acetylglucosamine 2-epimerase; structural genomics, center for structural genomics of infec diseases, csgid, alpha beta; HET: PGE; 2.20A {Listeria monocytogenes}	Back alignment and structure

>3q3e_A HMW1C-like glycosyltransferase; N-glycosylation; 2.10A {Actinobacillus pleuropneumoniae serovaorganism_taxid} PDB: 3q3h_A* 3q3i_A	Back alignment and structure

>3s2u_A UDP-N-acetylglucosamine--N-acetylmuramyl-(pentape pyrophosphoryl-undecaprenol N-acetylglucosamine...; N-acetylglucosaminyl transferase; HET: UD1; 2.23A {Pseudomonas aeruginosa}	Back alignment and structure

>3otg_A CALG1; calicheamicin, TDP, structural genomics, PSI-2, protein STRU initiative, center for eukaryotic structural genomics, CESG fold; HET: TYD; 2.08A {Micromonospora echinospora} PDB: 3oth_A*	Back alignment and structure

>2o6l_A UDP-glucuronosyltransferase 2B7; drug metabolism, rossman, MAD, enzyme, nucleotide binding, sugar,UDP-glucuronosyltransferase, UGT; 1.80A {Homo sapiens}	Back alignment and structure

>2iyf_A OLED, oleandomycin glycosyltransferase; antibiotic resistance, glycosylation, enzyme, macrolide, carbohydrate; HET: ERY UDP; 1.7A {Streptomyces antibioticus}	Back alignment and structure

>4fzr_A SSFS6; structural genomics, PSI-biology, protein structure initiati enzyme discovery for natural product biosynthesis, natPro; 2.40A {Streptomyces SP} PDB: 4g2t_A*	Back alignment and structure

>2p6p_A Glycosyl transferase; X-RAY-diffraction,urdamycina-biosynthesis; 1.88A {Streptomyces fradiae}	Back alignment and structure

>4hwg_A UDP-N-acetylglucosamine 2-epimerase; ssgcid, structural genomics, seattle structural genomics center for infectious disease, isomerase; 2.00A {Rickettsia bellii}	Back alignment and structure

>3ia7_A CALG4; glycosysltransferase, calicheamicin, enediyne, transf; 1.91A {Micromonospora echinospora}	Back alignment and structure

>3oti_A CALG3; calicheamicin, TDP, structural genomics, PSI-2, protein STRU initiative, center for eukaryotic structural genomics, CESG fold; HET: TYD C0T; 1.60A {Micromonospora echinospora} PDB: 3d0q_A* 3d0r_A*	Back alignment and structure

>3rsc_A CALG2; TDP, enediyne, structural genomics, PSI-2, protein structure initiative, center for eukaryotic structural genomics; HET: TYD C0T; 2.19A {Micromonospora echinospora} PDB: 3iaa_A*	Back alignment and structure

>2yjn_A ERYCIII, glycosyltransferase; transferase, cytochrome P450; 3.09A {Saccharopolyspora erythraea}	Back alignment and structure

>3tsa_A SPNG, NDP-rhamnosyltransferase; glycosyltransferase; HET: GLC; 1.70A {Saccharopolyspora spinosa} PDB: 3uyk_A* 3uyl_A*	Back alignment and structure

>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A*	Back alignment and structure

>2iya_A OLEI, oleandomycin glycosyltransferase; carbohydrate, glycosylation, enzyme, macrolide; HET: UDP ZIO; 1.7A {Streptomyces antibioticus}	Back alignment and structure

>1iir_A Glycosyltransferase GTFB; rossmann fold; 1.80A {Amycolatopsis orientalis} SCOP: c.87.1.5	Back alignment and structure

>1rrv_A Glycosyltransferase GTFD; GT-B, glycosyltransferase, rossmann fold, glycopeptide, VACO antibiotic, transferase-antibiotic complex; HET: OMZ GHP OMY 3FG TYD BGC; 2.00A {Amycolatopsis orientalis} SCOP: c.87.1.5	Back alignment and structure

>4amg_A Snogd; transferase, polyketide biosynthesis, GT1 family, nogalamyci; HET: MLY; 2.59A {Streptomyces nogalater} PDB: 4an4_A* 4amb_A*	Back alignment and structure

