Citrus Sinensis ID: 036876


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230----
MHDLLQELGREIFDKNQLILETADIYEVLTYNTGTKKIEGICLDMSKVKEICLNPNTFTKMPKLRFLKFYSSSFNGENKCKVSYLQDLGFVEVKYLHWHGYPLKSLPSNLSAEKLVLLEVPGSSIEQLWDGVKHYSKLNQIIHVACKKLIAKTPNPTLMPHLNKLVILILRGSKSLKSLPAEIFNLECLTELDLSDCSKLKRLPEILSGIVNDALRIQHIGHLLAVRWKEMLEK
ccHHHHHHHHHHHcccccccccHHHHHHHccccccccEEEEEEEccccEEEEEcHHHccccccccEEEEcccccccccccccccccccccccccEEEEcccccccccccccccccEEEEccccccccccccccccccccEEccccccccEEEccccccccccccccccccccccccccccccccccccccEEEccccccccccccccccccccccccccccccccccccccccc
ccHHHHHHHHHHHHHHHHcccHHHHHHHHHccccccEEEEEEEEcccccEEEccHHHHHHccccEEEEEEccccccccEEEcccccccccHHccEEEccccccccccccccHHHEEEEccccccHHHccccccccHcccEEEccccHHHHHHcccccccHcHHHHcEEcccccccHccccccHHHHHHccEEccccccHHcccccccccccccEEEccccccEEEEcccccccc
MHDLLQELGREIFDKNQLILETADIYEVLTyntgtkkieGICLDMSKVKeiclnpntftkmpklrFLKFysssfngenkckvsYLQDLGFVEVKYlhwhgyplkslpsnlsaeklvllevpgssieqLWDGVKHYSKLNQIIHVACKKLiaktpnptlmphLNKLVILILRGskslkslpaEIFNLeclteldlsdcsklkrlPEILSGIVNDALRIQHIGHLLAVRWKEMLEK
MHDLLQELGREIFDKNQLILETADIYEVLTYNTGTKKIEGICLDMSKVKEICLNpntftkmpkLRFLKFYSSSFNGENKCKVSYLQDLGFVEVKYLHWHGYPLKSLPSNLSAEKLVLLEVPGSSIEQLWDGVKHYSKLNQIIHVACKKLIAKTPNPTLMPHLNKLVILILRGSKSLKSLPAEIFNLECLTELDLSDCSKLKRLPEILSGIVNDALRIQHIGHLLAVRWKEMLEK
MHDLLQELGREIFDKNQLILETADIYEVLTYNTGTKKIEGICLDMSKVKEICLNPNTFTKMPKLRFLKFYSSSFNGENKCKVSYLQDLGFVEVKYLHWHGYPLKSLPSNLSAEKLVLLEVPGSSIEQLWDGVKHYSKLNQIIHVACKKLIAKTPNPTLMPHLNKLVILILRGSKSLKSLPAEIFNLECLTELDLSDCSKLKRLPEILSGIVNDALRIQHIGHLLAVRWKEMLEK
*******LGREIFDKNQLILETADIYEVLTYNTGTKKIEGICLDMSKVKEICLNPNTFTKMPKLRFLKFYSSSFNGENKCKVSYLQDLGFVEVKYLHWHGYPLKSLPSNLSAEKLVLLEVPGSSIEQLWDGVKHYSKLNQIIHVACKKLIAKTPNPTLMPHLNKLVILILRGSKSLKSLPAEIFNLECLTELDLSDCSKLKRLPEILSGIVNDALRIQHIGHLLAVRWK*****
MHDLLQELGREIFDKNQLILETADIYEVLTYNTGTKKIEGICLDMSKVKEICLNPNTFTKMPKLRFLKFYSSSFNGENKCKVSYLQDLGFVEVKYLHWHGYPLKSLPSNLSAEKLVLLEVPGSSIEQLWDGVKHYSKLNQIIHVACKKLIAKTPNPTLMPHLNKLVILILRGSKSLKSLPAEIFNLECLTELDLSDCSKLKRLPEILSGIVNDALRIQHIGHLLAVRWKEMLE*
MHDLLQELGREIFDKNQLILETADIYEVLTYNTGTKKIEGICLDMSKVKEICLNPNTFTKMPKLRFLKFYSSSFNGENKCKVSYLQDLGFVEVKYLHWHGYPLKSLPSNLSAEKLVLLEVPGSSIEQLWDGVKHYSKLNQIIHVACKKLIAKTPNPTLMPHLNKLVILILRGSKSLKSLPAEIFNLECLTELDLSDCSKLKRLPEILSGIVNDALRIQHIGHLLAVRWKEMLEK
*HDLLQELGREIFDKNQLILETADIYEVLTYNTGTKKIEGICLDMSKVKEICLNPNTFTKMPKLRFLKFYSSSFNGENKCKVSYLQDLGFVEVKYLHWHGYPLKSLPSNLSAEKLVLLEVPGSSIEQLWDGVKHYSKLNQIIHVACKKLIAKTPNPTLMPHLNKLVILILRGSKSLKSLPAEIFNLECLTELDLSDCSKLKRLPEILSGIVNDALRIQHIGHLLAVRWKEM***
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MHDLLQELGREIFDKNQLILETADIYEVLTYNTGTKKIEGICLDMSKVKEICLNPNTFTKMPKLRFLKFYSSSFNGENKCKVSYLQDLGFVEVKYLHWHGYPLKSLPSNLSAEKLVLLEVPGSSIEQLWDGVKHYSKLNQIIHVACKKLIAKTPNPTLMPHLNKLVILILRGSKSLKSLPAEIFNLECLTELDLSDCSKLKRLPEILSGIVNDALRIQHIGHLLAVRWKEMLEK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query234 2.2.26 [Sep-21-2011]
Q9SZ67 1895 Probable WRKY transcripti no no 0.863 0.106 0.348 7e-21
O82500 1095 Putative disease resistan no no 0.854 0.182 0.337 7e-20
O23530 1301 Protein SUPPRESSOR OF npr no no 0.824 0.148 0.320 5e-17
Q9FH83 1288 Probable WRKY transcripti no no 0.905 0.164 0.305 5e-14
Q40392 1144 TMV resistance protein N N/A no 0.824 0.168 0.282 2e-12
Q9FL92 1372 Probable WRKY transcripti no no 0.893 0.152 0.278 2e-11
Q9FKN7 1613 Protein DA1-related 4 OS= no no 0.799 0.115 0.276 9e-09
>sp|Q9SZ67|WRK19_ARATH Probable WRKY transcription factor 19 OS=Arabidopsis thaliana GN=WRKY19 PE=2 SV=1 Back     alignment and function desciption
 Score =  100 bits (250), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 85/244 (34%), Positives = 117/244 (47%), Gaps = 42/244 (17%)

