Citrus Sinensis ID: 036903
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 323 | ||||||
| 255564976 | 944 | TMV resistance protein N, putative [Rici | 0.962 | 0.329 | 0.529 | 9e-84 | |
| 255561520 | 465 | conserved hypothetical protein [Ricinus | 0.959 | 0.666 | 0.529 | 3e-80 | |
| 255537139 | 1137 | leucine-rich repeat-containing protein, | 0.972 | 0.276 | 0.523 | 1e-79 | |
| 224145028 | 709 | nbs-lrr resistance protein [Populus tric | 0.975 | 0.444 | 0.504 | 6e-77 | |
| 255561496 | 876 | TMV resistance protein N, putative [Rici | 0.959 | 0.353 | 0.517 | 7e-77 | |
| 255544956 | 1403 | leucine-rich repeat containing protein, | 0.972 | 0.223 | 0.504 | 1e-76 | |
| 296090597 | 1201 | unnamed protein product [Vitis vinifera] | 0.993 | 0.267 | 0.489 | 1e-76 | |
| 105922468 | 581 | NBS type disease resistance protein [Pop | 0.962 | 0.535 | 0.507 | 3e-76 | |
| 224127917 | 1470 | tir-nbs-lrr resistance protein [Populus | 0.959 | 0.210 | 0.484 | 2e-75 | |
| 255573549 | 908 | ATP binding protein, putative [Ricinus c | 0.987 | 0.351 | 0.495 | 4e-75 |
| >gi|255564976|ref|XP_002523481.1| TMV resistance protein N, putative [Ricinus communis] gi|223537309|gb|EEF38940.1| TMV resistance protein N, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
Score = 316 bits (809), Expect = 9e-84, Method: Compositional matrix adjust.
Identities = 172/325 (52%), Positives = 232/325 (71%), Gaps = 14/325 (4%)
Query: 1 LEYLTGGLDRFGPGSRIIVTTRDKRVLDNFGVPNTNIYKVRGLNYSEALELFCNFAFKQS 60
LE L G + FGPGSRII+T+RDK VL N IYK+ L++ EAL+LF AF+Q
Sbjct: 306 LENLAGEHNWFGPGSRIILTSRDKDVLKN---KTDAIYKIEDLDHHEALQLFSLNAFRQE 362
Query: 61 NCPDGLFT-LSKHIVGYCKGNPLALRVLGSFLHRKSKLDWENALENLKRSSDFEIYDVLK 119
CP + LSK ++ Y KGNPL L+VLGSFL++++ +WE+AL L+RS++ EI +VLK
Sbjct: 363 -CPKADYMKLSKRVINYAKGNPLGLKVLGSFLYQRNIKEWESALHKLERSTNKEIQNVLK 421
Query: 120 ISYNELNPEEKSLFLDIACFFAGEDKNLVTKILDDSNY----VLNVLVDKSLLRISRYNK 175
+SY+ L+ EEK +FLD+ACFF GED++ VT+IL+ + ++VLV KSLL IS N
Sbjct: 422 VSYDGLDDEEKDIFLDVACFFNGEDRDFVTRILNGCGFSADIAISVLVSKSLLTISN-NT 480
Query: 176 LQMHDLLQEMGREIVRQESVKEPGKRSRLWDHEDVYHVLKRNKGTDVIAGIFLDLSKIRD 235
L +H+LLQ+MG IVRQES KEPG+RSRL EDV HVL +N GT+ I GI+LD+SK R
Sbjct: 481 LAIHNLLQQMGWGIVRQESTKEPGRRSRLCTSEDVVHVLSKNTGTEAIEGIYLDMSKSRK 540
Query: 236 IHLGSRAFENMTNLRLLKFYLPNRRGDPI-MSSKVHLDQGLDYLPEELTYLHWHGYPLRT 294
++L +AFE M NLRLLKF+ PI M SKV+L +GL+ LP++L+ LHW+GYPL++
Sbjct: 541 VYLSPKAFERMHNLRLLKFH---HSFSPIAMYSKVYLPEGLESLPDKLSCLHWNGYPLKS 597
Query: 295 LPTNLITDKLVVLNLPCSNVELLWE 319
LP N + LV L++P S+V+ LWE
Sbjct: 598 LPFNFCAEYLVELSMPHSHVKFLWE 622
|
Source: Ricinus communis Species: Ricinus communis Genus: Ricinus Family: Euphorbiaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|255561520|ref|XP_002521770.1| conserved hypothetical protein [Ricinus communis] gi|223538983|gb|EEF40580.1| conserved hypothetical protein [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|255537139|ref|XP_002509636.1| leucine-rich repeat-containing protein, putative [Ricinus communis] gi|223549535|gb|EEF51023.1| leucine-rich repeat-containing protein, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|224145028|ref|XP_002325500.1| nbs-lrr resistance protein [Populus trichocarpa] gi|222862375|gb|EEE99881.1| nbs-lrr resistance protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|255561496|ref|XP_002521758.1| TMV resistance protein N, putative [Ricinus communis] gi|223538971|gb|EEF40568.1| TMV resistance protein N, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|255544956|ref|XP_002513539.1| leucine-rich repeat containing protein, putative [Ricinus communis] gi|223547447|gb|EEF48942.1| leucine-rich repeat containing protein, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|296090597|emb|CBI40966.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|105922468|gb|ABF81418.1| NBS type disease resistance protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|224127917|ref|XP_002329209.1| tir-nbs-lrr resistance protein [Populus trichocarpa] gi|222870990|gb|EEF08121.1| tir-nbs-lrr resistance protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|255573549|ref|XP_002527699.1| ATP binding protein, putative [Ricinus communis] gi|223532930|gb|EEF34698.1| ATP binding protein, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 323 | ||||||
| TAIR|locus:2175991 | 1294 | AT5G17680 [Arabidopsis thalian | 0.934 | 0.233 | 0.455 | 6.5e-68 | |
| TAIR|locus:2146243 | 900 | AT5G18360 [Arabidopsis thalian | 0.941 | 0.337 | 0.423 | 6.2e-62 | |
| TAIR|locus:2118106 | 1219 | AT4G12010 [Arabidopsis thalian | 0.981 | 0.260 | 0.420 | 6.8e-58 | |
| TAIR|locus:2155189 | 980 | AT5G49140 [Arabidopsis thalian | 0.969 | 0.319 | 0.416 | 4e-55 | |
| TAIR|locus:2162439 | 1008 | AT5G22690 [Arabidopsis thalian | 0.934 | 0.299 | 0.416 | 1.6e-54 | |
| TAIR|locus:2136108 | 1095 | AT4G11170 [Arabidopsis thalian | 0.941 | 0.277 | 0.406 | 5.9e-54 | |
| TAIR|locus:2174900 | 968 | AT5G40060 [Arabidopsis thalian | 0.965 | 0.322 | 0.404 | 7.6e-54 | |
| TAIR|locus:2161513 | 780 | AT5G17970 [Arabidopsis thalian | 0.934 | 0.387 | 0.389 | 9.4e-54 | |
| TAIR|locus:2173293 | 1059 | AT5G38340 [Arabidopsis thalian | 0.938 | 0.286 | 0.411 | 3.9e-53 | |
| TAIR|locus:2039405 | 1109 | AT2G16870 [Arabidopsis thalian | 0.956 | 0.278 | 0.386 | 7.4e-53 |
| TAIR|locus:2175991 AT5G17680 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 699 (251.1 bits), Expect = 6.5e-68, P = 6.5e-68
Identities = 143/314 (45%), Positives = 210/314 (66%)
Query: 11 FGPGSRIIVTTRDKRVLDNFGVPNTNIYKVRGLNYSEALELFCNFAFKQSNC-PDGLFTL 69
FGPGSRIIVTTRD+ +L + G+ N +YKV+ L EAL+LFCN+AF++ P G L
Sbjct: 313 FGPGSRIIVTTRDRHLLLSHGI-NL-VYKVKCLPKKEALQLFCNYAFREEIILPHGFEEL 370
Query: 70 SKHIVGYCKGNPLALRVLGSFLHRKSKLDWENALENLKRSSDFEIYDVLKISYNELNPEE 129
S V Y G PLALRVLGSFL+R+S+++WE+ L LK +I +VL++SY+ L+ +E
Sbjct: 371 SVQAVNYASGLPLALRVLGSFLYRRSQIEWESTLARLKTYPHSDIMEVLRVSYDGLDEQE 430
Query: 130 KSLFLDIACFFAGEDKNLVTKILDDSNYV----LNVLVDKSLLRISRYNKLQMHDLLQEM 185
K++FL I+CF+ + + V K+LD Y + +L +KSL+ + +++HDLL++M