>3h4t_A Glycosyltransferase GTFA, glycosyltransferase; vancomycin, teicoplanin, ORF1, natural products, antibiotic; HET: UDP; 1.15A {Amycolatopsis orientalis} SCOP: c.87.1.5 PDB: 3h4i_A* 1pn3_A* 1pnv_A*	Back alignment and structure

>2c1x_A UDP-glucose flavonoid 3-O glycosyltransferase; WINE, catalysis, glycosylation; HET: UDP B3P; 1.9A {Vitis vinifera} SCOP: c.87.1.10 PDB: 2c1z_A* 2c9z_A*	Back alignment and structure

>3hbf_A Flavonoid 3-O-glucosyltransferase; glycosyltransferase, GT-B fold, GT1, phenylpropanoid metabolism; HET: UDP MYC; 2.10A {Medicago truncatula} SCOP: c.87.1.0 PDB: 3hbj_A*	Back alignment and structure

>2pq6_A UDP-glucuronosyl/UDP-glucosyltransferase; glycosylation, isoflavonoid, uridine diphosphate glycosyltransferase; 2.10A {Medicago truncatula} SCOP: c.87.1.10	Back alignment and structure

>3hbm_A UDP-sugar hydrolase; PSEG; 1.80A {Campylobacter jejuni subsp} PDB: 3hbn_A*	Back alignment and structure

>1l5w_A Maltodextrin phosphorylase; enzymatic catalysis, substrate complex, trans; HET: GLC PLP; 1.80A {Escherichia coli} SCOP: c.87.1.4 PDB: 1l5v_A* 1l6i_A* 2asv_A* 2av6_A* 2aw3_A* 2azd_A* 1qm5_A* 1e4o_A* 2ecp_A* 1ahp_A*	Back alignment and structure

>2c4m_A Glycogen phosphorylase; allosteric control, phosphate dependence, starch degrading, transferase, glycosyltransferase; HET: PLP; 1.9A {Corynebacterium callunae}	Back alignment and structure

>2gj4_A Glycogen phosphorylase, muscle form; transferase; HET: PLR 2TH; 1.60A {Oryctolagus cuniculus} SCOP: c.87.1.4 PDB: 2gm9_A* 1abb_A* 3nc4_A* 3l79_A* 2pyd_A* 2pyi_A* 3l7a_A* 3l7b_A* 3l7c_A* 3l7d_A* 2qnb_A* 1c8l_A* 1axr_A* 1gpy_A* 1e1y_A* 1lwo_A* 1pyg_A* 1uzu_A* 1lwn_A* 1xkx_A* ...	Back alignment and structure

>3tov_A Glycosyl transferase family 9; structural genomics, PSI-BIOL protein structure initiative, midwest center for structural genomics, MCSG; 2.98A {Veillonella parvula}	Back alignment and structure

>1psw_A ADP-heptose LPS heptosyltransferase II; structural genomics, NYSGXRC, LPS biosynthetic pathway, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.87.1.7	Back alignment and structure

>2vch_A Hydroquinone glucosyltransferase; glycosyltransferase, N-glucosyltransferase, UDP-glucose- dependent, plant glycosyltransferase; HET: UDP; 1.45A {Arabidopsis thaliana} SCOP: c.87.1.10 PDB: 2vce_A* 2vg8_A*	Back alignment and structure

>2acv_A Triterpene UDP-glucosyl transferase UGT71G1; glycosyltransferase; HET: UDP; 2.00A {Medicago truncatula} SCOP: c.87.1.10 PDB: 2acw_A*	Back alignment and structure

>2jzc_A UDP-N-acetylglucosamine transferase subunit ALG13; rossmann-like fold, endoplasmic reticulum, glycosyltransferase, structural genomics; NMR {Saccharomyces cerevisiae} PDB: 2ks6_A	Back alignment and structure

>2gt1_A Lipopolysaccharide heptosyltransferase-1; GT-B fold; 1.90A {Escherichia coli UTI89} PDB: 2h1f_A* 2h1h_A*	Back alignment and structure