Query: 1    MHDLLQELGREIFDK-------NQLILETAD-IYEVLTYNTGTKKIEGICLDMSKVKEIC 52
            M   +Q  GREI  +       ++  L  AD I  V   +TGT  IEGI LDM  +K   
Sbjct: 1108 MLSFIQATGREIVRQESADRPGDRSRLWNADYIRHVFINDTGTSAIEGIFLDMLNLK-FD 1166

Query: 53   LNPNTFTKMPKLRFLKFYSSSFNGENKCKVSYLQDLGFV--EVKYLHWHGYPLKSLPSNL 110
             NPN F KM  LR LK Y S    E K  VS+ Q L ++  +++ LHW  YPL SLP + 
Sbjct: 1167 ANPNVFEKMCNLRLLKLYCS--KAEEKHGVSFPQGLEYLPSKLRLLHWEYYPLSSLPKSF 1224

Query: 111  SAEKLVLLEVPGSSIEQLWDGVK-HYSKLNQIIHVACKKLIAKTPNPTLMPHLN------ 163
            + E LV L +P S  ++LW G K  +   N  +    K  ++ +   T +P L+      
Sbjct: 1225 NPENLVELNLPSSCAKKLWKGKKARFCTTNSSLEKLKKMRLSYSDQLTKIPRLSSATNLE 1284

Query: 164  ---------------------KLVILILRGSKSLKSLPAEIFNLECLTELDLSDCSKLKR 202
                                 KLV L L+G   L+++P+ + +LE L  L+LS CSKL  
Sbjct: 1285 HIDLEGCNSLLSLSQSISYLKKLVFLNLKGCSKLENIPS-MVDLESLEVLNLSGCSKLGN 1343

Query: 203  LPEI 206
             PEI
Sbjct: 1344 FPEI 1347




Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element. May act also as a disease resistance protein with a serine/threonine-protein kinase activity.
Arabidopsis thaliana (taxid: 3702)
>sp|O82500|Y4117_ARATH Putative disease resistance protein At4g11170 OS=Arabidopsis thaliana GN=At4g11170 PE=2 SV=1 Back     alignment and function description
>sp|O23530|SNC1_ARATH Protein SUPPRESSOR OF npr1-1, CONSTITUTIVE 1 OS=Arabidopsis thaliana GN=SNC1 PE=1 SV=3 Back     alignment and function description
>sp|Q9FH83|WRK52_ARATH Probable WRKY transcription factor 52 OS=Arabidopsis thaliana GN=WRKY52 PE=2 SV=3 Back     alignment and function description
>sp|Q40392|TMVRN_NICGU TMV resistance protein N OS=Nicotiana glutinosa GN=N PE=1 SV=1 Back     alignment and function description
>sp|Q9FL92|WRK16_ARATH Probable WRKY transcription factor 16 OS=Arabidopsis thaliana GN=WRKY16 PE=2 SV=1 Back     alignment and function description
>sp|Q9FKN7|DAR4_ARATH Protein DA1-related 4 OS=Arabidopsis thaliana GN=DAR4 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query234
359486071 1261 PREDICTED: TMV resistance protein N-like 0.897 0.166 0.365 3e-31
317106744 947 JHS03A10.2 [Jatropha curcas] 0.948 0.234 0.360 9e-31
147858727 1177 hypothetical protein VITISV_025072 [Viti 0.893 0.177 0.372 1e-30
225448053 1468 PREDICTED: TMV resistance protein N-like 0.888 0.141 0.366 1e-30
359486075 1291 PREDICTED: TMV resistance protein N-like 0.897 0.162 0.365 5e-30
224145021 1561 tir-nbs-lrr resistance protein [Populus 0.863 0.129 0.382 7e-30
359493489 1092 PREDICTED: TMV resistance protein N-like 0.850 0.182 0.383 1e-29
224145016 1254 tir-nbs-lrr resistance protein [Populus 0.863 0.161 0.382 1e-29
224127917 1470 tir-nbs-lrr resistance protein [Populus 0.863 0.137 0.374 1e-29
359493485 824 PREDICTED: TMV resistance protein N-like 0.927 0.263 0.364 2e-29
>gi|359486071|ref|XP_002272667.2| PREDICTED: TMV resistance protein N-like [Vitis vinifera] Back     alignment and taxonomy information
 Score =  140 bits (354), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 94/257 (36%), Positives = 136/257 (52%), Gaps = 47/257 (18%)