Sbjct: 431 KAIFLYISCFYNMKQVDYVRKLLDLCGYAAEIGITILTEKSLI-VESNGCVKIHDLLEQM 489
Query: 186 GREIVRQESVKEPGKRSRLWDHEDVYHVLKRNKGTDVIAGIFLDLSKIRDIHLGSRAFEN 245
GRE+VRQ++V P +R LWD ED+ H+L N GT ++ GI L+LS+I ++ RAFE
Sbjct: 490 GRELVRQQAVNNPAQRLLLWDPEDICHLLSENSGTQLVEGISLNLSEISEVFASDRAFEG 549
Query: 246 MTNLRLLKFYLPNRRGDPIMSSKVHLDQGLDYLPEELTYLHWHGYPLRTLPTNLITDKLV 305
++NL+LL FY + G+ ++VHL GL YLP +L YL W GYPL+T+P+ + LV
Sbjct: 550 LSNLKLLNFYDLSFDGE----TRVHLPNGLSYLPRKLRYLRWDGYPLKTMPSRFFPEFLV 605
Query: 306 VLNLPCSNVELLWE 319
L + SN+E LW+
Sbjct: 606 ELCMSNSNLEKLWD 619
|
|
| TAIR|locus:2146243 AT5G18360 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2118106 AT4G12010 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2155189 AT5G49140 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2162439 AT5G22690 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2136108 AT4G11170 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2174900 AT5G40060 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2161513 AT5G17970 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2173293 AT5G38340 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2039405 AT2G16870 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| GSVIVG00021873001 | SubName- Full=Chromosome chr18 scaffold_24, whole genome shotgun sequence; (890 aa) | |||||||
(Vitis vinifera) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 323 | |||
| PLN03210 | 1153 | PLN03210, PLN03210, Resistant to P | 1e-72 | |
| pfam00931 | 285 | pfam00931, NB-ARC, NB-ARC domain | 3e-29 |
| >gnl|CDD|215633 PLN03210, PLN03210, Resistant to P | Back alignment and domain information |
|---|
Score = 242 bits (620), Expect = 1e-72
Identities = 137/325 (42%), Positives = 195/325 (60%), Gaps = 13/325 (4%)
Query: 1 LEYLTGGLDRFGPGSRIIVTTRDKRVLDNFGVPNTNIYKVRGLNYSEALELFCNFAFKQS 60
L+ L G FG GSRIIV T+DK L G+ +IY+V + ALE+FC AFK++
Sbjct: 311 LDALAGQTQWFGSGSRIIVITKDKHFLRAHGI--DHIYEVCLPSNELALEMFCRSAFKKN 368
Query: 61 NCPDGLFTLSKHIVGYCKGN-PLALRVLGSFLHRKSKLDWENALENLKRSSDFEIYDVLK 119
+ PDG L+ V GN PL L VLGS+L + K DW + L L+ D +I L+
Sbjct: 369 SPPDGFMELASE-VALRAGNLPLGLNVLGSYLRGRDKEDWMDMLPRLRNGLDGKIEKTLR 427
Query: 120 ISYNELN-PEEKSLFLDIACFFAGEDKNLVTKILDDSNYVLNV----LVDKSLLRISRYN 174
+SY+ LN ++K++F IAC F GE N + +L +S+ +N+ LVDKSL+ + R +
Sbjct: 428 VSYDGLNNKKDKAIFRHIACLFNGEKVNDIKLLLANSDLDVNIGLKNLVDKSLIHV-RED 486
Query: 175 KLQMHDLLQEMGREIVRQESVKEPGKRSRLWDHEDVYHVLKRNKGTDVIAGIFLDLSKIR 234
++MH LLQEMG+EIVR +S EPG+R L D +D+ VL+ N GT + GI LD+ +I
Sbjct: 487 IVEMHSLLQEMGKEIVRAQS-NEPGEREFLVDAKDICDVLEDNTGTKKVLGITLDIDEID 545
Query: 235 DIHLGSRAFENMTNLRLLKFYLPNRRGDPIMSSKVHLDQGLDYLPEELTYLHWHGYPLRT 294
++H+ AF+ M NL LKFY ++ D + HL +G DYLP +L L W YPLR
Sbjct: 546 ELHIHENAFKGMRNLLFLKFY--TKKWDQKKEVRWHLPEGFDYLPPKLRLLRWDKYPLRC 603
Query: 295 LPTNLITDKLVVLNLPCSNVELLWE 319
+P+N + LV L + S +E LW+
Sbjct: 604 MPSNFRPENLVKLQMQGSKLEKLWD 628
|
syringae 6; Provisional. Length = 1153 |
| >gnl|CDD|216202 pfam00931, NB-ARC, NB-ARC domain | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 323 | |||
| KOG4658 | 889 | consensus Apoptotic ATPase [Signal transduction me | 100.0 | |
| PLN03210 | 1153 | Resistant to P. syringae 6; Provisional | 100.0 | |
| PF00931 | 287 | NB-ARC: NB-ARC domain; InterPro: IPR002182 This is | 99.93 | |
| KOG0617 | 264 | consensus Ras suppressor protein (contains leucine | 98.65 | |
| PF13855 | 61 | LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF | 98.5 | |
| PF12799 | 44 | LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ | 98.36 | |
| PRK04841 | 903 | transcriptional regulator MalT; Provisional | 98.32 | |
| KOG0617 | 264 | consensus Ras suppressor protein (contains leucine | 98.22 | |
| KOG0444 | 1255 | consensus Cytoskeletal regulator Flightless-I (con | 98.15 | |
| PLN03150 | 623 | hypothetical protein; Provisional | 98.11 | |
| PF12799 | 44 | LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ | 98.06 | |
| KOG4658 | 889 | consensus Apoptotic ATPase [Signal transduction me | 97.98 | |
| KOG0472 | 565 | consensus Leucine-rich repeat protein [Function un | 97.85 | |
| KOG0444 | 1255 | consensus Cytoskeletal regulator Flightless-I (con | 97.8 | |
| PLN00113 | 968 | leucine-rich repeat receptor-like protein kinase; | 97.8 | |
| PF14580 | 175 | LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ | 97.76 | |
| PLN00113 | 968 | leucine-rich repeat receptor-like protein kinase; | 97.68 | |
| PF13855 | 61 | LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF | 97.67 | |
| PF14580 | 175 | LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ | 97.49 | |
| PLN03210 | 1153 | Resistant to P. syringae 6; Provisional | 97.49 | |
| KOG0472 | 565 | consensus Leucine-rich repeat protein [Function un | 97.43 | |
| PLN03150 | 623 | hypothetical protein; Provisional | 97.25 | |
| KOG0618 | 1081 | consensus Serine/threonine phosphatase 2C containi | 97.17 | |
| PRK15370 | 754 | E3 ubiquitin-protein ligase SlrP; Provisional | 97.03 | |
| PRK15370 | 754 | E3 ubiquitin-protein ligase SlrP; Provisional | 96.94 | |
| PRK15386 | 426 | type III secretion protein GogB; Provisional | 96.88 | |
| KOG1259 | 490 | consensus Nischarin, modulator of integrin alpha5 | 96.82 | |
| PF00560 | 22 | LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le | 96.74 | |
| KOG0532 | 722 | consensus Leucine-rich repeat (LRR) protein, conta | 96.73 | |
| KOG0618 | 1081 | consensus Serine/threonine phosphatase 2C containi | 96.72 | |
| PRK15387 | 788 | E3 ubiquitin-protein ligase SspH2; Provisional | 96.66 | |
| KOG0532 | 722 | consensus Leucine-rich repeat (LRR) protein, conta | 96.63 | |
| COG4886 | 394 | Leucine-rich repeat (LRR) protein [Function unknow | 96.56 | |
| PF13504 | 17 | LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO | 96.5 | |
| KOG4194 | 873 | consensus Membrane glycoprotein LIG-1 [Signal tran | 96.5 | |
| TIGR00635 | 305 | ruvB Holliday junction DNA helicase, RuvB subunit. | 96.44 | |