>3l7i_A Teichoic acid biosynthesis protein F; GT-B fold, monotopic membrane protein, structural protein; 2.70A {Staphylococcus epidermidis} PDB: 3l7j_A 3l7k_A* 3l7l_A* 3l7m_A*	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	E-value
Query		159
d1rzua_		477	c.87.1.8 (A:) Glycogen synthase 1, GlgA {Agrobacte	2e-08
d1uqta_		456	c.87.1.6 (A:) Trehalose-6-phosphate synthase, OtsA	2e-07
d2bisa1		437	c.87.1.8 (A:1-437) Glycogen synthase 1, GlgA {Pyro	1e-05

>d1rzua_ c.87.1.8 (A:) Glycogen synthase 1, GlgA {Agrobacterium tumefaciens [TaxId: 358]} Length = 477	Back information, alignment and structure


class: Alpha and beta proteins (a/b)
fold: UDP-Glycosyltransferase/glycogen phosphorylase
superfamily: UDP-Glycosyltransferase/glycogen phosphorylase
family: Glycosyl transferases group 1
domain: Glycogen synthase 1, GlgA
species: Agrobacterium tumefaciens [TaxId: 358]

 Score = 50.0 bits (118), Expect = 2e-08
 Identities = 11/71 (15%), Positives = 23/71 (32%)

Query: 68  AERNGMSDRVNFITSCSTTERNALLFECLCVFYTPKDEHFGIVPLEAMAAYKPVSACDSG 127
           A  +    RV      +    + +   C  +    + E  G+  L A+          +G
Sbjct: 339 AAASRHHGRVGVAIGYNEPLSHLMQAGCDAIIIPSRFEPCGLTQLYALRYGCIPVVARTG 398

Query: 128 GPVETIKNEEF 138
           G  +T+ +   
Sbjct: 399 GLADTVIDANH 409

PyMOL of d1rzua_

>d1uqta_ c.87.1.6 (A:) Trehalose-6-phosphate synthase, OtsA {Escherichia coli [TaxId: 562]} Length = 456	Back information, alignment and structure

>d2bisa1 c.87.1.8 (A:1-437) Glycogen synthase 1, GlgA {Pyrococcus abyssi [TaxId: 29292]} Length = 437	Back information, alignment and structure

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		159
d2iw1a1		370	Lipopolysaccharide core biosynthesis protein RfaG	99.94
d1rzua_		477	Glycogen synthase 1, GlgA {Agrobacterium tumefacie	99.92
d2bisa1		437	Glycogen synthase 1, GlgA {Pyrococcus abyssi [TaxI	99.89
d2bfwa1		196	Glycogen synthase 1, GlgA {Pyrococcus abyssi [TaxI	99.83
d2f9fa1		166	First mannosyl transferase WbaZ {Archaeoglobus ful	99.82
d1uqta_		456	Trehalose-6-phosphate synthase, OtsA {Escherichia	99.7
d1rrva_		401	TDP-vancosaminyltransferase GftD {Amycolatopsis or	98.14
d1pn3a_		391	TDP-epi-vancosaminyltransferase GtfA {Amycolatopsi	98.04
d1iira_		401	UDP-glucosyltransferase GtfB {Amycolatopsis orient	97.92
d1f0ka_		351	Peptidoglycan biosynthesis glycosyltransferase Mur	97.64
d1o6ca_		377	UDP-N-acetylglucosamine 2-epimerase {Bacillus subt	97.63
d2vcha1		471	Hydroquinone glucosyltransferase {Thale cress (Ara	97.19
d1v4va_		373	UDP-N-acetylglucosamine 2-epimerase {Thermus therm	97.17
d2pq6a1		473	(Iso)flavonoid glycosyltransferase {Medicago trunc	97.0
d1f6da_		376	UDP-N-acetylglucosamine 2-epimerase {Escherichia c	96.77
d2c1xa1		450	UDP glucose:flavonoid 3-o-glucosyltransferase {Gra	96.61
d2acva1		461	Triterpene UDP-glucosyl transferase UGT71G1 {Medic	95.75
d1pswa_		348	ADP-heptose LPS heptosyltransferase II {Escherichi	95.11
d2nzwa1		349	Alpha1,3-fucosyltransferase FucT {Helicobacter pyl	89.97
d1gtza_		149	Type II 3-dehydroquinate dehydratase {Streptomyces	84.61
d1j4aa1		197	D-lactate dehydrogenase {Lactobacillus helveticus	83.04