Query: 1   MHDLLQELGREIF--------DKNQLILETADIYEVLTYNTGTKKIEGICLDMSKVKEIC 52
           MHDL+QE+G EI          K   +    D+ ++LT NTGT+ +EG+ L++S +KE+ 
Sbjct: 489 MHDLIQEMGWEIVRQESIKDPGKRSRLWVNDDVIDMLTTNTGTEAVEGMVLNLSTLKELH 548

Query: 53  LNPNTFTKMPKLRFLKFYSSSFNGEN--------------KCKVSYLQDLGFVE--VKYL 96
            + N FTKM KLR L+FY +   G +              +CK     D  F+   ++ L
Sbjct: 549 FSVNVFTKMNKLRVLRFYDAQIWGSSWIGRHNDRYKSPYTECKFHLSGDFKFLSNHLRSL 608

Query: 97  HWHGYPLKSLPSNLSAEKLVLLEVPGSSIEQLWDGVKHYSKLNQIIHVACKKLIAKTPNP 156
           HW GYPLKSLPSN   EKL+ L++  S +EQLW+G K + KL + I ++  + + KTP+ 
Sbjct: 609 HWDGYPLKSLPSNFHPEKLLELKMCFSQLEQLWEGNKSFQKL-KFIELSHSQHLIKTPDF 667

Query: 157 TLMPHLN---------------------KLVILILRGSKSLKSLPAEIFNLECLTELDLS 195
           +  P L                      KL+ L L G K+LKS  + I +LE L  + LS
Sbjct: 668 SGAPKLRRIILEGCTSLVKVHPSIGALKKLIFLNLEGCKNLKSFSSSI-HLESLQTITLS 726

Query: 196 DCSKLKRLPEILSGIVN 212
            CSKLK+ PE+   + N
Sbjct: 727 GCSKLKKFPEVQGAMDN 743




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|317106744|dbj|BAJ53239.1| JHS03A10.2 [Jatropha curcas] Back     alignment and taxonomy information
>gi|147858727|emb|CAN82909.1| hypothetical protein VITISV_025072 [Vitis vinifera] Back     alignment and taxonomy information
>gi|225448053|ref|XP_002273151.1| PREDICTED: TMV resistance protein N-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|359486075|ref|XP_002273047.2| PREDICTED: TMV resistance protein N-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|224145021|ref|XP_002325498.1| tir-nbs-lrr resistance protein [Populus trichocarpa] gi|222862373|gb|EEE99879.1| tir-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|359493489|ref|XP_002264004.2| PREDICTED: TMV resistance protein N-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|224145016|ref|XP_002325496.1| tir-nbs-lrr resistance protein [Populus trichocarpa] gi|222862371|gb|EEE99877.1| tir-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224127917|ref|XP_002329209.1| tir-nbs-lrr resistance protein [Populus trichocarpa] gi|222870990|gb|EEF08121.1| tir-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|359493485|ref|XP_003634611.1| PREDICTED: TMV resistance protein N-like, partial [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query234
TAIR|locus:2162439 1008 AT5G22690 [Arabidopsis thalian 0.846 0.196 0.364 1.6e-27
TAIR|locus:2175075 1068 AT5G41750 [Arabidopsis thalian 0.841 0.184 0.353 3.6e-27
TAIR|locus:2160472 1038 AT5G41540 [Arabidopsis thalian 0.846 0.190 0.353 4e-26
TAIR|locus:2146243 900 AT5G18360 [Arabidopsis thalian 0.837 0.217 0.350 1.4e-25
TAIR|locus:2160487 1085 AT5G41550 [Arabidopsis thalian 0.923 0.199 0.321 4e-25
TAIR|locus:2118106 1219 AT4G12010 [Arabidopsis thalian 0.799 0.153 0.366 2.1e-24
TAIR|locus:2164486 1104 AT5G40910 [Arabidopsis thalian 0.820 0.173 0.345 3.7e-24
TAIR|locus:2115870 1234 AT4G08450 [Arabidopsis thalian 0.854 0.162 0.350 1.2e-23
TAIR|locus:2175991 1294 AT5G17680 [Arabidopsis thalian 0.846 0.153 0.331 2.1e-23
TAIR|locus:2161513780 AT5G17970 [Arabidopsis thalian 0.850 0.255 0.364 2.4e-23
TAIR|locus:2162439 AT5G22690 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 320 (117.7 bits), Expect = 1.6e-27, P = 1.6e-27
 Identities = 79/217 (36%), Positives = 123/217 (56%)

Query:     1 MHDLLQELGREIF--------DKNQLILETADIYEVLTYNTGTKKIEGICLDMSKVKEIC 52
             MH +LQE+GREI          + + ++++ DI +VL  NTGTKK+ GI  DMS+++E+ 
Sbjct:   488 MHSMLQEMGREIVREQSIYEPGEREFLVDSTDILDVLNDNTGTKKVLGISFDMSEIEELH 547

Query:    53 LNPNTFTKMPKLRFLKFYSSSFNGENKCKVSYLQDLGF-----VEVKYLHWHGYPLKSLP 107
             ++   F +MP LRFL+FY        + ++ +LQ+ GF      ++K L W  YP++ +P
Sbjct:   548 IHKRAFKRMPNLRFLRFYKKLGKQSKEARL-HLQE-GFDKFFPPKLKLLSWDDYPMRRMP 605