| KOG4237 | 498 | consensus Extracellular matrix protein slit, conta | 96.39 | |
| PF00560 | 22 | LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le | 96.39 | |
| PRK15387 | 788 | E3 ubiquitin-protein ligase SspH2; Provisional | 96.34 | |
| COG4886 | 394 | Leucine-rich repeat (LRR) protein [Function unknow | 96.33 | |
| KOG4237 | 498 | consensus Extracellular matrix protein slit, conta | 96.33 | |
| KOG1259 | 490 | consensus Nischarin, modulator of integrin alpha5 | 96.27 | |
| PRK00080 | 328 | ruvB Holliday junction DNA helicase RuvB; Reviewed | 96.22 | |
| KOG3665 | 699 | consensus ZYG-1-like serine/threonine protein kina | 96.11 | |
| KOG4579 | 177 | consensus Leucine-rich repeat (LRR) protein associ | 96.09 | |
| KOG0531 | 414 | consensus Protein phosphatase 1, regulatory subuni | 95.98 | |
| KOG3665 | 699 | consensus ZYG-1-like serine/threonine protein kina | 95.93 | |
| KOG2739 | 260 | consensus Leucine-rich acidic nuclear protein [Cel | 95.82 | |
| PF13504 | 17 | LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO | 95.81 | |
| cd00116 | 319 | LRR_RI Leucine-rich repeats (LRRs), ribonuclease i | 95.8 | |
| KOG4194 | 873 | consensus Membrane glycoprotein LIG-1 [Signal tran | 95.78 | |
| smart00370 | 26 | LRR Leucine-rich repeats, outliers. | 95.58 | |
| smart00369 | 26 | LRR_TYP Leucine-rich repeats, typical (most popula | 95.58 | |
| PF07725 | 20 | LRR_3: Leucine Rich Repeat; InterPro: IPR011713 Le | 95.34 | |
| KOG0531 | 414 | consensus Protein phosphatase 1, regulatory subuni | 95.19 | |
| KOG4579 | 177 | consensus Leucine-rich repeat (LRR) protein associ | 95.18 | |
| PRK15386 | 426 | type III secretion protein GogB; Provisional | 95.02 | |
| COG2909 | 894 | MalT ATP-dependent transcriptional regulator [Tran | 94.94 | |
| cd00116 | 319 | LRR_RI Leucine-rich repeats (LRRs), ribonuclease i | 94.66 | |
| KOG3207 | 505 | consensus Beta-tubulin folding cofactor E [Posttra | 94.52 | |
| KOG1644 | 233 | consensus U2-associated snRNP A' protein [RNA proc | 94.5 | |
| KOG3207 | 505 | consensus Beta-tubulin folding cofactor E [Posttra | 93.93 | |
| KOG1859 | 1096 | consensus Leucine-rich repeat proteins [General fu | 93.72 | |
| smart00370 | 26 | LRR Leucine-rich repeats, outliers. | 93.59 | |
| smart00369 | 26 | LRR_TYP Leucine-rich repeats, typical (most popula | 93.59 | |
| COG3903 | 414 | Predicted ATPase [General function prediction only | 93.27 | |
| PRK06893 | 229 | DNA replication initiation factor; Validated | 91.82 | |
| KOG2982 | 418 | consensus Uncharacterized conserved protein [Funct | 90.85 | |
| KOG1909 | 382 | consensus Ran GTPase-activating protein [RNA proce | 90.25 | |
| KOG1859 | 1096 | consensus Leucine-rich repeat proteins [General fu | 90.18 | |
| smart00364 | 26 | LRR_BAC Leucine-rich repeats, bacterial type. | 90.15 | |
| KOG1644 | 233 | consensus U2-associated snRNP A' protein [RNA proc | 90.02 | |
| COG3899 | 849 | Predicted ATPase [General function prediction only | 88.92 | |
| KOG2739 | 260 | consensus Leucine-rich acidic nuclear protein [Cel | 88.83 | |
| KOG2982 | 418 | consensus Uncharacterized conserved protein [Funct | 88.41 | |
| KOG0473 | 326 | consensus Leucine-rich repeat protein [Function un | 88.36 | |
| KOG0473 | 326 | consensus Leucine-rich repeat protein [Function un | 88.19 | |
| KOG1909 | 382 | consensus Ran GTPase-activating protein [RNA proce | 87.57 | |
| PF05729 | 166 | NACHT: NACHT domain | 86.33 | |
| PRK09087 | 226 | hypothetical protein; Validated | 84.62 | |
| PF01637 | 234 | Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 | 84.42 | |
| smart00365 | 26 | LRR_SD22 Leucine-rich repeat, SDS22-like subfamily | 83.8 | |
| TIGR03015 | 269 | pepcterm_ATPase putative secretion ATPase, PEP-CTE | 83.13 | |
| PF13516 | 24 | LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI | 82.36 | |
| PRK00411 | 394 | cdc6 cell division control protein 6; Reviewed | 80.33 |
| >KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
Probab=100.00 E-value=4.3e-51 Score=405.77 Aligned_cols=303 Identities=26% Similarity=0.324 Sum_probs=252.4
Q ss_pred CcchhcCCCCCCCCceEEEEcCChhhHhh-cCCCCcceEEcCCCCHHhHHHHHHHhhhcC-CCCCCChHHHHHHHHHHhc
Q 036903 1 LEYLTGGLDRFGPGSRIIVTTRDKRVLDN-FGVPNTNIYKVRGLNYSEALELFCNFAFKQ-SNCPDGLFTLSKHIVGYCK 78 (323)
Q Consensus 1 le~l~~~~~~~~~gs~IlvTTR~~~v~~~-~~~~~~~~~~l~~L~~~~~~~Lf~~~~~~~-~~~~~~~~~~~~~i~~~c~ 78 (323)
++.+..+++...+||+|++|||++.|+.. ++ +...++++.|+++|||+||++.+|.. ....+.++++|++++++|+
T Consensus 276 w~~I~~~~p~~~~g~KvvlTTRs~~V~~~~m~--~~~~~~v~~L~~~eaW~LF~~~v~~~~~~~~~~i~~lak~v~~kC~ 353 (889)
T KOG4658|consen 276 WDKIGVPFPSRENGSKVVLTTRSEEVCGRAMG--VDYPIEVECLTPEEAWDLFQKKVGPNTLGSHPDIEELAKEVAEKCG 353 (889)
T ss_pred HHhcCCCCCCccCCeEEEEEeccHhhhhcccc--CCccccccccCccccHHHHHHhhccccccccccHHHHHHHHHHHhC
Confidence 35688899999999999999999999998 76 68899999999999999999999876 4455669999999999999
Q ss_pred CCchhHHHHhhhhcCC-ChHHHHHHHHHhhcC-------CcccHHHHHHHHhcCCChhhHhHhhhhcccCCC--CCHHHH
Q 036903 79 GNPLALRVLGSFLHRK-SKLDWENALENLKRS-------SDFEIYDVLKISYNELNPEEKSLFLDIACFFAG--EDKNLV 148 (323)
Q Consensus 79 GlPLAi~~ig~~L~~~-~~~~w~~~l~~l~~~-------~~~~i~~~l~~sy~~L~~~~k~cfl~~s~fp~~--~~~~~l 148 (323)
|+|||++++|+.|+.+ +..+|+++.+.+.+. ..+.+.+++++|||.||++.|.||+|||+||+| ++++.|
T Consensus 354 GLPLAl~viG~~ma~K~t~~eW~~~~~~l~s~~~~~~~~~~~~i~~iLklSyd~L~~~lK~CFLycalFPED~~I~~e~L 433 (889)
T KOG4658|consen 354 GLPLALNVLGGLLACKKTVQEWRRALNVLKSSLAADFSGMEESILPILKLSYDNLPEELKSCFLYCALFPEDYEIKKEKL 433 (889)
T ss_pred ChHHHHHHHHHHhcCCCcHHHHHHHHccccccccCCCCchhhhhHHhhhccHhhhhHHHHHHHHhhccCCcccccchHHH
Confidence 9999999999999998 778999999987654 246799999999999998899999999999999 556779
Q ss_pred HHHHhhcch----------------HHHHhhhCCcceEcCC----CeEEecHHHHHHHHHHHhhhccCCC----------
Q 036903 149 TKILDDSNY----------------VLNVLVDKSLLRISRY----NKLQMHDLLQEMGREIVRQESVKEP---------- 198 (323)
Q Consensus 149 ~~~w~~~g~----------------~l~~L~~~~ll~~~~~----~~~~mh~lv~~~~~~~~~~~~~~~~---------- 198 (323)
+.+|+|||| |+++|++++|++.... ..|+|||+|||+|.+++.+.+....