>d2iw1a1 c.87.1.8 (A:2-371) Lipopolysaccharide core biosynthesis protein RfaG {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: UDP-Glycosyltransferase/glycogen phosphorylase
superfamily: UDP-Glycosyltransferase/glycogen phosphorylase
family: Glycosyl transferases group 1
domain: Lipopolysaccharide core biosynthesis protein RfaG
species: Escherichia coli [TaxId: 562]

Probab=99.94  E-value=6.9e-27  Score=167.81  Aligned_cols=153  Identities=19%  Similarity=0.232  Sum_probs=125.3

Q ss_pred             ccEEEEcCHhhHHHHHHHhhhhhccCceeEEEecCCccccccCCCCC-----------------------------c---
Q 036860            2 ADVILVDSKFTANTFADTFKKLHARGIRLVVLYLAVNVYQFDKPHSC-----------------------------G---   49 (159)
Q Consensus         2 ad~ii~~s~~~~~~~~~~~~~~~~~~i~~~vi~~~vd~~~~~~~~~~-----------------------------~---   49 (159)
                      ++.+++.++...+.+.+.++....+   +.+++||+|.+.+.+....                             |   
T Consensus       136 ~~~~~~~~~~~~~~~~~~~~~~~~~---i~vi~~gv~~~~~~~~~~~~~~~~~r~~~~~~~~~~~i~~~gr~~~~Kg~~~  212 (370)
T d2iw1a1         136 STKLMMLTDKQIADFQKHYQTEPER---FQILPPGIYPDRKYSEQIPNSREIYRQKNGIKEQQNLLLQVGSDFGRKGVDR  212 (370)
T ss_dssp             CCEEEESCHHHHHHHHHHHCCCGGG---EEECCCCCCGGGSGGGSCTTHHHHHHHHTTCCTTCEEEEEECSCTTTTTHHH
T ss_pred             CceEEEecHHHHHHHHHhcCCCcce---EEEEEeecccccccccCchhhhhhhhhccCCCccceEEEEEeccccccchhh
Confidence            5788999999988887777665555   7899999998765432211                             1   


Q ss_pred             --------------ccccccccHHHHHHHHHHHHHcCCCCcEEEccCCCHHHHHHHHHhCcEEEeCCCCCCCccHHHHhh
Q 036860           50 --------------CDKLLRENVEYLEELKSLAERNGMSDRVNFITSCSTTERNALLFECLCVFYTPKDEHFGIVPLEAM  115 (159)
Q Consensus        50 --------------~~~~i~~~~~~~~~~~~~~~~~~~~~~v~~~g~~~~~~l~~~~~~a~~~i~~s~~e~~g~~~lEam  115 (159)
                                    ....+.+.+.....+++++++.+..++++|+|+.+  ++.++|+.||++++||..|+||++++|||
T Consensus       213 li~a~~~l~~~~~~~~~~ii~g~~~~~~~~~~~~~~~~~~~v~~~g~~~--~~~~~~~~adv~v~ps~~E~~~~~~~EAm  290 (370)
T d2iw1a1         213 SIEALASLPESLRHNTLLFVVGQDKPRKFEALAEKLGVRSNVHFFSGRN--DVSELMAAADLLLHPAYQEAAGIVLLEAI  290 (370)
T ss_dssp             HHHHHHTSCHHHHHTEEEEEESSSCCHHHHHHHHHHTCGGGEEEESCCS--CHHHHHHHCSEEEECCSCCSSCHHHHHHH
T ss_pred             hcccccccccccccceeeecccccccccccccccccccccccccccccc--ccccccccccccccccccccccceeeecc
Confidence                          11122344445567888999999989999999874  67999999999999999999999999999