Query:   108 SNLSAEKLVLLEVPGSSIEQLWDGVKHYSKLNQIIHVACKKLIAKTPNPTLMPHLNKLVI 167
             SN  A  LV+L +  S +E+LW GV+  + L ++     KKL  + P+ +L  +L  L  
Sbjct:   606 SNFHAGYLVVLRMQHSKLEKLWQGVQPLTCLREMQLWGSKKL-KEIPDLSLATNLETLY- 663

Query:   168 LILRGSKSLKSLPAEIFNLECLTELDLSDCSKLKRLP 204
               L    SL  LP+ I NL  L +L +  C KL+ LP
Sbjct:   664 --LNDCSSLVELPSSIKNLNKLWDLGMKGCEKLELLP 698




GO:0005622 "intracellular" evidence=IEA
GO:0005737 "cytoplasm" evidence=ISM
GO:0006952 "defense response" evidence=IEA;ISS
GO:0007165 "signal transduction" evidence=IEA
GO:0043531 "ADP binding" evidence=IEA
TAIR|locus:2175075 AT5G41750 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2160472 AT5G41540 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2146243 AT5G18360 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2160487 AT5G41550 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2118106 AT4G12010 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2164486 AT5G40910 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2115870 AT4G08450 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2175991 AT5G17680 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2161513 AT5G17970 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
eugene3.00190618
tir-nbs-lrr resistance protein (1561 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query234
PLN03210 1153 PLN03210, PLN03210, Resistant to P 8e-35
PLN03210 1153 PLN03210, PLN03210, Resistant to P 5e-07
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information
 Score =  130 bits (329), Expect = 8e-35
 Identities = 85/242 (35%), Positives = 129/242 (53%), Gaps = 36/242 (14%)

Query: 1   MHDLLQELGREIF-------DKNQLILETADIYEVLTYNTGTKKIEGICLDMSKVKEICL 53
           MH LLQE+G+EI         + + +++  DI +VL  NTGTKK+ GI LD+ ++ E+ +
Sbjct: 490 MHSLLQEMGKEIVRAQSNEPGEREFLVDAKDICDVLEDNTGTKKVLGITLDIDEIDELHI 549

Query: 54  NPNTFTKMPKLRFLKFYSSSFNGENKCKVSYLQDLGF----VEVKYLHWHGYPLKSLPSN 109
           + N F  M  L FLKFY+  +  + K +V +    GF     +++ L W  YPL+ +PSN
Sbjct: 550 HENAFKGMRNLLFLKFYTKKW--DQKKEVRWHLPEGFDYLPPKLRLLRWDKYPLRCMPSN 607

Query: 110 LSAEKLVLLEVPGSSIEQLWDGVKHYSKLNQIIHVACKKLIAKTPN-------------- 155
              E LV L++ GS +E+LWDGV   + L  I     K L  + P+              
Sbjct: 608 FRPENLVKLQMQGSKLEKLWDGVHSLTGLRNIDLRGSKNLK-EIPDLSMATNLETLKLSD 666

Query: 156 -------PTLMPHLNKLVILILRGSKSLKSLPAEIFNLECLTELDLSDCSKLKRLPEILS 208
                  P+ + +LNKL  L +   ++L+ LP  I NL+ L  L+LS CS+LK  P+I +
Sbjct: 667 CSSLVELPSSIQYLNKLEDLDMSRCENLEILPTGI-NLKSLYRLNLSGCSRLKSFPDIST 725

Query: 209 GI 210
            I
Sbjct: 726 NI 727


syringae 6; Provisional. Length = 1153

>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 234
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.95
KOG0617264 consensus Ras suppressor protein (contains leucine 99.7
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.68
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.64
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.61
KOG0617264 consensus Ras suppressor protein (contains leucine 99.55
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.54
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.5
KOG4658 889 consensus Apoptotic ATPase [Signal transduction me 99.41
KOG0472 565 consensus Leucine-rich repeat protein [Function un 99.38
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.34
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.31
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.23
KOG0472 565 consensus Leucine-rich repeat protein [Function un 99.2
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.18
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.16
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.08
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.07
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.05
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.05
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.0
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.98
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.88
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.87
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 98.87
KOG4237 498 consensus Extracellular matrix protein slit, conta 98.84
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 98.82
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 98.81
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.79
COG4886 394 Leucine-rich repeat (LRR) protein [Function unknow 98.71
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 98.69
PLN03150623 hypothetical protein; Provisional 98.66
PLN03150623 hypothetical protein; Provisional 98.61
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.55
KOG4658 889 consensus Apoptotic ATPase [Signal transduction me 98.52
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.37
KOG4237 498 consensus Extracellular matrix protein slit, conta 98.32
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.32
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.27
PRK15386 426 type III secretion protein GogB; Provisional 98.23
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 98.19
PRK15386 426 type III secretion protein GogB; Provisional 98.19
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.14
KOG0531 414 consensus Protein phosphatase 1, regulatory subuni 97.94
KOG0531 414 consensus Protein phosphatase 1, regulatory subuni 97.89
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.86
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 97.77
KOG1909 382 consensus Ran GTPase-activating protein [RNA proce 97.72
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 97.71
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.69
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.58
KOG2982 418 consensus Uncharacterized conserved protein [Funct 97.38
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.31
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.19
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.15
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 97.14
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.57
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.54
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 96.39
KOG2123 388 consensus Uncharacterized conserved protein [Funct 96.28
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 96.2
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 95.92
KOG2982 418 consensus Uncharacterized conserved protein [Funct 95.89
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 94.65
COG5238 388 RNA1 Ran GTPase-activating protein (RanGAP) involv 94.53
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 94.37
KOG2123 388 consensus Uncharacterized conserved protein [Funct 94.12
KOG3864221 consensus Uncharacterized conserved protein [Funct 93.58
KOG3864221 consensus Uncharacterized conserved protein [Funct 93.47
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 93.01
smart0037026 LRR Leucine-rich repeats, outliers. 90.87
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 90.87
KOG1947 482 consensus Leucine rich repeat proteins, some prote 88.84
KOG4341483 consensus F-box protein containing LRR [General fu 87.76
KOG0473 326 consensus Leucine-rich repeat protein [Function un 86.89
KOG0473 326 consensus Leucine-rich repeat protein [Function un 86.63
smart0036726 LRR_CC Leucine-rich repeat - CC (cysteine-containi 84.97
smart0036426 LRR_BAC Leucine-rich repeats, bacterial type. 84.8
>PLN03210 Resistant to P Back     alignment and domain information
Probab=99.95  E-value=2.2e-27  Score=227.12  Aligned_cols=223  Identities=35%  Similarity=0.624  Sum_probs=201.9