T Consensus 434 i~yWiaEGfi~~~~~~~~~~d~G~~~i~~LV~~~Ll~~~~~~~~~~~~kmHDvvRe~al~ias~~~~~~e~~iv~~~~~~ 513 (889)
T KOG4658|consen 434 IEYWIAEGFIDPLDGGETAEDVGYDYIEELVRASLLIEERDEGRKETVKMHDVVREMALWIASDFGKQEENQIVSDGVGL 513 (889)
T ss_pred HHHHHhccCcCccccccchhcchHHHHHHHHHHHHHhhcccccceeEEEeeHHHHHHHHHHhccccccccceEEECCcCc
Confidence 999999997 9999999999998642 5799999999999999993322111
Q ss_pred ---------CCeeecccchhhHHHhhcCcccceeEEEEeecCCccccccCchhhhCCCCceEEEEeCCCCCCCCCCCccc
Q 036903 199 ---------GKRSRLWDHEDVYHVLKRNKGTDVIAGIFLDLSKIRDIHLGSRAFENMTNLRLLKFYLPNRRGDPIMSSKV 269 (323)
Q Consensus 199 ---------~~~~~l~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~l~~~~~~~~~~~~LrvL~L~~~~~~~~~~~~~~~ 269 (323)
...+++..+..............+++++.+..+......+...+|..|+.||||||++|.- ..
T Consensus 514 ~~~~~~~~~~~~rr~s~~~~~~~~~~~~~~~~~L~tLll~~n~~~l~~is~~ff~~m~~LrVLDLs~~~~--------l~ 585 (889)
T KOG4658|consen 514 SEIPQVKSWNSVRRMSLMNNKIEHIAGSSENPKLRTLLLQRNSDWLLEISGEFFRSLPLLRVLDLSGNSS--------LS 585 (889)
T ss_pred cccccccchhheeEEEEeccchhhccCCCCCCccceEEEeecchhhhhcCHHHHhhCcceEEEECCCCCc--------cC
Confidence 1112222222323333334444467777666553224667788899999999999998763 48
Q ss_pred ccCCCccCcCCCceeEEecCCCCCCCCCCCC-CCCceEEEcCCCcc
Q 036903 270 HLDQGLDYLPEELTYLHWHGYPLRTLPTNLI-TDKLVVLNLPCSNV 314 (323)
Q Consensus 270 ~lp~~i~~L~~~Lr~L~l~~~~i~~LP~~i~-L~~L~~L~l~~~~i 314 (323)
+||++|+.|. +||||+++++.+.+||.+++ |+.|++||+..+.-
T Consensus 586 ~LP~~I~~Li-~LryL~L~~t~I~~LP~~l~~Lk~L~~Lnl~~~~~ 630 (889)
T KOG4658|consen 586 KLPSSIGELV-HLRYLDLSDTGISHLPSGLGNLKKLIYLNLEVTGR 630 (889)
T ss_pred cCChHHhhhh-hhhcccccCCCccccchHHHHHHhhheeccccccc
Confidence 8999999999 99999999999999999998 99999999998853
|
|
| >PLN03210 Resistant to P | Back alignment and domain information |
|---|
| >PF00931 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is the NB-ARC domain, a novel signalling motif found in bacteria and eukaryotes, shared by plant resistance gene products and regulators of cell death in animals [] | Back alignment and domain information |
|---|
| >KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A | Back alignment and domain information |
|---|
| >PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B | Back alignment and domain information |
|---|
| >PRK04841 transcriptional regulator MalT; Provisional | Back alignment and domain information |
|---|
| >KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] | Back alignment and domain information |
|---|
| >PLN03150 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B | Back alignment and domain information |
|---|
| >KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0472 consensus Leucine-rich repeat protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] | Back alignment and domain information |
|---|
| >PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A | Back alignment and domain information |
|---|
| >PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A | Back alignment and domain information |
|---|
| >PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A | Back alignment and domain information |
|---|
| >PLN03210 Resistant to P | Back alignment and domain information |
|---|
| >KOG0472 consensus Leucine-rich repeat protein [Function unknown] | Back alignment and domain information |
|---|
| >PLN03150 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional | Back alignment and domain information |
|---|
| >PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional | Back alignment and domain information |
|---|
| >PRK15386 type III secretion protein GogB; Provisional | Back alignment and domain information |
|---|
| >KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] | Back alignment and domain information |
|---|
| >KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional | Back alignment and domain information |
|---|
| >KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] | Back alignment and domain information |
|---|
| >COG4886 Leucine-rich repeat (LRR) protein [Function unknown] | Back alignment and domain information |
|---|
| >PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D | Back alignment and domain information |
|---|
| >KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit | Back alignment and domain information |
|---|
| >KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] | Back alignment and domain information |
|---|
| >PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional | Back alignment and domain information |
|---|
| >COG4886 Leucine-rich repeat (LRR) protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed | Back alignment and domain information |
|---|
| >KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] | Back alignment and domain information |
|---|
| >PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D | Back alignment and domain information |
|---|
| >cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily | Back alignment and domain information |
|---|
| >KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >smart00370 LRR Leucine-rich repeats, outliers | Back alignment and domain information |
|---|
| >smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily | Back alignment and domain information |
|---|
| >PF07725 LRR_3: Leucine Rich Repeat; InterPro: IPR011713 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] | Back alignment and domain information |
|---|
| >KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] | Back alignment and domain information |
|---|
| >PRK15386 type III secretion protein GogB; Provisional | Back alignment and domain information |
|---|
| >COG2909 MalT ATP-dependent transcriptional regulator [Transcription] | Back alignment and domain information |
|---|
| >cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily | Back alignment and domain information |
|---|
| >KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] | Back alignment and domain information |
|---|
| >smart00370 LRR Leucine-rich repeats, outliers | Back alignment and domain information |
|---|
| >smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily | Back alignment and domain information |
|---|
| >COG3903 Predicted ATPase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK06893 DNA replication initiation factor; Validated | Back alignment and domain information |
|---|
| >KOG2982 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] | Back alignment and domain information |
|---|
| >smart00364 LRR_BAC Leucine-rich repeats, bacterial type | Back alignment and domain information |
|---|
| >KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] | Back alignment and domain information |
|---|
| >COG3899 Predicted ATPase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] | Back alignment and domain information |
|---|
| >KOG2982 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0473 consensus Leucine-rich repeat protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0473 consensus Leucine-rich repeat protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF05729 NACHT: NACHT domain | Back alignment and domain information |
|---|
| >PRK09087 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PF01637 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 This domain has been found in a number of bacterial and archaeal proteins, all of which contain a conserved P-loop motif that is involved in binding ATP | Back alignment and domain information |
|---|
| >smart00365 LRR_SD22 Leucine-rich repeat, SDS22-like subfamily | Back alignment and domain information |
|---|
| >TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily | Back alignment and domain information |
|---|
| >PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A | Back alignment and domain information |
|---|
| >PRK00411 cdc6 cell division control protein 6; Reviewed | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 323 | ||||