Q ss_pred             hcCCcEEEeCCCCCceeecc-------------HHHHHHHHHHhcCHHHHHHhhhcC
Q 036860          116 AAYKPVSACDSGGPVETIKN-------------EEFSLSMAKLIQEPQMAKNMGENA  159 (159)
Q Consensus       116 a~G~Pvi~~~~~~~~e~i~~-------------~~l~~~i~~l~~~~~~~~~~~~~a  159 (159)
                      +||+|||+|+.+|..|++.+             ++++++|.++++|++++++|+++|
T Consensus       291 a~G~PvI~s~~~g~~e~i~~~~~G~l~~~~~d~~~la~~i~~ll~d~~~~~~~~~~a  347 (370)
T d2iw1a1         291 TAGLPVLTTAVCGYAHYIADANCGTVIAEPFSQEQLNEVLRKALTQSPLRMAWAENA  347 (370)
T ss_dssp             HHTCCEEEETTSTTTHHHHHHTCEEEECSSCCHHHHHHHHHHHHHCHHHHHHHHHHH
T ss_pred             cCCeeEEEeCCCChHHHhcCCCceEEEcCCCCHHHHHHHHHHHHcCHHHHHHHHHHH
Confidence            99999999999999988755             899999999999999999998864

PyMOL of d2iw1a1

>d1rzua_ c.87.1.8 (A:) Glycogen synthase 1, GlgA {Agrobacterium tumefaciens [TaxId: 358]}	Back information, alignment and structure

>d2bisa1 c.87.1.8 (A:1-437) Glycogen synthase 1, GlgA {Pyrococcus abyssi [TaxId: 29292]}	Back information, alignment and structure

>d2bfwa1 c.87.1.8 (A:218-413) Glycogen synthase 1, GlgA {Pyrococcus abyssi [TaxId: 29292]}	Back information, alignment and structure

>d2f9fa1 c.87.1.8 (A:2-167) First mannosyl transferase WbaZ {Archaeoglobus fulgidus [TaxId: 2234]}	Back information, alignment and structure

>d1uqta_ c.87.1.6 (A:) Trehalose-6-phosphate synthase, OtsA {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1rrva_ c.87.1.5 (A:) TDP-vancosaminyltransferase GftD {Amycolatopsis orientalis [TaxId: 31958]}	Back information, alignment and structure

>d1pn3a_ c.87.1.5 (A:) TDP-epi-vancosaminyltransferase GtfA {Amycolatopsis orientalis [TaxId: 31958]}	Back information, alignment and structure

>d1iira_ c.87.1.5 (A:) UDP-glucosyltransferase GtfB {Amycolatopsis orientalis [TaxId: 31958]}	Back information, alignment and structure

>d1f0ka_ c.87.1.2 (A:) Peptidoglycan biosynthesis glycosyltransferase MurG {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1o6ca_ c.87.1.3 (A:) UDP-N-acetylglucosamine 2-epimerase {Bacillus subtilis [TaxId: 1423]}	Back information, alignment and structure

>d2vcha1 c.87.1.10 (A:6-476) Hydroquinone glucosyltransferase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}	Back information, alignment and structure

>d1v4va_ c.87.1.3 (A:) UDP-N-acetylglucosamine 2-epimerase {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d2pq6a1 c.87.1.10 (A:8-480) (Iso)flavonoid glycosyltransferase {Medicago truncatula [TaxId: 3880]}	Back information, alignment and structure

>d1f6da_ c.87.1.3 (A:) UDP-N-acetylglucosamine 2-epimerase {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2c1xa1 c.87.1.10 (A:7-456) UDP glucose:flavonoid 3-o-glucosyltransferase {Grape (Vitis vinifera) [TaxId: 29760]}	Back information, alignment and structure

>d2acva1 c.87.1.10 (A:3-463) Triterpene UDP-glucosyl transferase UGT71G1 {Medicago truncatula [TaxId: 3880]}	Back information, alignment and structure

>d1pswa_ c.87.1.7 (A:) ADP-heptose LPS heptosyltransferase II {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2nzwa1 c.87.1.11 (A:1-349) Alpha1,3-fucosyltransferase FucT {Helicobacter pylori [TaxId: 210]}	Back information, alignment and structure

>d1gtza_ c.23.13.1 (A:) Type II 3-dehydroquinate dehydratase {Streptomyces coelicolor [TaxId: 1902]}	Back information, alignment and structure

>d1j4aa1 c.2.1.4 (A:104-300) D-lactate dehydrogenase {Lactobacillus helveticus [TaxId: 1587]}	Back information, alignment and structure