Q ss_pred             CchHHHHHHHHHHhh-------cccccchhhHHHHHhcCcCccceeeEEEecCCceeeecCchhhCCCCCcceEEecCCC
Q 036876            1 MHDLLQELGREIFDK-------NQLILETADIYEVLTYNTGTKKIEGICLDMSKVKEICLNPNTFTKMPKLRFLKFYSSS   73 (234)
Q Consensus         1 mhd~~~~~~~~~~~~-------~~~l~~~~~~~~~~~~~~~~~~i~~~~l~~~~~~~~~~~~~~~~~l~~L~~L~l~~~~   73 (234)
                      |||++++||++++++       ++++|.+++++.++.+..|++.+++|.+|......+.+...+|.+|++|+.|.++.+.
T Consensus       490 MHdLl~~~~r~i~~~~~~~~~~r~~l~~~~di~~vl~~~~g~~~v~~i~l~~~~~~~~~i~~~aF~~m~~L~~L~~~~~~  569 (1153)
T PLN03210        490 MHSLLQEMGKEIVRAQSNEPGEREFLVDAKDICDVLEDNTGTKKVLGITLDIDEIDELHIHENAFKGMRNLLFLKFYTKK  569 (1153)
T ss_pred             hhhHHHHHHHHHHHhhcCCCCcceeEeCHHHHHHHHHhCcccceeeEEEeccCccceeeecHHHHhcCccccEEEEeccc
Confidence            999999999999864       6899999999999999999999999999999998889999999999999999998775


Q ss_pred             CCCCCcccccccCCCCcc--EEEEEeeCCCCCCCCCCccCCCCccEEEecCCccccccccccCCCCCcEEEcccCccccc
Q 036876           74 FNGENKCKVSYLQDLGFV--EVKYLHWHGYPLKSLPSNLSAEKLVLLEVPGSSIEQLWDGVKHYSKLNQIIHVACKKLIA  151 (234)
Q Consensus        74 ~~~~~~~~~~~~~~l~~l--~L~~L~l~~~~~~~lp~~~~l~~L~~L~l~~~~l~~l~~~~~~l~~L~~L~l~~~~~l~~  151 (234)
                      +.........+|.++..+  +|+.|.|.+++++.+|..+.+.+|+.|++.++++..+|.+++.+++|+++++++|..++.
T Consensus       570 ~~~~~~~~~~lp~~~~~lp~~Lr~L~~~~~~l~~lP~~f~~~~L~~L~L~~s~l~~L~~~~~~l~~Lk~L~Ls~~~~l~~  649 (1153)
T PLN03210        570 WDQKKEVRWHLPEGFDYLPPKLRLLRWDKYPLRCMPSNFRPENLVKLQMQGSKLEKLWDGVHSLTGLRNIDLRGSKNLKE  649 (1153)
T ss_pred             ccccccceeecCcchhhcCcccEEEEecCCCCCCCCCcCCccCCcEEECcCccccccccccccCCCCCEEECCCCCCcCc
Confidence            443334445788888887  899999999999999999999999999999999999999999999999999999987888


Q ss_pred             CCCCCCCCCCCCCccEEEecCCCCCCcccccccCCCCCCEEeccCCCCCCcCCCcccCCCCCCCcEEecCCCcCC-Chhh
Q 036876          152 KTPNPTLMPHLNKLVILILRGSKSLKSLPAEIFNLECLTELDLSDCSKLKRLPEILSGIVNDALRIQHIGHLLAV-RWKE  230 (234)
Q Consensus       152 ~lp~~~~l~~L~~l~~L~l~~~~~l~~lp~~~~~l~~L~~L~l~~c~~l~~lp~~~~~~~l~~L~~l~l~~c~~l-~~~~  230 (234)
                       +|.++.+++|   +.|++++|..+..+|..++++++|+.|++++|+.++.+|..   ..+++|+.|++++|..+ .+|+
T Consensus       650 -ip~ls~l~~L---e~L~L~~c~~L~~lp~si~~L~~L~~L~L~~c~~L~~Lp~~---i~l~sL~~L~Lsgc~~L~~~p~  722 (1153)
T PLN03210        650 -IPDLSMATNL---ETLKLSDCSSLVELPSSIQYLNKLEDLDMSRCENLEILPTG---INLKSLYRLNLSGCSRLKSFPD  722 (1153)
T ss_pred             -CCccccCCcc---cEEEecCCCCccccchhhhccCCCCEEeCCCCCCcCccCCc---CCCCCCCEEeCCCCCCcccccc
Confidence             9987777777   99999999999999999999999999999999999999995   48999999999999887 3554



syringae 6; Provisional

>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily Back     alignment and domain information
>smart00364 LRR_BAC Leucine-rich repeats, bacterial type Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query234
4fcg_A328 Structure Of The Leucine-Rich Repeat Domain Of The 2e-04
>pdb|4FCG|A Chain A, Structure Of The Leucine-Rich Repeat Domain Of The Type Iii Effector Xcv3220 (Xopl) Length = 328 Back     alignment and structure