| 1z6t_A | 591 | Structure Of The Apoptotic Protease-activating Fact | 6e-07 | ||
| 3iza_B | 1263 | Structure Of An Apoptosome-Procaspase-9 Card Comple | 1e-06 | ||
| 3sfz_A | 1249 | Crystal Structure Of Full-Length Murine Apaf-1 Leng | 2e-06 | ||
| 3shf_A | 1256 | Crystal Structure Of The R265s Mutant Of Full-Lengt | 1e-05 |
| >pdb|1Z6T|A Chain A, Structure Of The Apoptotic Protease-activating Factor 1 Bound To Adp Length = 591 | Back alignment and structure |
|
| >pdb|3SFZ|A Chain A, Crystal Structure Of Full-Length Murine Apaf-1 Length = 1249 | Back alignment and structure |
| >pdb|3SHF|A Chain A, Crystal Structure Of The R265s Mutant Of Full-Length Murine Apaf-1 Length = 1256 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 323 | |||
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 2e-37 | |
| 2a5y_B | 549 | CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis | 4e-32 | |
| 1z6t_A | 591 | APAF-1, apoptotic protease activating factor 1; ca | 2e-31 | |
| 3sfz_A | 1249 | APAF-1, apoptotic peptidase activating factor 1; a | 4e-16 |
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
Score = 141 bits (356), Expect = 2e-37
Identities = 63/339 (18%), Positives = 116/339 (34%), Gaps = 77/339 (22%)
Query: 8 LDRFGPGSRIIVTTRDKRVLDNFGVPNTNIYKV----RGLNYSEALELFCNFAFKQSNCP 63
+ F +I++TTR K+V D T + L E L + +C
Sbjct: 259 WNAFNLSCKILLTTRFKQVTDFLSAATTTHISLDHHSMTLTPDEVKSLLLKYL----DCR 314
Query: 64 DGLFTLSKHIVGYCKGNPLALRVLGSFLHRKSKLDWENALENLKRSSDFEIYDVLKISYN 123
L + + NP L ++ + D +N K + ++ +++ S N
Sbjct: 315 --PQDLPREV---LTTNPRRLSIIAESIR-----DGLATWDNWKHVNCDKLTTIIESSLN 364
Query: 124 ELNPEE-KSLFLDIACFFAGEDKNLVTKIL---------DDSNYVLNVLVDKSLL-RISR 172
L P E + +F ++ F ++ T +L D V+N L SL+ + +
Sbjct: 365 VLEPAEYRKMFDRLSVF--PPSAHIPTILLSLIWFDVIKSDVMVVVNKLHKYSLVEKQPK 422
Query: 173 YNKLQMHDL----------LQEMGREIVRQESVKEPGKRSRLWD----HED-------VY 211
+ + + + + R IV ++ K D + D +
Sbjct: 423 ESTISIPSIYLELKVKLENEYALHRSIVDHYNIP---KTFDSDDLIPPYLDQYFYSHIGH 479
Query: 212 HVLKRNKG--TDVIAGIFLDLS----KIRDIHLGSRAFENMTN-LRLLKFYLPNRRGDPI 264
H+ + +FLD KIR A ++ N L+ LKFY P I
Sbjct: 480 HLKNIEHPERMTLFRMVFLDFRFLEQKIRHDSTAWNASGSILNTLQQLKFYKPY-----I 534
Query: 265 MSSKVHLDQGLDYLPEELTYLHWHGYPLRTLPTNLITDK 303
+ ++ ++ + L +L NLI K
Sbjct: 535 CDNDPKYERLVNAI---LDFLPKIE-------ENLICSK 563
|
| >2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Length = 549 | Back alignment and structure |
|---|
| >1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Length = 591 | Back alignment and structure |
|---|
| >3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Length = 1249 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 323 | |||
| 2a5y_B | 549 | CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis | 99.96 | |
| 3sfz_A | 1249 | APAF-1, apoptotic peptidase activating factor 1; a | 99.93 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 99.88 | |
| 1z6t_A | 591 | APAF-1, apoptotic protease activating factor 1; ca | 99.88 | |
| 2r9u_A | 174 | Variable lymphocyte receptor; adaptive immunity, V | 98.76 | |
| 3e6j_A | 229 | Variable lymphocyte receptor diversity region; var | 98.69 | |
| 3e6j_A | 229 | Variable lymphocyte receptor diversity region; var | 98.68 | |
| 2wfh_A | 193 | SLIT homolog 2 protein C-product; developmental pr | 98.64 | |
| 2v9t_B | 220 | SLIT homolog 2 protein N-product; structural prote | 98.63 | |
| 4b8c_D | 727 | Glucose-repressible alcohol dehydrogenase transcr | 98.63 | |
| 3g39_A | 170 | Variable lymphocyte receptor VLRB.2D; antibody, X- | 98.63 | |
| 2v9t_B | 220 | SLIT homolog 2 protein N-product; structural prote | 98.61 | |
| 2o6r_A | 177 | Variable lymphocyte receptor B; leucine-rich repea | 98.61 | |
| 2ell_A | 168 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 98.59 | |
| 1a9n_A | 176 | U2A', U2A'; complex (nuclear protein/RNA), RNA, sn | 98.59 | |
| 2r9u_A | 174 | Variable lymphocyte receptor; adaptive immunity, V | 98.59 | |
| 2ell_A | 168 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 98.58 | |
| 2v70_A | 220 | SLIT-2, SLIT homolog 2 protein N-product; neurogen | 98.58 | |
| 2je0_A | 149 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 98.55 | |
| 2o6s_A | 208 | Variable lymphocyte receptor B; leucine-rich repea | 98.54 | |
| 4b8c_D | 727 | Glucose-repressible alcohol dehydrogenase transcr | 98.53 | |
| 1w8a_A | 192 | SLIT protein; signaling protein, secreted protein, | 98.51 | |
| 3m19_A | 251 | Variable lymphocyte receptor A diversity region; a | 98.51 | |
| 2o6s_A | 208 | Variable lymphocyte receptor B; leucine-rich repea | 98.51 | |
| 1a9n_A | 176 | U2A', U2A'; complex (nuclear protein/RNA), RNA, sn | 98.5 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 98.5 | |
| 3g39_A | 170 | Variable lymphocyte receptor VLRB.2D; antibody, X- | 98.5 | |
| 3m19_A | 251 | Variable lymphocyte receptor A diversity region; a | 98.49 | |
| 1dce_A | 567 | Protein (RAB geranylgeranyltransferase alpha subun | 98.49 | |
| 2je0_A | 149 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 98.48 | |
| 4g8a_A | 635 | TOLL-like receptor 4; leucine rich repeat MD-2 rel | 98.48 | |
| 1p9a_G | 290 | Platelet glycoprotein IB alpha chain precursor; pl | 98.46 | |
| 1dce_A | 567 | Protein (RAB geranylgeranyltransferase alpha subun | 98.45 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 98.44 | |
| 1ogq_A | 313 | PGIP-2, polygalacturonase inhibiting protein; inhi | 98.42 | |
| 1p9a_G | 290 | Platelet glycoprotein IB alpha chain precursor; pl | 98.42 | |
| 2o6q_A | 270 | Variable lymphocyte receptor A; leucine-rich repea | 98.41 | |
| 1xku_A | 330 | Decorin; proteoglycan, leucine-rich repeat, struct | 98.41 | |
| 2xot_A | 361 | Amphoterin-induced protein 1; cell adhesion, neuro | 98.4 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 98.37 | |
| 3rfs_A | 272 | Internalin B, repeat modules, variable lymphocyte | 98.37 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 98.37 | |
| 2o6q_A | 270 | Variable lymphocyte receptor A; leucine-rich repea | 98.36 | |
| 2v70_A | 220 | SLIT-2, SLIT homolog 2 protein N-product; neurogen | 98.36 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 98.36 | |
| 1w8a_A | 192 | SLIT protein; signaling protein, secreted protein, | 98.35 | |
| 2wfh_A | 193 | SLIT homolog 2 protein C-product; developmental pr | 98.34 | |
| 2ifg_A | 347 | High affinity nerve growth factor receptor; TRK, T | 98.34 | |
| 3a79_B | 562 | TLR6, VLRB.59, TOLL-like receptor 6, variable lymp | 98.33 | |
| 2xot_A | 361 | Amphoterin-induced protein 1; cell adhesion, neuro | 98.32 | |
| 1ogq_A | 313 | PGIP-2, polygalacturonase inhibiting protein; inhi | 98.31 | |
| 2o6r_A | 177 | Variable lymphocyte receptor B; leucine-rich repea | 98.31 | |
| 3zyi_A | 452 | Leucine-rich repeat-containing protein 4; cell adh | 98.31 | |
| 2z7x_B | 520 | TOLL-like receptor 1, variable lymphocyte recepto; | 98.31 | |
| 3rfs_A | 272 | Internalin B, repeat modules, variable lymphocyte | 98.3 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 98.29 | |
| 2z80_A | 353 | TOLL-like receptor 2, variable lymphocyte recepto; | 98.29 | |
| 2ft3_A | 332 | Biglycan; proteoglycan, dimer interface, structura | 98.29 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 98.29 | |
| 2ft3_A | 332 | Biglycan; proteoglycan, dimer interface, structura | 98.28 | |
| 1ozn_A | 285 | Reticulon 4 receptor; NOGO receptor, MAD, myelinat | 98.28 | |
| 1ozn_A | 285 | Reticulon 4 receptor; NOGO receptor, MAD, myelinat | 98.27 | |
| 4g8a_A | 635 | TOLL-like receptor 4; leucine rich repeat MD-2 rel | 98.27 | |
| 2z62_A | 276 | TOLL-like receptor 4, variable lymphocyte recepto; | 98.26 | |
| 2z62_A | 276 | TOLL-like receptor 4, variable lymphocyte recepto; | 98.24 | |
| 3zyj_A | 440 | Leucine-rich repeat-containing protein 4C; cell ad | 98.24 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 98.23 | |
| 1xku_A | 330 | Decorin; proteoglycan, leucine-rich repeat, struct | 98.23 | |
| 4ezg_A | 197 | Putative uncharacterized protein; internalin-A, le | 98.22 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 98.22 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 98.22 | |
| 3v47_A | 455 | TOLL-like receptor 5B and variable lymphocyte REC | 98.21 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 98.18 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 98.17 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 98.17 | |
| 2z66_A | 306 | Variable lymphocyte receptor B, TOLL-like recepto; | 98.17 | |
| 2xwt_C | 239 | Thyrotropin receptor; signaling protein-immune sys | 98.15 | |
| 1xeu_A | 263 | Internalin C; cellular invasion, leucine-rich repe | 98.15 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 98.15 | |
| 1wwl_A | 312 | Monocyte differentiation antigen CD14; LPS, immune | 98.15 | |
| 1xeu_A | 263 | Internalin C; cellular invasion, leucine-rich repe | 98.15 | |
| 4ezg_A | 197 | Putative uncharacterized protein; internalin-A, le | 98.15 | |
| 2z80_A | 353 | TOLL-like receptor 2, variable lymphocyte recepto; | 98.14 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 98.14 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 98.14 | |
| 2ifg_A | 347 | High affinity nerve growth factor receptor; TRK, T | 98.13 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 98.13 | |
| 1h6t_A | 291 | Internalin B; cell adhesion, leucine rich repeat, | 98.13 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 98.12 | |
| 1h6t_A | 291 | Internalin B; cell adhesion, leucine rich repeat, | 98.12 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 98.12 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 98.12 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 98.11 | |
| 2xwt_C | 239 | Thyrotropin receptor; signaling protein-immune sys | 98.11 | |
| 4glp_A | 310 | Monocyte differentiation antigen CD14; alpha beta | 98.1 | |
| 2z66_A | 306 | Variable lymphocyte receptor B, TOLL-like recepto; | 98.1 | |
| 1h6u_A | 308 | Internalin H; cell adhesion, leucine rich repeat, | 98.1 | |
| 1h6u_A | 308 | Internalin H; cell adhesion, leucine rich repeat, | 98.09 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 98.08 | |
| 1ds9_A | 198 | Outer arm dynein; leucine-rich repeat, beta-BETA-a | 98.08 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 98.08 | |
| 3zyi_A | 452 | Leucine-rich repeat-containing protein 4; cell adh | 98.07 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 98.06 | |
| 3zyj_A | 440 | Leucine-rich repeat-containing protein 4C; cell ad | 98.05 | |
| 3v47_A | 455 | TOLL-like receptor 5B and variable lymphocyte REC | 98.03 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 98.02 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 98.02 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 98.02 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 98.0 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 98.0 | |
| 2fna_A | 357 | Conserved hypothetical protein; structural genomic | 98.0 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 97.99 | |
| 1wwl_A | 312 | Monocyte differentiation antigen CD14; LPS, immune | 97.99 | |
| 2z7x_B | 520 | TOLL-like receptor 1, variable lymphocyte recepto; | 97.98 | |
| 2qen_A | 350 | Walker-type ATPase; unknown function; HET: ADP; 2. | 97.98 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 97.98 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 97.98 | |
| 3a79_B | 562 | TLR6, VLRB.59, TOLL-like receptor 6, variable lymp | 97.96 | |
| 1m9s_A | 605 | Internalin B; cell invasion, GW domains, SH3 domai | 97.96 | |
| 4glp_A | 310 | Monocyte differentiation antigen CD14; alpha beta | 97.95 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 97.91 | |
| 1m9s_A | 605 | Internalin B; cell invasion, GW domains, SH3 domai | 97.9 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 97.87 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 97.85 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 97.84 | |
| 1ds9_A | 198 | Outer arm dynein; leucine-rich repeat, beta-BETA-a | 97.84 | |
| 3g06_A | 622 | SSPH2 (leucine-rich repeat protein); E3 ubiquitin | 97.84 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 97.77 | |
| 3cvr_A | 571 | Invasion plasmid antigen; leucine rich repeat and | 97.75 | |
| 3g06_A | 622 | SSPH2 (leucine-rich repeat protein); E3 ubiquitin | 97.73 | |
| 3cvr_A | 571 | Invasion plasmid antigen; leucine rich repeat and | 97.68 | |
| 4ay9_X | 350 | Follicle-stimulating hormone receptor; hormone-rec | 97.6 | |
| 4ay9_X | 350 | Follicle-stimulating hormone receptor; hormone-rec | 97.6 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 97.53 | |
| 3rw6_A | 267 | Nuclear RNA export factor 1; retroviral constituti | 97.45 | |
| 2ca6_A | 386 | RAN GTPase-activating protein 1; GAP, GTPase activ | 97.39 | |
| 2ca6_A | 386 | RAN GTPase-activating protein 1; GAP, GTPase activ | 97.29 | |
| 1w5s_A | 412 | Origin recognition complex subunit 2 ORC2; replica | 97.03 | |
| 2ast_B | 336 | S-phase kinase-associated protein 2; SCF-substrate | 97.01 | |
| 2ast_B | 336 | S-phase kinase-associated protein 2; SCF-substrate | 96.99 | |
| 3goz_A | 362 | Leucine-rich repeat-containing protein; LEGL7, NES | 96.73 | |
| 3rfe_A | 130 | Platelet glycoprotein IB beta chain; platelet surf | 96.48 | |
| 3goz_A | 362 | Leucine-rich repeat-containing protein; LEGL7, NES | 96.36 | |
| 1z7x_W | 461 | Ribonuclease inhibitor; leucine-rich repeat, enzym | 96.35 | |
| 1z7x_W | 461 | Ribonuclease inhibitor; leucine-rich repeat, enzym | 96.26 | |
| 3sb4_A | 329 | Hypothetical leucine rich repeat protein; LRR, rig | 96.22 | |
| 3un9_A | 372 | NLR family member X1; leucine rich repeat (LRR), a | 95.83 | |
| 3rw6_A | 267 | Nuclear RNA export factor 1; retroviral constituti | 95.73 | |
| 3e4g_A | 176 | ATP synthase subunit S, mitochondrial; leucine-ric | 95.7 | |
| 2qby_B | 384 | CDC6 homolog 3, cell division control protein 6 ho | 95.57 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 95.33 | |
| 3sb4_A | 329 | Hypothetical leucine rich repeat protein; LRR, rig | 95.23 | |
| 3un9_A | 372 | NLR family member X1; leucine rich repeat (LRR), a | 94.97 | |
| 1njg_A | 250 | DNA polymerase III subunit gamma; rossman-like fol | 94.95 | |
| 1io0_A | 185 | Tropomodulin; LRR protein, right-handed super-heli | 94.86 | |
| 2ra8_A | 362 | Uncharacterized protein Q64V53_bacfr; WGR domain, | 94.76 | |
| 2qby_A | 386 | CDC6 homolog 1, cell division control protein 6 ho | 94.32 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 93.71 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 93.61 | |
| 1io0_A | 185 | Tropomodulin; LRR protein, right-handed super-heli | 93.59 | |
| 3e4g_A | 176 | ATP synthase subunit S, mitochondrial; leucine-ric | 93.41 | |
| 1fnn_A | 389 | CDC6P, cell division control protein 6; ORC1, AAA | 93.32 | |
| 2v1u_A | 387 | Cell division control protein 6 homolog; DNA repli | 92.84 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 92.68 | |
| 2ra8_A | 362 | Uncharacterized protein Q64V53_bacfr; WGR domain, | 89.76 | |
| 1sxj_B | 323 | Activator 1 37 kDa subunit; clamp loader, processi | 88.26 | |
| 3rfe_A | 130 | Platelet glycoprotein IB beta chain; platelet surf | 88.06 | |
| 2chg_A | 226 | Replication factor C small subunit; DNA-binding pr | 87.91 | |
| 4fdw_A | 401 | Leucine rich hypothetical protein; putative cell s | 87.27 | |
| 4fdw_A | 401 | Leucine rich hypothetical protein; putative cell s | 86.27 |
| >2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* | Back alignment and structure |
|---|
Probab=99.96 E-value=1.3e-30 Score=251.61 Aligned_cols=178 Identities=15% Similarity=0.175 Sum_probs=147.8
Q ss_pred CCceEEEEcCChhhHhhcCCCCcceEEcCCCCHHhHHHHHHHhhhcCCCCCCChHHHHHHHHHHhcCCchhHHHHhhhhc
Q 036903 13 PGSRIIVTTRDKRVLDNFGVPNTNIYKVRGLNYSEALELFCNFAFKQSNCPDGLFTLSKHIVGYCKGNPLALRVLGSFLH 92 (323)
Q Consensus 13 ~gs~IlvTTR~~~v~~~~~~~~~~~~~l~~L~~~~~~~Lf~~~~~~~~~~~~~~~~~~~~i~~~c~GlPLAi~~ig~~L~ 92 (323)
+||+||||||++.++..++ ....+|.|++|+.++||+||.+.+|+... ++++++++.+|+++|+|+||||+++|++|+
T Consensus 264 ~gs~ilvTTR~~~v~~~~~-~~~~~~~l~~L~~~ea~~Lf~~~a~~~~~-~~~~~~~~~~I~~~c~GlPLAl~~~g~~l~ 341 (549)
T 2a5y_B 264 LRLRCLVTTRDVEISNAAS-QTCEFIEVTSLEIDECYDFLEAYGMPMPV-GEKEEDVLNKTIELSSGNPATLMMFFKSCE 341 (549)
T ss_dssp TTCEEEEEESBGGGGGGCC-SCEEEEECCCCCHHHHHHHHHHTSCCCC---CHHHHHHHHHHHHHTTCHHHHHHHHTTCC
T ss_pred CCCEEEEEcCCHHHHHHcC-CCCeEEECCCCCHHHHHHHHHHHhcCCCC-chhHHHHHHHHHHHhCCChHHHHHHHHHhc
Confidence 7999999999999998775 13468999999999999999999976543 467888999999999999999999999998
Q ss_pred CCChHHHHHHHHH-hhcCCcccHHHHHHHHhcCCChhhHhHhh-----------hhcccCCCCCHHHHHHHHhhc--ch-
Q 036903 93 RKSKLDWENALEN-LKRSSDFEIYDVLKISYNELNPEEKSLFL-----------DIACFFAGEDKNLVTKILDDS--NY- 157 (323)
Q Consensus 93 ~~~~~~w~~~l~~-l~~~~~~~i~~~l~~sy~~L~~~~k~cfl-----------~~s~fp~~~~~~~l~~~w~~~--g~- 157 (323)
.++ ++|...+.. ++.....++..++.+||++||++.|.||+ |||+||+++.++ +++|+++ |+
T Consensus 342 ~~~-w~~~~~l~~~l~~~~~~~i~~~l~~Sy~~L~~~lk~~f~~Ls~~er~l~~~ls~fp~~~~i~--i~~w~a~~~G~i 418 (549)
T 2a5y_B 342 PKT-FEKMAQLNNKLESRGLVGVECITPYSYKSLAMALQRCVEVLSDEDRSALAFAVVMPPGVDIP--VKLWSCVIPVDI 418 (549)
T ss_dssp SSS-HHHHHHHHHHHHHHCSSTTCCCSSSSSSSHHHHHHHHHHTSCHHHHHHTTGGGSSCTTCCEE--HHHHHHHSCC--
T ss_pred cch-HHHHHHhHHHhhcccHHHHHHHHhcccccccHHHHHHHhccchhhhhHhhheeeeCCCCeee--eeeeeeecccee
Confidence 773 334333332 33324567888999999999999999999 999999998888 8899998 55
Q ss_pred --------------HHHHhhhCCcceEcC---CCeEEecHHHHHHHHHHHhhhcc
Q 036903 158 --------------VLNVLVDKSLLRISR---YNKLQMHDLLQEMGREIVRQESV 195 (323)
Q Consensus 158 --------------~l~~L~~~~ll~~~~---~~~~~mh~lv~~~~~~~~~~~~~ 195 (323)
+|++|+++||++... ..+|+|||+||+||++++.+++.
T Consensus 419 ~~~~~~~~~~~~~~~l~~L~~rsLl~~~~~~~~~~~~mHdlv~~~a~~~~~~~~~ 473 (549)
T 2a5y_B 419 CSNEEEQLDDEVADRLKRLSKRGALLSGKRMPVLTFKIDHIIHMFLKHVVDAQTI 473 (549)
T ss_dssp -----CCCTHHHHHHHHHTTTBSSCSEEECSSSCEEECCHHHHHHHHTTSCTHHH
T ss_pred ccCCCCCCHHHHHHHHHHHHHcCCeeEecCCCceEEEeChHHHHHHHHHHHHHHH
Confidence 799999999999864 34799999999999998877653
|
| >3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* | Back alignment and structure |
|---|
| >1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} | Back alignment and structure |
|---|
| >2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} | Back alignment and structure |
|---|
| >3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} | Back alignment and structure |
|---|
| >3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} | Back alignment and structure |
|---|
| >2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A | Back alignment and structure |
|---|
| >4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} | Back alignment and structure |
|---|
| >3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D | Back alignment and structure |
|---|
| >2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A | Back alignment and structure |
|---|
| >2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A | Back alignment and structure |
|---|
| >1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 | Back alignment and structure |
|---|
| >2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} | Back alignment and structure |
|---|
| >2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A | Back alignment and structure |
|---|
| >2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} | Back alignment and structure |
|---|
| >2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A | Back alignment and structure |
|---|
| >2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} | Back alignment and structure |
|---|
| >1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 | Back alignment and structure |
|---|
| >3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A | Back alignment and structure |
|---|
| >2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D | Back alignment and structure |
|---|
| >3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* | Back alignment and structure |
|---|
| >2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A | Back alignment and structure |
|---|
| >4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* | Back alignment and structure |
|---|
| >1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 | Back alignment and structure |
|---|
| >1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A | Back alignment and structure |
|---|
| >2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* | Back alignment and structure |
|---|
| >2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* | Back alignment and structure |
|---|
| >2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* | Back alignment and structure |
|---|
| >1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 | Back alignment and structure |
|---|
| >2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 | Back alignment and structure |
|---|
| >3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} | Back alignment and structure |
|---|
| >2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 | Back alignment and structure |
|---|
| >2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} | Back alignment and structure |
|---|
| >2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} | Back alignment and structure |
|---|
| >1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* | Back alignment and structure |
|---|
| >1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* | Back alignment and structure |
|---|
| >4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* | Back alignment and structure |
|---|
| >2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* | Back alignment and structure |
|---|
| >2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* | Back alignment and structure |
|---|
| >1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} | Back alignment and structure |
|---|
| >1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* | Back alignment and structure |
|---|
| >2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* | Back alignment and structure |
|---|
| >2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* | Back alignment and structure |
|---|
| >4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} | Back alignment and structure |
|---|
| >2fna_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE ADP; 2.00A {Sulfolobus solfataricus} SCOP: a.4.5.11 c.37.1.20 | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A | Back alignment and structure |
|---|
| >1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2qen_A Walker-type ATPase; unknown function; HET: ADP; 2.25A {Pyrococcus abyssi} | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A | Back alignment and structure |
|---|
| >4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} | Back alignment and structure |
|---|
| >1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A | Back alignment and structure |
|---|
| >3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} | Back alignment and structure |
|---|
| >4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* | Back alignment and structure |
|---|
| >4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A | Back alignment and structure |
|---|
| >3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A | Back alignment and structure |
|---|
| >2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A | Back alignment and structure |
|---|
| >2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A | Back alignment and structure |
|---|
| >1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* | Back alignment and structure |
|---|
| >2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A | Back alignment and structure |
|---|
| >2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A | Back alignment and structure |
|---|
| >3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* | Back alignment and structure |
|---|
| >3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I | Back alignment and structure |
|---|
| >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I | Back alignment and structure |
|---|
| >3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A | Back alignment and structure |
|---|
| >3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A | Back alignment and structure |
|---|
| >2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* | Back alignment and structure |
|---|
| >3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* | Back alignment and structure |
|---|
| >1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 | Back alignment and structure |
|---|
| >2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* | Back alignment and structure |
|---|
| >1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 | Back alignment and structure |
|---|
| >3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A | Back alignment and structure |
|---|
| >1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 | Back alignment and structure |
|---|
| >2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* | Back alignment and structure |
|---|
| >2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* | Back alignment and structure |
|---|
| >2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A | Back alignment and structure |
|---|
| >4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 323 | ||||
| d2a5yb3 | 277 | c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenor | 1e-24 |
| >d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Length = 277 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: Extended AAA-ATPase domain domain: CED-4, NB-ARC domain species: Caenorhabditis elegans [TaxId: 6239]
Score = 98.7 bits (245), Expect = 1e-24
Identities = 18/123 (14%), Positives = 33/123 (26%), Gaps = 2/123 (1%)
Query: 11 FGPGSRIIVTTRDKRVLDNFGVPNTNIYKVRGLNYSEALELFCNFAFKQSNCPDGLFTLS 70
R +VTTRD + + +V L E + + + +
Sbjct: 154 QELRLRCLVTTRDVEISNAASQTC-EFIEVTSLEIDECYDFLEAYGMPM-PVGEKEEDVL 211
Query: 71 KHIVGYCKGNPLALRVLGSFLHRKSKLDWENALENLKRSSDFEIYDVLKISYNELNPEEK 130
+ GNP L + K+ L+ + + SY L +
Sbjct: 212 NKTIELSSGNPATLMMFFKSCEPKTFEKMAQLNNKLESRGLVGVECITPYSYKSLAMALQ 271
Query: 131 SLF 133
Sbjct: 272 RCV 274
|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 323 | |||
| d2a5yb3 | 277 | CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI | 99.87 | |
| d1dcea3 | 124 | Rab geranylgeranyltransferase alpha-subunit, C-ter | 98.68 | |
| d1dcea3 | 124 | Rab geranylgeranyltransferase alpha-subunit, C-ter | 98.66 | |
| d1w8aa_ | 192 | Slit {Fruit fly (Drosophila melanogaster) [TaxId: | 98.61 | |
| d1a9na_ | 162 | Splicesomal U2A' protein {Human (Homo sapiens) [Ta | 98.56 | |
| d1a9na_ | 162 | Splicesomal U2A' protein {Human (Homo sapiens) [Ta | 98.47 | |
| d1xkua_ | 305 | Decorin {Cow (Bos taurus) [TaxId: 9913]} | 98.45 | |
| d2ifga3 | 156 | High affinity nerve growth factor receptor, N-term | 98.28 | |
| d2ifga3 | 156 | High affinity nerve growth factor receptor, N-term | 98.25 | |
| d1p9ag_ | 266 | von Willebrand factor binding domain of glycoprote | 98.24 | |
| d1w8aa_ | 192 | Slit {Fruit fly (Drosophila melanogaster) [TaxId: | 98.23 | |
| d1xkua_ | 305 | Decorin {Cow (Bos taurus) [TaxId: 9913]} | 98.15 | |
| d1p9ag_ | 266 | von Willebrand factor binding domain of glycoprote | 98.13 | |
| d1ogqa_ | 313 | Polygalacturonase inhibiting protein PGIP {Kidney | 98.05 | |
| d1ogqa_ | 313 | Polygalacturonase inhibiting protein PGIP {Kidney | 98.03 | |
| d2omza2 | 384 | Internalin A {Listeria monocytogenes [TaxId: 1639] | 97.98 | |
| d1h6ua2 | 227 | Internalin H {Listeria monocytogenes [TaxId: 1639] | 97.94 | |
| d2omza2 | 384 | Internalin A {Listeria monocytogenes [TaxId: 1639] | 97.94 | |
| d1h6ta2 | 210 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 97.9 | |
| d2omxa2 | 199 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 97.88 | |
| d2omxa2 | 199 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 97.87 | |
| d1m9la_ | 198 | Outer arm dynein light chain 1 {Green algae (Chlam | 97.86 | |
| d1jl5a_ | 353 | Leucine rich effector protein YopM {Yersinia pesti | 97.85 | |
| d1ozna_ | 284 | Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma | 97.8 | |
| d1h6ua2 | 227 | Internalin H {Listeria monocytogenes [TaxId: 1639] | 97.74 | |
| d1h6ta2 | 210 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 97.73 | |
| d1ozna_ | 284 | Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma | 97.69 | |
| d1m9la_ | 198 | Outer arm dynein light chain 1 {Green algae (Chlam | 97.56 | |
| d1jl5a_ | 353 | Leucine rich effector protein YopM {Yersinia pesti | 97.49 | |
| d1koha1 | 162 | mRNA export factor tap {Human (Homo sapiens) [TaxI | 97.34 | |
| d1xwdc1 | 242 | Follicle-stimulating hormone receptor {Human (Homo | 97.21 | |
| d1xwdc1 | 242 | Follicle-stimulating hormone receptor {Human (Homo | 97.2 | |
| d2astb2 | 284 | Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa | 96.23 | |
| d1koha1 | 162 | mRNA export factor tap {Human (Homo sapiens) [TaxI | 95.72 | |
| d1z7xw1 | 460 | Ribonuclease inhibitor {Human (Homo sapiens) [TaxI | 95.59 | |
| d1z7xw1 | 460 | Ribonuclease inhibitor {Human (Homo sapiens) [TaxI | 95.08 | |
| d2astb2 | 284 | Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa | 94.81 | |
| d2ca6a1 | 344 | Rna1p (RanGAP1), N-terminal domain {Fission yeast | 93.61 | |
| d2ca6a1 | 344 | Rna1p (RanGAP1), N-terminal domain {Fission yeast | 92.46 | |
| d2fnaa2 | 283 | Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ | 89.34 | |
| d1pgva_ | 167 | Tropomodulin C-terminal domain {nematode (Caenorha | 86.46 |
| >d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: Extended AAA-ATPase domain domain: CED-4, NB-ARC domain species: Caenorhabditis elegans [TaxId: 6239]
Probab=99.87 E-value=3.3e-23 Score=180.63 Aligned_cols=123 Identities=15% Similarity=0.138 Sum_probs=108.4
Q ss_pred CCCceEEEEcCChhhHhhcCCCCcceEEcCCCCHHhHHHHHHHhhhcCCCCCCChHHHHHHHHHHhcCCchhHHHHhhhh
Q 036903 12 GPGSRIIVTTRDKRVLDNFGVPNTNIYKVRGLNYSEALELFCNFAFKQSNCPDGLFTLSKHIVGYCKGNPLALRVLGSFL 91 (323)
Q Consensus 12 ~~gs~IlvTTR~~~v~~~~~~~~~~~~~l~~L~~~~~~~Lf~~~~~~~~~~~~~~~~~~~~i~~~c~GlPLAi~~ig~~L 91 (323)
..||+||||||++.++..+. ...+.|+|++|+.+|||+||..++|.... ++..++++++|+++|+|+|||++++|+.|
T Consensus 155 ~~~srilvTTR~~~v~~~~~-~~~~~~~l~~L~~~ea~~Lf~~~~~~~~~-~~~~~~~~~~iv~~c~GlPLAl~~ig~~l 232 (277)
T d2a5yb3 155 ELRLRCLVTTRDVEISNAAS-QTCEFIEVTSLEIDECYDFLEAYGMPMPV-GEKEEDVLNKTIELSSGNPATLMMFFKSC 232 (277)
T ss_dssp HTTCEEEEEESBGGGGGGCC-SCEEEEECCCCCHHHHHHHHHHTSCCCC---CHHHHHHHHHHHHHTTCHHHHHHHHTTC
T ss_pred ccCceEEEEeehHHHHHhcC-CCCceEECCCCCHHHHHHHHHHHhCCccC-chhhHHHHHHHHHHhCCCHHHHHHHHHHh
Confidence 46899999999999998775 13478999999999999999999876543 34567889999999999999999999999
Q ss_pred cCCChHHHHHHHHHhhcCCcccHHHHHHHHhcCCChhhHhHhhhh
Q 036903 92 HRKSKLDWENALENLKRSSDFEIYDVLKISYNELNPEEKSLFLDI 136 (323)
Q Consensus 92 ~~~~~~~w~~~l~~l~~~~~~~i~~~l~~sy~~L~~~~k~cfl~~ 136 (323)
+.++.++|.+..+++......++..++.+||++||+++|+||-++
T Consensus 233 ~~k~~~~~~~~~~~L~~~~~~~v~~il~~sY~~L~~~lk~c~~~l 277 (277)
T d2a5yb3 233 EPKTFEKMAQLNNKLESRGLVGVECITPYSYKSLAMALQRCVEVL 277 (277)
T ss_dssp CSSSHHHHHHHHHHHHHHCSSTTCCCSSSSSSSHHHHHHHHHHTS
T ss_pred ccCCHHHHHHHHHHHhcCcHHHHHHHHHHHHhcccHHHHHHHHhC
Confidence 999999999999999877778899999999999999999999764
|
| >d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} | Back information, alignment and structure |
|---|
| >d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} | Back information, alignment and structure |
|---|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} | Back information, alignment and structure |
|---|
| >d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} | Back information, alignment and structure |
|---|
| >d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|