Iteration: 1

Score = 42.4 bits (98), Expect = 2e-04, Method: Compositional matrix adjust. Identities = 43/152 (28%), Positives = 73/152 (48%), Gaps = 17/152 (11%) Query: 58 FTKMPKLRFLKFYSSSFNGENKCKVSYLQDLGFVEVKYLHWHGYPLKSLPSNLSA-EKLV 116 T++P+ S+ +GE++ V+ LQ L L W G ++SLP++++ + L Sbjct: 163 LTELPE----PLASTDASGEHQGLVN-LQSL------RLEWTG--IRSLPASIANLQNLK 209 Query: 117 LLEVPGSSIEQLWDGVKHYSKLNQIIHVACKKLIAKTPNPTLMPHLNKLVILILRGSKSL 176 L++ S + L + H KL ++ C L P + L LIL+ +L Sbjct: 210 SLKIRNSPLSALGPAIHHLPKLEELDLRGCTALRNYPP---IFGGRAPLKRLILKDCSNL 266 Query: 177 KSLPAEIFNLECLTELDLSDCSKLKRLPEILS 208 +LP +I L L +LDL C L RLP +++ Sbjct: 267 LTLPLDIHRLTQLEKLDLRGCVNLSRLPSLIA 298

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query234
4fcg_A 328 Uncharacterized protein; structural genomics, PSI- 2e-10
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-08
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 8e-08
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 4e-04
4fcg_A 328 Uncharacterized protein; structural genomics, PSI- 7e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-05
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 1e-04
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-04
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 4e-04
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 8e-04
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 3e-04
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 7e-04
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
 Score = 58.4 bits (142), Expect = 2e-10
 Identities = 31/115 (26%), Positives = 46/115 (40%), Gaps = 8/115 (6%)

Query: 94  KYLHWHGYPLKSLPS---NLSAEKLVLLEVPGSSIEQLWDGVKHYSKLNQIIHVACKKLI 150
           +     G  LK+      + +    V LE+    + Q  D     S L Q + +    L+
Sbjct: 59  QIETRTGRALKATADLLEDATQPGRVALELRSVPLPQFPDQAFRLSHL-QHMTIDAAGLM 117

Query: 151 AKTPNPTLMPHLNKLVILILRGSKSLKSLPAEIFNLECLTELDLSDCSKLKRLPE 205
                P  M     L  L L  +  L++LPA I +L  L EL +  C +L  LPE
Sbjct: 118 EL---PDTMQQFAGLETLTLARNP-LRALPASIASLNRLRELSIRACPELTELPE 168


>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query234
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.86
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.83
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.78
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.77
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.77
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.75
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.74
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.74
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.73
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.73
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 99.72
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.72
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.72
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.72
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 99.72
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.72
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.71
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.71
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.7
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.7
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.7
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.7
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.69
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.69
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.69
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.69
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 99.69
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.69
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.69
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.68
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.68
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.68
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.67
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.67
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.67
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.66
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.66
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.66
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.66
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.66
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 99.66
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.65
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 99.65
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.65
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.65
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.65
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.64
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.64
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.64
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.64
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.64
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.64
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 99.63
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.63
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 99.63
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.63
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.63
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 99.63
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.62
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.62
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.62
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 99.62
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.61
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 99.61
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.61
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 99.61
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.61
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.61
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 99.59
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.59
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.59
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.58
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.58
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.58
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 99.58
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.58
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.57
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.57
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.57
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.57
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.56
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.56
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.56
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.56
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.56
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.55
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.55
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.55
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.54
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.54
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.54
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 99.53
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.53
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.52
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 99.52
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.51
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.5
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.5
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.5
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 99.49
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.49
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.49
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.49
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.49
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.48
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.48
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.48
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 99.48
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.48
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.48
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.47
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.47
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.46
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.46
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 99.46
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.46
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.45
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.45
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.43
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.4
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.35
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.31
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.3
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.3
2ca6_A 386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.27
2ca6_A 386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.27
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.27
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.22
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.2
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.14
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.13
3goz_A 362 Leucine-rich repeat-containing protein; LEGL7, NES 99.08
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.03
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 98.94
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 98.91
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 98.9
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 98.9
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 98.86
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 98.76
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 98.66
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 98.64
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 98.57
4fdw_A401 Leucine rich hypothetical protein; putative cell s 98.46
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 98.42
3un9_A 372 NLR family member X1; leucine rich repeat (LRR), a 98.4
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.38
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.35
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.29
4fdw_A401 Leucine rich hypothetical protein; putative cell s 98.27
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.83
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 97.67
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 97.39
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.37
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 97.32
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 97.09
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 96.96
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 96.83
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.73
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 96.59
4gt6_A394 Cell surface protein; leucine rich repeats, putati 96.53
4gt6_A394 Cell surface protein; leucine rich repeats, putati 95.76
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 95.67
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 84.43
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
Probab=99.86  E-value=2.9e-21  Score=161.21  Aligned_cols=161  Identities=21%  Similarity=0.252  Sum_probs=108.1

Q ss_pred             hCCCCCcceEEecCCCCCCCCcccccccCCCCcc-EEEEEeeCCCC-CCCCCCccC----------CCCccEEEecCCcc
Q 036876           58 FTKMPKLRFLKFYSSSFNGENKCKVSYLQDLGFV-EVKYLHWHGYP-LKSLPSNLS----------AEKLVLLEVPGSSI  125 (234)
Q Consensus        58 ~~~l~~L~~L~l~~~~~~~~~~~~~~~~~~l~~l-~L~~L~l~~~~-~~~lp~~~~----------l~~L~~L~l~~~~l  125 (234)
                      +.++++|++|++++|.+.       .+|..+..+ +|++|++++|. .+.+|..+.          +++|++|++++|++
T Consensus       123 ~~~l~~L~~L~Ls~n~l~-------~lp~~l~~l~~L~~L~L~~n~~~~~~p~~~~~~~~~~~~~~l~~L~~L~L~~n~l  195 (328)
T 4fcg_A          123 MQQFAGLETLTLARNPLR-------ALPASIASLNRLRELSIRACPELTELPEPLASTDASGEHQGLVNLQSLRLEWTGI  195 (328)
T ss_dssp             GGGGTTCSEEEEESCCCC-------CCCGGGGGCTTCCEEEEEEETTCCCCCSCSEEEC-CCCEEESTTCCEEEEEEECC
T ss_pred             HhccCCCCEEECCCCccc-------cCcHHHhcCcCCCEEECCCCCCccccChhHhhccchhhhccCCCCCEEECcCCCc
Confidence            444555555555555443       445555555 56666665543 444554331          56666666666666


Q ss_pred             ccccccccCCCCCcEEEcccCcccccCCCC-CCCCCCCCCccEEEecCCCCCCcccccccCCCCCCEEeccCCCCCCcCC
Q 036876          126 EQLWDGVKHYSKLNQIIHVACKKLIAKTPN-PTLMPHLNKLVILILRGSKSLKSLPAEIFNLECLTELDLSDCSKLKRLP  204 (234)
Q Consensus       126 ~~l~~~~~~l~~L~~L~l~~~~~l~~~lp~-~~~l~~L~~l~~L~l~~~~~l~~lp~~~~~l~~L~~L~l~~c~~l~~lp  204 (234)
                      +.+|..++.+++|++|++++|. ++. +|. ++.+++|   +.|++++|+....+|..++++++|++|++++|+.++.+|
T Consensus       196 ~~lp~~l~~l~~L~~L~L~~N~-l~~-l~~~l~~l~~L---~~L~Ls~n~~~~~~p~~~~~l~~L~~L~L~~n~~~~~~p  270 (328)
T 4fcg_A          196 RSLPASIANLQNLKSLKIRNSP-LSA-LGPAIHHLPKL---EELDLRGCTALRNYPPIFGGRAPLKRLILKDCSNLLTLP  270 (328)
T ss_dssp             CCCCGGGGGCTTCCEEEEESSC-CCC-CCGGGGGCTTC---CEEECTTCTTCCBCCCCTTCCCCCCEEECTTCTTCCBCC
T ss_pred             CcchHhhcCCCCCCEEEccCCC-CCc-CchhhccCCCC---CEEECcCCcchhhhHHHhcCCCCCCEEECCCCCchhhcc
Confidence            6677677777777777777776 666 665 6666666   888888877777777778888888888888887888888


Q ss_pred             CcccCCCCCCCcEEecCCCcCC-Chhhhh
Q 036876          205 EILSGIVNDALRIQHIGHLLAV-RWKEML  232 (234)
Q Consensus       205 ~~~~~~~l~~L~~l~l~~c~~l-~~~~~~  232 (234)
                      ..  ++.+++|+.|++++|..+ ..|+.+
T Consensus       271 ~~--~~~l~~L~~L~L~~n~~~~~iP~~l  297 (328)
T 4fcg_A          271 LD--IHRLTQLEKLDLRGCVNLSRLPSLI  297 (328)
T ss_dssp             TT--GGGCTTCCEEECTTCTTCCCCCGGG
T ss_pred             hh--hhcCCCCCEEeCCCCCchhhccHHH
Confidence            77  788888888888888776 355543



>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 234
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 9e-05
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Ngr ectodomain-like
domain: Decorin
species: Cow (Bos taurus) [TaxId: 9913]
 Score = 40.4 bits (93), Expect = 9e-05
 Identities = 29/167 (17%), Positives = 56/167 (33%), Gaps = 9/167 (5%)

Query: 43  LDMSKVKEICLNPNTFTKMPKLRFLKFYSSSFNGENKCKVSYLQDLGFVEVKYLHWHGYP 102
           LD+   K   +    F  +  L  L   ++  +  +    + L  L     + L+     
Sbjct: 36  LDLQNNKITEIKDGDFKNLKNLHTLILINNKISKISPGAFAPLVKL-----ERLYLSKNQ 90

Query: 103 LKSLPSNLSAEKLVLLEVPGSSIEQLWDGVKHYSKLNQIIHVACKKLIAKTPNPTLMPHL 162
           LK LP  +       L V  + I ++   V +      ++ +    L +          +
Sbjct: 91  LKELPEKMPKTL-QELRVHENEITKVRKSVFNGLNQMIVVELGTNPLKSSGIENGAFQGM 149

Query: 163 NKLVILILRGSKSLKSLPAEIFNLECLTELDLSDCSKLKRLPEILSG 209
            KL  + +  +  + ++P  +     LTEL L      K     L G
Sbjct: 150 KKLSYIRIADTN-ITTIPQGLP--PSLTELHLDGNKITKVDAASLKG 193


Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query234
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.75
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.69
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.64
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.64
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.63
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.63
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.61
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.58
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.55
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.55
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.53
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.51
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.49
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.48
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.47
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.46
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.46
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.46
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.45
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.45
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.36
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.32
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.23
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.21
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.17
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.14
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.13
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.09
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.04
d1jl5a_ 353 Leucine rich effector protein YopM {Yersinia pesti 98.97
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.97
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 98.92
d2ca6a1 344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 97.73
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 97.66
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.59
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.46
d1z7xw1 460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 97.41
d1z7xw1 460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 97.34
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 94.3
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 93.68
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 91.79
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 84.89
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Ngr ectodomain-like
domain: von Willebrand factor binding domain of glycoprotein Ib alpha
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.75  E-value=3.2e-17  Score=130.78  Aligned_cols=165  Identities=21%  Similarity=0.204  Sum_probs=134.4

Q ss_pred             EecCCceeeecCchhhCCCCCcceEEecCCCCCCCCcccccccCCCCcc-EEEEEeeCCCCCCCCCCccC-CCCccEEEe
Q 036876           43 LDMSKVKEICLNPNTFTKMPKLRFLKFYSSSFNGENKCKVSYLQDLGFV-EVKYLHWHGYPLKSLPSNLS-AEKLVLLEV  120 (234)
Q Consensus        43 l~~~~~~~~~~~~~~~~~l~~L~~L~l~~~~~~~~~~~~~~~~~~l~~l-~L~~L~l~~~~~~~lp~~~~-l~~L~~L~l  120 (234)
                      ++++.+.-..+.+..|.++++|+.|++++|.++       .++. +..+ +|++|++++|.+...+..+. +++|++|++
T Consensus        36 L~Ls~N~i~~l~~~~f~~l~~L~~L~L~~N~l~-------~l~~-~~~l~~L~~L~Ls~N~l~~~~~~~~~l~~L~~L~l  107 (266)
T d1p9ag_          36 LHLSENLLYTFSLATLMPYTRLTQLNLDRAELT-------KLQV-DGTLPVLGTLDLSHNQLQSLPLLGQTLPALTVLDV  107 (266)
T ss_dssp             EECTTSCCSEEEGGGGTTCTTCCEEECTTSCCC-------EEEC-CSCCTTCCEEECCSSCCSSCCCCTTTCTTCCEEEC
T ss_pred             EECcCCcCCCcCHHHhhcccccccccccccccc-------cccc-ccccccccccccccccccccccccccccccccccc
Confidence            355555434556678999999999999999876       4543 4566 89999999999888888776 899999999


Q ss_pred             cCCcccccccc-ccCCCCCcEEEcccCcccccCCCC--CCCCCCCCCccEEEecCCCCCCccc-ccccCCCCCCEEeccC
Q 036876          121 PGSSIEQLWDG-VKHYSKLNQIIHVACKKLIAKTPN--PTLMPHLNKLVILILRGSKSLKSLP-AEIFNLECLTELDLSD  196 (234)
Q Consensus       121 ~~~~l~~l~~~-~~~l~~L~~L~l~~~~~l~~~lp~--~~~l~~L~~l~~L~l~~~~~l~~lp-~~~~~l~~L~~L~l~~  196 (234)
                      +++.+..++.. +..+.+++++++++|. +.. +|.  +..+.++   +.+++++ +.++.+| ..++.+++|++|++++
T Consensus       108 ~~~~~~~~~~~~~~~l~~l~~L~l~~n~-l~~-l~~~~~~~l~~l---~~l~l~~-N~l~~~~~~~~~~l~~L~~L~Ls~  181 (266)
T d1p9ag_         108 SFNRLTSLPLGALRGLGELQELYLKGNE-LKT-LPPGLLTPTPKL---EKLSLAN-NNLTELPAGLLNGLENLDTLLLQE  181 (266)
T ss_dssp             CSSCCCCCCSSTTTTCTTCCEEECTTSC-CCC-CCTTTTTTCTTC---CEEECTT-SCCSCCCTTTTTTCTTCCEEECCS
T ss_pred             cccccceeeccccccccccccccccccc-cce-eccccccccccc---hhccccc-ccccccCccccccccccceeeccc
Confidence            99988877554 6778999999999997 777 776  5666677   9999999 5677766 4588999999999999


Q ss_pred             CCCCCcCCCcccCCCCCCCcEEecCCCc
Q 036876          197 CSKLKRLPEILSGIVNDALRIQHIGHLL  224 (234)
Q Consensus       197 c~~l~~lp~~~~~~~l~~L~~l~l~~c~  224 (234)
                       +.++++|..  +..+++|+.+++++.+
T Consensus       182 -N~L~~lp~~--~~~~~~L~~L~L~~Np  206 (266)
T d1p9ag_         182 -NSLYTIPKG--FFGSHLLPFAFLHGNP  206 (266)
T ss_dssp             -SCCCCCCTT--TTTTCCCSEEECCSCC
T ss_pred             -CCCcccChh--HCCCCCCCEEEecCCC
Confidence             578999998  8999999999998743



>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure