Citrus Sinensis ID: 036917

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280
MALPLIPLSIIFIILAYKLYQRLRFNLPPGPRPLPIVGNLYDIKPVRFRCFAEWAQQYGQSFRFELAREVLKEHDQQLADRHRSRSAAKFSRDGKDLIWADYGPHYVKVRKVCTLELFTPKRLEALRPIREDEVTAMVESIFKDCTDPHNFVAFTLSGSNIHVNVWAVARDPAVWKDPLEFRPERFFEEDVDMKGHDFRLLPFGAGRRVCPGAQLGINLVTSMLGHLLHHFAWAPPEGVKPEEIDMSENPGLVTYMKTPLQAVPTPRLPSHLYKRVAADM
ccHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHcccccccccccccHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHcccccccccccccccccEEEEEEEEEcccccccccccccccccccccccccccccccEEcccccccccccHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccEEEEEEccccccccccccccc
cHHHHHHHHHHHHHHHHHHHcccccccccccccEcccEcHHHccHHHHHHHHHHHHcccHHHHHHHHHHHHHHccHHHHHccHHHHHHHHcccccEEEcccccccHHHHEEHHHHHHcccccccccHHHHHHHHHHHHHHHHHHcccccEccEEcccccEEEEEEEEEcccccccccHHHccHHHHcccccccccccEEEEEccccccccccHHHHHHHHHHHHHHHHHHccccccccccHHHccccccccEEEEccccEEEEEccccccHHcccccccc
MALPLIPLSIIFIILAYKLYQRLrfnlppgprplpivgnlydikpvrFRCFAEWAQQYGQSFRFELAREVLKEHDQQLADRHRSrsaakfsrdgkdliwadygphyvKVRKVctlelftpkrlealrpireDEVTAMVESIFKdctdphnfvaftlsgsniHVNVWAVardpavwkdplefrperffeedvdmkghdfrllpfgagrrvcpgaqLGINLVTSMLGHLlhhfawappegvkpeeidmsenpglvtymktplqavptprlpshLYKRVAADM
MALPLIPLSIIFIILAYKLYQRLRFNLPPGPRPLPIVGNLYDIKPVRFRCFAEWAQQYGQSFRFELAREVLKEHDqqladrhrsrsaakfsrdgkdliWADYGPHYVKVRKVCtlelftpkrlealrpireDEVTAMVESIFKDCTDPHNFVAFTLSGSNIHVNVWAVARDPAVWKDPLEFRPERFFEEDVDMKGHDFRLLPFGAGRRVCPGAQLGINLVTSMLGHLLHHFAWAPPEGVKPEEIDMSENPGLVTYMKtplqavptprlpshLYKRVAADM
MAlpliplsiifiilAYKLYQRLRFNLPPGPRPLPIVGNLYDIKPVRFRCFAEWAQQYGQSFRFELAREVLKEHDQQLADRHRSRSAAKFSRDGKDLIWADYGPHYVKVRKVCTLELFTPKRLEALRPIREDEVTAMVESIFKDCTDPHNFVAFTLSGSNIHVNVWAVARDPAVWKDPLefrperffeeDVDMKGHDFRLLPFGAGRRVCPGAQLGINLVTSMLGHLLHHFAWAPPEGVKPEEIDMSENPGLVTYMKTPLQAVPTPRLPSHLYKRVAADM
***PLIPLSIIFIILAYKLYQRLRFNLPPGPRPLPIVGNLYDIKPVRFRCFAEWAQQYGQSFRFELAREVL**********************GKDLIWADYGPHYVKVRKVCTLELFTPKRLEALRPIREDEVTAMVESIFKDCTDPHNFVAFTLSGSNIHVNVWAVARDPAVWKDPLEFRPERFFEEDVDMKGHDFRLLPFGAGRRVCPGAQLGINLVTSMLGHLLHHFAWAP*****************VTY*************************
MALPLIPLSIIFIILAYKLY**********PRPLPIVGNLYDIKPVRFRCFAEWAQQYGQSFRFELAREVLKEHDQQLADRHRSRSAAKFSRDGKDLIWADYGPHYVKVRKVCTLELFTPKRLEALRPIREDEVTAMVESIFKDCTDPHNFVAFTLSGSNIHVNVWAVARDPAVWKDPLEFRPERFFEEDVDMKGHDFRLLPFGAGRRVCPGAQLGINLVTSMLGHLLHHFAWAPPEGVKPEEIDMSENPGLVTYMKTPLQAVPTPRLPSHLYKRVA***
MALPLIPLSIIFIILAYKLYQRLRFNLPPGPRPLPIVGNLYDIKPVRFRCFAEWAQQYGQSFRFELAREVLK******************SRDGKDLIWADYGPHYVKVRKVCTLELFTPKRLEALRPIREDEVTAMVESIFKDCTDPHNFVAFTLSGSNIHVNVWAVARDPAVWKDPLEFRPERFFEEDVDMKGHDFRLLPFGAGRRVCPGAQLGINLVTSMLGHLLHHFAWAPPEGVKPEEIDMSENPGLVTYMKTPLQAVPTPRLPSHLYKRVAADM
MALPLIPLSIIFIILAYKLYQRLRFNLPPGPRPLPIVGNLYDIKPVRFRCFAEWAQQYGQSFRFELAREVLKEHDQQLADRHRSRSAAKFSRDGKDLIWADYGPHYVKVRKVCTLELFTPKRLEALRPIREDEVTAMVESIFKDCTDPHNFVAFTLSGSNIHVNVWAVARDPAVWKDPLEFRPERFFEEDVDMKGHDFRLLPFGAGRRVCPGAQLGINLVTSMLGHLLHHFAWAPPEGVKPEEIDMSENPGLVTYMKTPLQAVPTPRLPSHLYKRV****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MALPLIPLSIIFIILAYKLYQRLRFNLPPGPRPLPIVGNLYDIKPVRFRCFAEWAQQYGQSFRFELAREVLKEHDQQLADRHRSRSAAKFSRDGKDLIWADYGPHYVKVRKVCTLELFTPKRLEALRPIREDEVTAMVESIFKDCTDPHNFVAFTLSGSNIHVNVWAVARDPAVWKDPLEFRPERFFEEDVDMKGHDFRLLPFGAGRRVCPGAQLGINLVTSMLGHLLHHFAWAPPEGVKPEEIDMSENPGLVTYMKTPLQAVPTPRLPSHLYKRVAADM
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query280 2.2.26 [Sep-21-2011]
O48922 509 Cytochrome P450 98A2 OS=G yes no 0.532 0.292 0.722 1e-63
O22203508 Cytochrome P450 98A3 OS=A yes no 0.392 0.216 0.869 2e-61
O48956512 Cytochrome P450 98A1 OS=S N/A no 0.439 0.240 0.701 4e-49
Q9CA60487 Cytochrome P450 98A9 OS=A no no 0.407 0.234 0.594 4e-36
Q9CA61497 Cytochrome P450 98A8 OS=A no no 0.364 0.205 0.605 4e-33
D1MI46495 Geraniol 8-hydroxylase OS N/A no 0.332 0.187 0.513 5e-30
Q9LVD2502 Cytochrome P450 71B10 OS= no no 0.335 0.187 0.527 8e-30
Q9LIP6500 Cytochrome P450 71B34 OS= no no 0.317 0.178 0.523 1e-28
O64636512 Cytochrome P450 76C1 OS=A no no 0.357 0.195 0.473 2e-28
Q9LTL0500 Cytochrome P450 71B26 OS= no no 0.325 0.182 0.5 2e-28
>sp|O48922|C98A2_SOYBN Cytochrome P450 98A2 OS=Glycine max GN=CYP98A2 PE=2 SV=1 Back     alignment and function desciption
 Score =  243 bits (619), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 117/162 (72%), Positives = 129/162 (79%), Gaps = 13/162 (8%)

Query: 3   LPLIPLSIIFIILAYKLYQRLRFNLPPGPRPLPIVGNLYDIKPVRFRCFAEWAQQYGQSF 62
           L +IP+S++ + L Y LYQRLRF LPPGPRP P+VGNLYDIKPVRFRCFAEWAQ YG   
Sbjct: 4   LLIIPISLVTLWLGYTLYQRLRFKLPPGPRPWPVVGNLYDIKPVRFRCFAEWAQSYGPII 63

Query: 63  RF-------------ELAREVLKEHDQQLADRHRSRSAAKFSRDGKDLIWADYGPHYVKV 109
                          ELA+EVLKEHDQ LADRHRSRSAAKFSRDGKDLIWADYGPHYVKV
Sbjct: 64  SVWFGSTLNVIVSNSELAKEVLKEHDQLLADRHRSRSAAKFSRDGKDLIWADYGPHYVKV 123

Query: 110 RKVCTLELFTPKRLEALRPIREDEVTAMVESIFKDCTDPHNF 151
           RKVCTLELF+PKRLEALRPIREDEVT+MV+S++  CT   N 
Sbjct: 124 RKVCTLELFSPKRLEALRPIREDEVTSMVDSVYNHCTSTENL 165

Glycine max (taxid: 3847)
EC: 1EC: .EC: 1EC: 4EC: .EC: -EC: .EC: -
>sp|O22203|C98A3_ARATH Cytochrome P450 98A3 OS=Arabidopsis thaliana GN=CYP98A3 PE=1 SV=1 Back     alignment and function description
>sp|O48956|C98A1_SORBI Cytochrome P450 98A1 OS=Sorghum bicolor GN=CYP98A1 PE=2 SV=1 Back     alignment and function description
>sp|Q9CA60|C98A9_ARATH Cytochrome P450 98A9 OS=Arabidopsis thaliana GN=CYP98A9 PE=1 SV=1 Back     alignment and function description
>sp|Q9CA61|C98A8_ARATH Cytochrome P450 98A8 OS=Arabidopsis thaliana GN=CYP98A8 PE=1 SV=1 Back     alignment and function description
>sp|D1MI46|C76BA_SWEMU Geraniol 8-hydroxylase OS=Swertia mussotii GN=CYP76B10 PE=1 SV=1 Back     alignment and function description
>sp|Q9LVD2|C71BA_ARATH Cytochrome P450 71B10 OS=Arabidopsis thaliana GN=CYP71B10 PE=3 SV=1 Back     alignment and function description
>sp|Q9LIP6|C71BV_ARATH Cytochrome P450 71B34 OS=Arabidopsis thaliana GN=CYP71B34 PE=2 SV=1 Back     alignment and function description
>sp|O64636|C76C1_ARATH Cytochrome P450 76C1 OS=Arabidopsis thaliana GN=CYP76C1 PE=2 SV=1 Back     alignment and function description
>sp|Q9LTL0|C71BQ_ARATH Cytochrome P450 71B26 OS=Arabidopsis thaliana GN=CYP71B26 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query280
333826792 508 CYP98A22 [Ruta graveolens] 0.539 0.297 0.786 1e-68
166209291 508 p-coumaryl-CoA 3'-hydroxylase [Populus a 0.535 0.295 0.779 1e-66
429326400 508 p-coumarate 3-hydroxylase [Populus tomen 0.535 0.295 0.779 3e-66
224089905 508 cytochrome P450 [Populus trichocarpa] gi 0.535 0.295 0.766 7e-66
344222898 508 C3H3 [Populus nigra] 0.535 0.295 0.766 8e-66
343796563 508 p-coumarate 3'-hydroxylase [Platycodon g 0.535 0.295 0.754 1e-64
225440169 508 PREDICTED: cytochrome P450 98A2 [Vitis v 0.539 0.297 0.768 1e-64
164604842 511 cytochrome P450 [Coptis japonica var. di 0.514 0.281 0.777 2e-63
356504639 509 PREDICTED: cytochrome P450 98A2-like [Gl 0.539 0.296 0.739 8e-63
260751188 509 p-coumaroyl-shikimate 3'-hydroxylase [Tr 0.539 0.296 0.751 1e-62
>gi|333826792|gb|AEG19446.1| CYP98A22 [Ruta graveolens] Back     alignment and taxonomy information
 Score =  266 bits (679), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 129/164 (78%), Positives = 136/164 (82%), Gaps = 13/164 (7%)

Query: 1   MALPLIPLSIIFIILAYKLYQRLRFNLPPGPRPLPIVGNLYDIKPVRFRCFAEWAQQYGQ 60
           M LPLIPLS+IF +LAY LYQRLRF LPPGPRPLPIVGNLY +KPVRFRC+ EWA  YG 
Sbjct: 1   MGLPLIPLSLIFTVLAYNLYQRLRFKLPPGPRPLPIVGNLYHVKPVRFRCYDEWAHHYGP 60

Query: 61  SFRF-------------ELAREVLKEHDQQLADRHRSRSAAKFSRDGKDLIWADYGPHYV 107
                            ELA+EVLKEHDQQLADRHRSRSAAKFSRDGKDLIWADYGPHYV
Sbjct: 61  IISVWFGSILNVVVSNTELAKEVLKEHDQQLADRHRSRSAAKFSRDGKDLIWADYGPHYV 120

Query: 108 KVRKVCTLELFTPKRLEALRPIREDEVTAMVESIFKDCTDPHNF 151
           KVRKVCTLELFTPKRLEA+RPIREDEVTAMVESIFKD TDP N+
Sbjct: 121 KVRKVCTLELFTPKRLEAMRPIREDEVTAMVESIFKDSTDPQNY 164

Source: Ruta graveolens

Species: Ruta graveolens

Genus: Ruta

Family: Rutaceae

Order: Sapindales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|166209291|gb|ABY85195.1| p-coumaryl-CoA 3'-hydroxylase [Populus alba x Populus grandidentata] Back     alignment and taxonomy information
>gi|429326400|gb|AFZ78540.1| p-coumarate 3-hydroxylase [Populus tomentosa] Back     alignment and taxonomy information
>gi|224089905|ref|XP_002308860.1| cytochrome P450 [Populus trichocarpa] gi|183585157|gb|ACC63870.1| coumaroyl 3-hydroxylase [Populus trichocarpa] gi|222854836|gb|EEE92383.1| cytochrome P450 [Populus trichocarpa] Back     alignment and taxonomy information
>gi|344222898|gb|AEN02912.1| C3H3 [Populus nigra] Back     alignment and taxonomy information
>gi|343796563|gb|AEM63674.1| p-coumarate 3'-hydroxylase [Platycodon grandiflorus] Back     alignment and taxonomy information
>gi|225440169|ref|XP_002283338.1| PREDICTED: cytochrome P450 98A2 [Vitis vinifera] Back     alignment and taxonomy information
>gi|164604842|dbj|BAF98473.1| cytochrome P450 [Coptis japonica var. dissecta] Back     alignment and taxonomy information
>gi|356504639|ref|XP_003521103.1| PREDICTED: cytochrome P450 98A2-like [Glycine max] Back     alignment and taxonomy information
>gi|260751188|gb|ACX48910.1| p-coumaroyl-shikimate 3'-hydroxylase [Trifolium pratense] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query280
TAIR|locus:2058440 508 CYP98A3 "cytochrome P450, fami 0.482 0.265 0.716 6.4e-108
TAIR|locus:2019250487 CYP98A9 "cytochrome P450, fami 0.407 0.234 0.525 4.9e-58
TAIR|locus:2019240497 CYP98A8 "cytochrome P450, fami 0.385 0.217 0.527 2.7e-57
TAIR|locus:2179280496 CYP71B12 ""cytochrome P450, fa 0.371 0.209 0.480 2.6e-39
TAIR|locus:2179290496 CYP71B13 ""cytochrome P450, fa 0.371 0.209 0.461 5.6e-39
TAIR|locus:2031900502 CYP71B2 ""cytochrome P450, fam 0.389 0.217 0.431 8.8e-39
TAIR|locus:2165595502 CYP71B10 ""cytochrome P450, fa 0.392 0.219 0.472 2e-38
TAIR|locus:2146980496 CYP71B14 ""cytochrome P450, fa 0.371 0.209 0.5 2.2e-38
UNIPROTKB|Q6YV88518 CYP71Z7 "Ent-cassadiene C2-hyd 0.457 0.247 0.376 5.4e-38
TAIR|locus:2047570503 CYP71B6 "cytochrome p450 71b6" 0.364 0.202 0.439 1.1e-37
TAIR|locus:2058440 CYP98A3 "cytochrome P450, family 98, subfamily A, polypeptide 3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 549 (198.3 bits), Expect = 6.4e-108, Sum P(2) = 6.4e-108
 Identities = 106/148 (71%), Positives = 117/148 (79%)

Query:    16 AYKLYQRLRFNLPPGPRPLPIVGNLYDIKPVRFRCFAEWAQQYGQSFRF----------- 64
             +YKL QRLR+  PPGP P PIVGNLYDIKPVRFRC+ EWAQ YG                
Sbjct:    16 SYKLIQRLRYKFPPGPSPKPIVGNLYDIKPVRFRCYYEWAQSYGPIISVWIGSILNVVVS 75

Query:    65 --ELAREVLKEHDQQLADRHRSRSAAKFSRDGKDLIWADYGPHYVKVRKVCTLELFTPKR 122
               ELA+EVLKEHDQ+LADRHR+RS   FSR+G+DLIWADYGPHYVKVRKVCTLELFTPKR
Sbjct:    76 SAELAKEVLKEHDQKLADRHRNRSTEAFSRNGQDLIWADYGPHYVKVRKVCTLELFTPKR 135

Query:   123 LEALRPIREDEVTAMVESIFKDCTDPHN 150
             LE+LRPIREDEVTAMVES+F+DC  P N
Sbjct:   136 LESLRPIREDEVTAMVESVFRDCNLPEN 163
GO:0055114 "oxidation-reduction process" evidence=IEA
GO:0004497 "monooxygenase activity" evidence=IDA
GO:0009699 "phenylpropanoid biosynthetic process" evidence=IMP
GO:0043231 "intracellular membrane-bounded organelle" evidence=IDA
GO:0046409 "p-coumarate 3-hydroxylase activity" evidence=IMP;IDA
GO:0009809 "lignin biosynthetic process" evidence=IMP;TAS
GO:0005739 "mitochondrion" evidence=IDA
GO:0009813 "flavonoid biosynthetic process" evidence=IMP
GO:0009805 "coumarin biosynthetic process" evidence=RCA;IMP
GO:0005783 "endoplasmic reticulum" evidence=IDA
GO:0005886 "plasma membrane" evidence=IDA
GO:0009611 "response to wounding" evidence=RCA
GO:0009963 "positive regulation of flavonoid biosynthetic process" evidence=RCA
GO:0005515 "protein binding" evidence=IPI
GO:0042802 "identical protein binding" evidence=IPI
TAIR|locus:2019250 CYP98A9 "cytochrome P450, family 98, subfamily A, polypeptide 9" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2019240 CYP98A8 "cytochrome P450, family 98, subfamily A, polypeptide 8" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2179280 CYP71B12 ""cytochrome P450, family 71, subfamily B, polypeptide 12"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2179290 CYP71B13 ""cytochrome P450, family 71, subfamily B, polypeptide 13"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2031900 CYP71B2 ""cytochrome P450, family 71, subfamily B, polypeptide 2"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2165595 CYP71B10 ""cytochrome P450, family 71, subfamily B, polypeptide 10"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2146980 CYP71B14 ""cytochrome P450, family 71, subfamily B, polypeptide 14"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q6YV88 CYP71Z7 "Ent-cassadiene C2-hydroxylase" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
TAIR|locus:2047570 CYP71B6 "cytochrome p450 71b6" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
O48922C98A2_SOYBN1, ., 1, 4, ., -, ., -0.72220.53210.2927yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query280
PLN02687517 PLN02687, PLN02687, flavonoid 3'-monooxygenase 2e-36
PLN03112514 PLN03112, PLN03112, cytochrome P450 family protein 1e-35
PLN00110504 PLN00110, PLN00110, flavonoid 3',5'-hydroxylase (F 4e-35
PLN02183516 PLN02183, PLN02183, ferulate 5-hydroxylase 4e-33
PLN03234499 PLN03234, PLN03234, cytochrome P450 83B1; Provisio 1e-27
PLN02966502 PLN02966, PLN02966, cytochrome P450 83A1 3e-25
PLN02394503 PLN02394, PLN02394, trans-cinnamate 4-monooxygenas 1e-24
pfam00067461 pfam00067, p450, Cytochrome P450 9e-23
PLN02687 517 PLN02687, PLN02687, flavonoid 3'-monooxygenase 3e-21
PLN02183 516 PLN02183, PLN02183, ferulate 5-hydroxylase 2e-20
PLN02966 502 PLN02966, PLN02966, cytochrome P450 83A1 9e-19
PLN02655466 PLN02655, PLN02655, ent-kaurene oxidase 2e-18
PLN03112 514 PLN03112, PLN03112, cytochrome P450 family protein 7e-18
PLN03234 499 PLN03234, PLN03234, cytochrome P450 83B1; Provisio 7e-17
PLN02971543 PLN02971, PLN02971, tryptophan N-hydroxylase 1e-16
PLN02394 503 PLN02394, PLN02394, trans-cinnamate 4-monooxygenas 3e-16
PLN00168519 PLN00168, PLN00168, Cytochrome P450; Provisional 3e-15
PLN03018534 PLN03018, PLN03018, homomethionine N-hydroxylase 2e-14
COG2124411 COG2124, CypX, Cytochrome P450 [Secondary metaboli 5e-11
PLN00110 504 PLN00110, PLN00110, flavonoid 3',5'-hydroxylase (F 9e-11
PLN03018 534 PLN03018, PLN03018, homomethionine N-hydroxylase 1e-09
pfam00067 461 pfam00067, p450, Cytochrome P450 4e-09
PLN02302490 PLN02302, PLN02302, ent-kaurenoic acid oxidase 1e-07
PLN02774463 PLN02774, PLN02774, brassinosteroid-6-oxidase 7e-07
PLN02936489 PLN02936, PLN02936, epsilon-ring hydroxylase 9e-07
PLN00168 519 PLN00168, PLN00168, Cytochrome P450; Provisional 3e-06
PTZ00404 482 PTZ00404, PTZ00404, cytochrome P450; Provisional 3e-06
PLN02987472 PLN02987, PLN02987, Cytochrome P450, family 90, su 4e-06
PLN02738633 PLN02738, PLN02738, carotene beta-ring hydroxylase 2e-05
PLN02655 466 PLN02655, PLN02655, ent-kaurene oxidase 3e-05
PTZ00404482 PTZ00404, PTZ00404, cytochrome P450; Provisional 3e-05
PLN02971 543 PLN02971, PLN02971, tryptophan N-hydroxylase 4e-05
PLN03141452 PLN03141, PLN03141, 3-epi-6-deoxocathasterone 23-m 7e-05
PLN02290516 PLN02290, PLN02290, cytokinin trans-hydroxylase 3e-04
PLN02169500 PLN02169, PLN02169, fatty acid (omega-1)-hydroxyla 5e-04
PLN02426502 PLN02426, PLN02426, cytochrome P450, family 94, su 7e-04
PLN03195516 PLN03195, PLN03195, fatty acid omega-hydroxylase; 7e-04
PLN02196463 PLN02196, PLN02196, abscisic acid 8'-hydroxylase 0.001
>gnl|CDD|215371 PLN02687, PLN02687, flavonoid 3'-monooxygenase Back     alignment and domain information 
 Score =  135 bits (341), Expect = 2e-36
 Identities = 56/120 (46%), Positives = 72/120 (60%), Gaps = 4/120 (3%)

Query: 158 GSNIHVNVWAVARDPAVWKDPLEFRPERFF----EEDVDMKGHDFRLLPFGAGRRVCPGA 213
           G+ + VNVWA+ARDP  W DPLEFRP+RF        VD+KG DF L+PFGAGRR+C G 
Sbjct: 395 GATLLVNVWAIARDPEQWPDPLEFRPDRFLPGGEHAGVDVKGSDFELIPFGAGRRICAGL 454

Query: 214 QLGINLVTSMLGHLLHHFAWAPPEGVKPEEIDMSENPGLVTYMKTPLQAVPTPRLPSHLY 273
             G+ +VT +   L+H F W   +G  P++++M E  GL      PL   P PRL    Y
Sbjct: 455 SWGLRMVTLLTATLVHAFDWELADGQTPDKLNMEEAYGLTLQRAVPLMVHPRPRLLPSAY 514

Length = 517
>gnl|CDD|215583 PLN03112, PLN03112, cytochrome P450 family protein; Provisional Back     alignment and domain information
>gnl|CDD|177725 PLN00110, PLN00110, flavonoid 3',5'-hydroxylase (F3'5'H); Provisional Back     alignment and domain information
>gnl|CDD|165828 PLN02183, PLN02183, ferulate 5-hydroxylase Back     alignment and domain information
>gnl|CDD|178773 PLN03234, PLN03234, cytochrome P450 83B1; Provisional Back     alignment and domain information
>gnl|CDD|178550 PLN02966, PLN02966, cytochrome P450 83A1 Back     alignment and domain information
>gnl|CDD|215221 PLN02394, PLN02394, trans-cinnamate 4-monooxygenase Back     alignment and domain information
>gnl|CDD|215689 pfam00067, p450, Cytochrome P450 Back     alignment and domain information
>gnl|CDD|215371 PLN02687, PLN02687, flavonoid 3'-monooxygenase Back     alignment and domain information
>gnl|CDD|165828 PLN02183, PLN02183, ferulate 5-hydroxylase Back     alignment and domain information
>gnl|CDD|178550 PLN02966, PLN02966, cytochrome P450 83A1 Back     alignment and domain information
>gnl|CDD|215354 PLN02655, PLN02655, ent-kaurene oxidase Back     alignment and domain information
>gnl|CDD|215583 PLN03112, PLN03112, cytochrome P450 family protein; Provisional Back     alignment and domain information
>gnl|CDD|178773 PLN03234, PLN03234, cytochrome P450 83B1; Provisional Back     alignment and domain information
>gnl|CDD|166612 PLN02971, PLN02971, tryptophan N-hydroxylase Back     alignment and domain information
>gnl|CDD|215221 PLN02394, PLN02394, trans-cinnamate 4-monooxygenase Back     alignment and domain information
>gnl|CDD|215086 PLN00168, PLN00168, Cytochrome P450; Provisional Back     alignment and domain information
>gnl|CDD|178592 PLN03018, PLN03018, homomethionine N-hydroxylase Back     alignment and domain information
>gnl|CDD|225035 COG2124, CypX, Cytochrome P450 [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>gnl|CDD|177725 PLN00110, PLN00110, flavonoid 3',5'-hydroxylase (F3'5'H); Provisional Back     alignment and domain information
>gnl|CDD|178592 PLN03018, PLN03018, homomethionine N-hydroxylase Back     alignment and domain information
>gnl|CDD|215689 pfam00067, p450, Cytochrome P450 Back     alignment and domain information
>gnl|CDD|215171 PLN02302, PLN02302, ent-kaurenoic acid oxidase Back     alignment and domain information
>gnl|CDD|178373 PLN02774, PLN02774, brassinosteroid-6-oxidase Back     alignment and domain information
>gnl|CDD|178524 PLN02936, PLN02936, epsilon-ring hydroxylase Back     alignment and domain information
>gnl|CDD|215086 PLN00168, PLN00168, Cytochrome P450; Provisional Back     alignment and domain information
>gnl|CDD|173595 PTZ00404, PTZ00404, cytochrome P450; Provisional Back     alignment and domain information
>gnl|CDD|166628 PLN02987, PLN02987, Cytochrome P450, family 90, subfamily A Back     alignment and domain information
>gnl|CDD|215393 PLN02738, PLN02738, carotene beta-ring hydroxylase Back     alignment and domain information
>gnl|CDD|215354 PLN02655, PLN02655, ent-kaurene oxidase Back     alignment and domain information
>gnl|CDD|173595 PTZ00404, PTZ00404, cytochrome P450; Provisional Back     alignment and domain information
>gnl|CDD|166612 PLN02971, PLN02971, tryptophan N-hydroxylase Back     alignment and domain information
>gnl|CDD|215600 PLN03141, PLN03141, 3-epi-6-deoxocathasterone 23-monooxygenase; Provisional Back     alignment and domain information
>gnl|CDD|215164 PLN02290, PLN02290, cytokinin trans-hydroxylase Back     alignment and domain information
>gnl|CDD|177826 PLN02169, PLN02169, fatty acid (omega-1)-hydroxylase/midchain alkane hydroxylase Back     alignment and domain information
>gnl|CDD|215235 PLN02426, PLN02426, cytochrome P450, family 94, subfamily C protein Back     alignment and domain information
>gnl|CDD|215627 PLN03195, PLN03195, fatty acid omega-hydroxylase; Provisional Back     alignment and domain information
>gnl|CDD|177847 PLN02196, PLN02196, abscisic acid 8'-hydroxylase Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 280
KOG0156489 consensus Cytochrome P450 CYP2 subfamily [Secondar 100.0
KOG0158499 consensus Cytochrome P450 CYP3/CYP5/CYP6/CYP9 subf 100.0
PLN02687517 flavonoid 3'-monooxygenase 100.0
PLN02183516 ferulate 5-hydroxylase 100.0
PLN03234499 cytochrome P450 83B1; Provisional 100.0
PLN00110504 flavonoid 3',5'-hydroxylase (F3'5'H); Provisional 100.0
PLN03112514 cytochrome P450 family protein; Provisional 100.0
PLN02971543 tryptophan N-hydroxylase 100.0
PLN02394503 trans-cinnamate 4-monooxygenase 100.0
PLN00168519 Cytochrome P450; Provisional 100.0
PLN02966502 cytochrome P450 83A1 100.0
PTZ00404482 cytochrome P450; Provisional 100.0
PLN02290516 cytokinin trans-hydroxylase 100.0
PLN02655466 ent-kaurene oxidase 100.0
PLN02774463 brassinosteroid-6-oxidase 100.0
PLN02500490 cytochrome P450 90B1 100.0
KOG0157497 consensus Cytochrome P450 CYP4/CYP19/CYP26 subfami 100.0
PLN02196463 abscisic acid 8'-hydroxylase 100.0
PLN03018534 homomethionine N-hydroxylase 100.0
PF00067463 p450: Cytochrome P450 p450 superfamily signature b 100.0
PLN03141452 3-epi-6-deoxocathasterone 23-monooxygenase; Provis 100.0
PLN02987472 Cytochrome P450, family 90, subfamily A 100.0
PLN02302490 ent-kaurenoic acid oxidase 100.0
PLN02169500 fatty acid (omega-1)-hydroxylase/midchain alkane h 100.0
KOG0684486 consensus Cytochrome P450 [Secondary metabolites b 100.0
KOG0159519 consensus Cytochrome P450 CYP11/CYP12/CYP24/CYP27 100.0
PLN03195516 fatty acid omega-hydroxylase; Provisional 100.0
PLN02738633 carotene beta-ring hydroxylase 100.0
PLN02936489 epsilon-ring hydroxylase 100.0
PLN02426502 cytochrome P450, family 94, subfamily C protein 99.97
PLN02648480 allene oxide synthase 99.96
COG2124411 CypX Cytochrome P450 [Secondary metabolites biosyn 99.92
>KOG0156 consensus Cytochrome P450 CYP2 subfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information 
Probab=100.00  E-value=3.2e-48  Score=336.68  Aligned_cols=239  Identities=42%  Similarity=0.804  Sum_probs=207.3

Q ss_pred             CCCCCCCCCCCCccccccCCCCc-hhHHHHHHHHHhCccchH-------------HHHHHHHHHcCCCCCCCCC-ccccc
Q 036917           24 RFNLPPGPRPLPIVGNLYDIKPV-RFRCFAEWAQQYGQSFRF-------------ELAREVLKEHDQQLADRHR-SRSAA   88 (280)
Q Consensus        24 ~~~~pPgP~~~p~lG~~~~~~~~-~~~~~~~~~~kyG~v~~~-------------~~~~~il~~~~~~f~~r~~-~~~~~   88 (280)
                      +.++||||.+||+|||++++... +|+.+.+|+++|||||++             +.++|++++++..|++||. .....
T Consensus        24 ~~~lPPGP~~lPiIGnl~~l~~~~~h~~~~~ls~~yGpi~tl~lG~~~~Vviss~~~akE~l~~~d~~fa~Rp~~~~~~~  103 (489)
T KOG0156|consen   24 RRNLPPGPPPLPIIGNLHQLGSLPPHRSFRKLSKKYGPVFTLRLGSVPVVVISSYEAAKEVLVKQDLEFADRPDPTATLK  103 (489)
T ss_pred             CCCCCcCCCCCCccccHHHcCCCchhHHHHHHHHHhCCeEEEEecCceEEEECCHHHHHHHHHhCCccccCCCCchhhHH
Confidence            37999999999999999999776 999999999999999987             9999999999999999997 23447


Q ss_pred             cccCCCCceEEccCCchHHHHHhhhhhcccChHHHhhhhHHHHHHHHHHHHHHhhcCC-CCeee--------------ee
Q 036917           89 KFSRDGKDLIWADYGPHYVKVRKVCTLELFTPKRLEALRPIREDEVTAMVESIFKDCT-DPHNF--------------VA  153 (280)
Q Consensus        89 ~~~~~~~~~~~~~~g~~w~~~R~~~~~~~~~~~~l~~~~~~~~~~~~~l~~~l~~~~~-~~~~~--------------~~  153 (280)
                      .+..++.+++++.||+.|+.+||++...+++.+.++.......++++.+++.+.+... ..+++              +.
T Consensus       104 ~~~~~~~~i~~a~yG~~Wr~~Rr~~~~~L~~~~~~~~~~~~R~~E~~~l~~~l~~~~~~~~vdl~~~l~~~~~nvI~~~~  183 (489)
T KOG0156|consen  104 YLSYGGKGIVFAPYGDYWREMRRFALTELRSFGRGKSFMEIREEEVDELVKKLSKSKKGEPVDLSELLDLLVGNVICRML  183 (489)
T ss_pred             HhcCCCCceEeCCCcHHHHHHHHHHHHHhcChhhhhhhHHHHHHHHHHHHHHHHhcCCCceeeHHHHHHHHHHHHHHHHH
Confidence            7777778999999999999999999999999999999988889999999999986111 34444              11


Q ss_pred             ec------------------------------------------------------------------------------
Q 036917          154 FT------------------------------------------------------------------------------  155 (280)
Q Consensus       154 ~~------------------------------------------------------------------------------  155 (280)
                      ++                                                                              
T Consensus       184 fG~rf~~~~~~~~~~~~~l~~~~~~~~~~~~~~d~~p~~l~~~~~~~g~~~~~~~~~~~~~~~~~~~i~eh~~~~~~~~~  263 (489)
T KOG0156|consen  184 FGRRFEEEDEEEFLELKELVEESLELLGSFNLSDYFPFLLRWLDGISGLEKRLKKVSKRLDEFLERIIDEHREKIGDEEG  263 (489)
T ss_pred             hCCccccCCchHHHHHHHHHHHHHHHhCCccHHHHhhHHHHhcccccHHHHHHHHHHHHHHHHHHHHHHHHHhhhccCCC
Confidence            11                                                                              


Q ss_pred             --------------------------------------------------------------------------------
Q 036917          156 --------------------------------------------------------------------------------  155 (280)
Q Consensus       156 --------------------------------------------------------------------------------  155 (280)
                                                                                                      
T Consensus       264 ~D~vD~lL~~~~~~~~~~~t~~~i~~~~~dl~~AGtdTta~Tl~Wa~a~Ll~~Pev~~K~qeEId~vvG~~r~v~e~D~~  343 (489)
T KOG0156|consen  264 RDFVDALLKLMKEEKAEGLTDDHLKALILDLFLAGTDTTATTLEWAMAELLNNPEVQKKLQEEIDEVVGKGRLVSESDLP  343 (489)
T ss_pred             CcHHHHHHHhhcccccCCCCHHHHHHHHHHHHhcccchHHHHHHHHHHHHHhCHHHHHHHHHHHHHHhCCCCCCChhhhc
Confidence                                                                                            


Q ss_pred             --------------------------------------CCcceEEEeeehhccCCCCCCCCCCCCCCcccccCcCCCCCC
Q 036917          156 --------------------------------------LSGSNIHVNVWAVARDPAVWKDPLEFRPERFFEEDVDMKGHD  197 (280)
Q Consensus       156 --------------------------------------pkgt~v~~~~~~~~~d~~~~~~~~~F~peR~l~~~~~~~~~~  197 (280)
                                                            ||||.|+++.|++|+||.+|+||++|+||||++++ +.+...
T Consensus       344 ~lpYL~Avi~E~~Rl~p~~Pl~~ph~~~~d~~i~Gy~IPkgT~v~vn~~ai~rDp~vw~dP~eF~PERFl~~~-d~~~~~  422 (489)
T KOG0156|consen  344 KLPYLKAVIKETLRLHPPLPLLLPRETTEDTKIGGYDIPKGTTVLVNLWAIHRDPKVWEDPEEFKPERFLDSN-DGKGLD  422 (489)
T ss_pred             cCHHHHHHHHHHHhcCCCccccccccccCCeeEcCEEcCCCCEEEEeehhhhcCCccCCCccccChhhhcCCc-cccCCc
Confidence                                                  99999999999999999999999999999999985 222356


Q ss_pred             CccccCCCCCCCCccHHHHHHHHHHHHHHHHHHccccCCCCCCCCCCCCCCCCCccccccCCceEeeeecC
Q 036917          198 FRLLPFGAGRRVCPGAQLGINLVTSMLGHLLHHFAWAPPEGVKPEEIDMSENPGLVTYMKTPLQAVPTPRL  268 (280)
Q Consensus       198 ~~~~~Fg~G~r~C~G~~~A~~e~~~~l~~ll~~f~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~R~  268 (280)
                      ..++|||.|+|.|||..+|++++.+++++|+++|+|+++++    +++.++.. +++.+..|+.....+|.
T Consensus       423 ~~~iPFG~GRR~CpG~~La~~~l~l~la~llq~F~w~~~~~----~~d~~e~~-~~~~~~~pl~~~~~~r~  488 (489)
T KOG0156|consen  423 FKLIPFGSGRRICPGEGLARAELFLFLANLLQRFDWKLPGG----KVDMEEAG-LTLKKKKPLKAVPVPRL  488 (489)
T ss_pred             eEecCCCCCcCCCCcHHHHHHHHHHHHHHHHheeeeecCCC----CCCCcccc-cceecCCcceeeeecCC
Confidence            68999999999999999999999999999999999999977    44555554 66777789999888874

>KOG0158 consensus Cytochrome P450 CYP3/CYP5/CYP6/CYP9 subfamilies [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PLN02687 flavonoid 3'-monooxygenase Back     alignment and domain information
>PLN02183 ferulate 5-hydroxylase Back     alignment and domain information
>PLN03234 cytochrome P450 83B1; Provisional Back     alignment and domain information
>PLN00110 flavonoid 3',5'-hydroxylase (F3'5'H); Provisional Back     alignment and domain information
>PLN03112 cytochrome P450 family protein; Provisional Back     alignment and domain information
>PLN02971 tryptophan N-hydroxylase Back     alignment and domain information
>PLN02394 trans-cinnamate 4-monooxygenase Back     alignment and domain information
>PLN00168 Cytochrome P450; Provisional Back     alignment and domain information
>PLN02966 cytochrome P450 83A1 Back     alignment and domain information
>PTZ00404 cytochrome P450; Provisional Back     alignment and domain information
>PLN02290 cytokinin trans-hydroxylase Back     alignment and domain information
>PLN02655 ent-kaurene oxidase Back     alignment and domain information
>PLN02774 brassinosteroid-6-oxidase Back     alignment and domain information
>PLN02500 cytochrome P450 90B1 Back     alignment and domain information
>KOG0157 consensus Cytochrome P450 CYP4/CYP19/CYP26 subfamilies [Secondary metabolites biosynthesis, transport and catabolism; Lipid transport and metabolism] Back     alignment and domain information
>PLN02196 abscisic acid 8'-hydroxylase Back     alignment and domain information
>PLN03018 homomethionine N-hydroxylase Back     alignment and domain information
>PF00067 p450: Cytochrome P450 p450 superfamily signature b-class p450 signature mitochondrial p450 signature E-class p450 group I signature E-class p450 group II signature E-class p450 group IV signature; InterPro: IPR001128 Cytochrome P450 enzymes are a superfamily of haem-containing mono-oxygenases that are found in all kingdoms of life, and which show extraordinary diversity in their reaction chemistry Back     alignment and domain information
>PLN03141 3-epi-6-deoxocathasterone 23-monooxygenase; Provisional Back     alignment and domain information
>PLN02987 Cytochrome P450, family 90, subfamily A Back     alignment and domain information
>PLN02302 ent-kaurenoic acid oxidase Back     alignment and domain information
>PLN02169 fatty acid (omega-1)-hydroxylase/midchain alkane hydroxylase Back     alignment and domain information
>KOG0684 consensus Cytochrome P450 [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>KOG0159 consensus Cytochrome P450 CYP11/CYP12/CYP24/CYP27 subfamilies [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PLN03195 fatty acid omega-hydroxylase; Provisional Back     alignment and domain information
>PLN02738 carotene beta-ring hydroxylase Back     alignment and domain information
>PLN02936 epsilon-ring hydroxylase Back     alignment and domain information
>PLN02426 cytochrome P450, family 94, subfamily C protein Back     alignment and domain information
>PLN02648 allene oxide synthase Back     alignment and domain information
>COG2124 CypX Cytochrome P450 [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query280
3hf2_A482 Crystal Structure Of The I401p Mutant Of Cytochrome 2e-06
3psx_A487 Crystal Structure Of The Kt2 Mutant Of Cytochrome P 1e-05
3kx4_A470 Crystal Structure Of Bacillus Megaterium Bm3 Heme D 2e-05
4du2_B470 Cytochrome P450 Bm3h-B7 Mri Sensor Bound To Dopamin 2e-05
3qi8_B472 Evolved Variant Of Cytochrome P450 (Bm3, Cyp102a1) 2e-05
1smi_A471 A Single Mutation Of P450 Bm3 Induces The Conformat 2e-05
2hpd_A471 Crystal Structure Of Hemoprotein Domain Of P450bm-3 2e-05
4dua_A471 Cytochrome P450 Bm3h-9d7 Mri Sensor, No Ligand Leng 2e-05
4dtw_B469 Cytochrome P450 Bm3h-8c8 Mri Sensor Bound To Seroto 2e-05
3ekf_A470 Crystal Structure Of The A264q Heme Domain Of Cytoc 2e-05
3ekb_A470 Crystal Structure Of The A264c Mutant Heme Domain O 2e-05
3ekd_A470 Crystal Structure Of The A264m Heme Domain Of Cytoc 2e-05
4dub_A472 Cytochrome P450 Bm3h-9d7 Mri Sensor Bound To Dopami 2e-05
2nnb_A471 The Q403k Mutnat Heme Domain Of Flavocytochrome P45 2e-05
2ij4_A470 Structure Of The A264k Mutant Of Cytochrome P450 Bm 2e-05
1jpz_A473 Crystal Structure Of A Complex Of The Heme Domain O 2e-05
2ij3_A470 Structure Of The A264h Mutant Of Cytochrome P450 Bm 2e-05
1zoa_A473 Crystal Structure Of A328v Mutant Of The Heme Domai 2e-05
1zo4_A473 Crystal Structure Of A328s Mutant Of The Heme Domai 3e-05
3kx5_A470 Crystal Structure Of Bacillus Megaterium Bm3 Heme D 3e-05
3m4v_A482 Crystal Structure Of The A330p Mutant Of Cytochrome 3e-05
3kx3_A470 Crystal Structure Of Bacillus Megaterium Bm3 Heme D 3e-05
3ben_A470 Structure Of N-(12-Imidazolyl-Dodecanoyl)-L-Leucine 3e-05
2ij2_A470 Atomic Structure Of The Heme Domain Of Flavocytochr 3e-05
1fah_A471 Structure Of Cytochrome P450 Length = 471 3e-05
4dud_A471 Cytochrome P450 Bm3h-2g9c6 Mri Sensor, No Ligand Le 3e-05
4duc_A472 Cytochrome P450 Bm3h-2g9 Mri Sensor, No Ligand Leng 3e-05
4duf_A471 Cytochrome P450 Bm3h-2g9 Mri Sensor Bound To Seroto 3e-05
3npl_A470 Structure Of Ru(Bpy)2(A-Phen)(K97c) P450 Bm3 Heme D 3e-05
2f9q_A479 Crystal Structure Of Human Cytochrome P450 2d6 Leng 4e-05
3qm4_A479 Human Cytochrome P450 (Cyp) 2d6 - Prinomastat Compl 4e-05
3cbd_A455 Directed Evolution Of Cytochrome P450 Bm3, To Octan 3e-04
1yqo_A455 T268a Mutant Heme Domain Of Flavocytochrome P450 Bm 4e-04
2bmh_A455 Modeling Protein-Substrate Interactions In The Heme 4e-04
1yqp_A455 T268n Mutant Cytochrome Domain Of Flavocytochrome P 4e-04
3dgi_A461 Crystal Structure Of F87aT268A MUTANT OF CYP BM3 Le 4e-04
2x7y_A455 P450 Bm3 F87a In Complex With Dmso Length = 455 4e-04
2uwh_A458 Cytochrome P450 Bm3 Mutant In Complex With Palmitic 4e-04
1bvy_A458 Complex Of The Heme And Fmn-Binding Domains Of The 5e-04
>pdb|3HF2|A Chain A, Crystal Structure Of The I401p Mutant Of Cytochrome P450 Bm3 Length = 482 Back     alignment and structure 
Iteration: 1

 Score = 49.3 bits (116), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 34/117 (29%), Positives = 52/117 (44%), Gaps = 13/117 (11%)
Query: 158 GSNIHVNVWAVARDPAVWKDPLXXXXXXXXXXDVDMKGHDFRLLPFGAGRRVCPGAQLGI 217
           G  + V +  + RD  +W D +             +  H F+  PFG G+R CPG Q  +
Sbjct: 351 GDELMVLIPQLHRDKTIWGDDVEEFRPERFENPSAIPQHAFK--PFGNGQRACPGQQFAL 408
Query: 218 NLVTSMLGHLLHHFAWAPPEGVKPEEIDMSEN-----PGLVTYMKT---PLQAVPTP 266
           +  T +LG +L HF +   E     E+D+ E       G V   K+   PL  +P+P
Sbjct: 409 HEATLVLGMMLKHFDF---EDHTNYELDIKETLTLKPEGFVVKAKSKKIPLGGIPSP 462
>pdb|3PSX|A Chain A, Crystal Structure Of The Kt2 Mutant Of Cytochrome P450 Bm3 Length = 487 Back     alignment and structure
>pdb|3KX4|A Chain A, Crystal Structure Of Bacillus Megaterium Bm3 Heme Domain Mut Length = 470 Back     alignment and structure
>pdb|4DU2|B Chain B, Cytochrome P450 Bm3h-B7 Mri Sensor Bound To Dopamine Length = 470 Back     alignment and structure
>pdb|3QI8|B Chain B, Evolved Variant Of Cytochrome P450 (Bm3, Cyp102a1) Length = 472 Back     alignment and structure
>pdb|1SMI|A Chain A, A Single Mutation Of P450 Bm3 Induces The Conformational Rearrangement Seen Upon Substrate-Binding In Wild-Type Enzyme Length = 471 Back     alignment and structure
>pdb|2HPD|A Chain A, Crystal Structure Of Hemoprotein Domain Of P450bm-3, A Prototype For Microsomal P450's Length = 471 Back     alignment and structure
>pdb|4DUA|A Chain A, Cytochrome P450 Bm3h-9d7 Mri Sensor, No Ligand Length = 471 Back     alignment and structure
>pdb|4DTW|B Chain B, Cytochrome P450 Bm3h-8c8 Mri Sensor Bound To Serotonin Length = 469 Back     alignment and structure
>pdb|3EKF|A Chain A, Crystal Structure Of The A264q Heme Domain Of Cytochrome P450 Bm3 Length = 470 Back     alignment and structure
>pdb|3EKB|A Chain A, Crystal Structure Of The A264c Mutant Heme Domain Of Cytochrome P450 Bm3 Length = 470 Back     alignment and structure
>pdb|3EKD|A Chain A, Crystal Structure Of The A264m Heme Domain Of Cytochrome P450 Bm3 Length = 470 Back     alignment and structure
>pdb|4DUB|A Chain A, Cytochrome P450 Bm3h-9d7 Mri Sensor Bound To Dopamine Length = 472 Back     alignment and structure
>pdb|2NNB|A Chain A, The Q403k Mutnat Heme Domain Of Flavocytochrome P450 Bm3 Length = 471 Back     alignment and structure
>pdb|2IJ4|A Chain A, Structure Of The A264k Mutant Of Cytochrome P450 Bm3 Length = 470 Back     alignment and structure
>pdb|1JPZ|A Chain A, Crystal Structure Of A Complex Of The Heme Domain Of P450bm- 3 With N-Palmitoylglycine Length = 473 Back     alignment and structure
>pdb|2IJ3|A Chain A, Structure Of The A264h Mutant Of Cytochrome P450 Bm3 Length = 470 Back     alignment and structure
>pdb|1ZOA|A Chain A, Crystal Structure Of A328v Mutant Of The Heme Domain Of P450bm-3 With N-Palmitoylglycine Length = 473 Back     alignment and structure
>pdb|1ZO4|A Chain A, Crystal Structure Of A328s Mutant Of The Heme Domain Of P450bm-3 Length = 473 Back     alignment and structure
>pdb|3KX5|A Chain A, Crystal Structure Of Bacillus Megaterium Bm3 Heme Domain Mut Length = 470 Back     alignment and structure
>pdb|3M4V|A Chain A, Crystal Structure Of The A330p Mutant Of Cytochrome P450 Bm3 Length = 482 Back     alignment and structure
>pdb|3KX3|A Chain A, Crystal Structure Of Bacillus Megaterium Bm3 Heme Domain Mut Length = 470 Back     alignment and structure
>pdb|3BEN|A Chain A, Structure Of N-(12-Imidazolyl-Dodecanoyl)-L-Leucine Inhibitor Bound To The Heme Domain Of Cytochrome P450-Bm3 Length = 470 Back     alignment and structure
>pdb|2IJ2|A Chain A, Atomic Structure Of The Heme Domain Of Flavocytochrome P450- Bm3 Length = 470 Back     alignment and structure
>pdb|1FAH|A Chain A, Structure Of Cytochrome P450 Length = 471 Back     alignment and structure
>pdb|4DUD|A Chain A, Cytochrome P450 Bm3h-2g9c6 Mri Sensor, No Ligand Length = 471 Back     alignment and structure
>pdb|4DUC|A Chain A, Cytochrome P450 Bm3h-2g9 Mri Sensor, No Ligand Length = 472 Back     alignment and structure
>pdb|4DUF|A Chain A, Cytochrome P450 Bm3h-2g9 Mri Sensor Bound To Serotonin Length = 471 Back     alignment and structure
>pdb|3NPL|A Chain A, Structure Of Ru(Bpy)2(A-Phen)(K97c) P450 Bm3 Heme Domain, A Ruthenium Modified P450 Bm3 Mutant Length = 470 Back     alignment and structure
>pdb|2F9Q|A Chain A, Crystal Structure Of Human Cytochrome P450 2d6 Length = 479 Back     alignment and structure
>pdb|3QM4|A Chain A, Human Cytochrome P450 (Cyp) 2d6 - Prinomastat Complex Length = 479 Back     alignment and structure
>pdb|3CBD|A Chain A, Directed Evolution Of Cytochrome P450 Bm3, To Octane Monoxygenase 139-3 Length = 455 Back     alignment and structure
>pdb|1YQO|A Chain A, T268a Mutant Heme Domain Of Flavocytochrome P450 Bm3 Length = 455 Back     alignment and structure
>pdb|2BMH|A Chain A, Modeling Protein-Substrate Interactions In The Heme Domain Of Cytochrome P450bm-3 Length = 455 Back     alignment and structure
>pdb|1YQP|A Chain A, T268n Mutant Cytochrome Domain Of Flavocytochrome P450 Bm3 Length = 455 Back     alignment and structure
>pdb|3DGI|A Chain A, Crystal Structure Of F87aT268A MUTANT OF CYP BM3 Length = 461 Back     alignment and structure
>pdb|2X7Y|A Chain A, P450 Bm3 F87a In Complex With Dmso Length = 455 Back     alignment and structure
>pdb|2UWH|A Chain A, Cytochrome P450 Bm3 Mutant In Complex With Palmitic Acid Length = 458 Back     alignment and structure
>pdb|1BVY|A Chain A, Complex Of The Heme And Fmn-Binding Domains Of The Cytochrome P450(Bm-3) Length = 458 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query280
3b98_A475 Prostaglandin I2 synthase; prostacyclin synthase, 2e-41
3b98_A 475 Prostaglandin I2 synthase; prostacyclin synthase, 2e-20
3dax_A491 Cytochrome P450 7A1; cholesterol, cholesterol 7-al 2e-37
3dax_A 491 Cytochrome P450 7A1; cholesterol, cholesterol 7-al 2e-17
3k9v_A482 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitocho 4e-33
3k9v_A 482 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitocho 3e-22
3n9y_A487 Cholesterol SIDE-chain cleavage enzyme; cytochrome 8e-33
3n9y_A 487 Cholesterol SIDE-chain cleavage enzyme; cytochrome 5e-24
2cib_A455 Cytochrome P450 51; heme, heme lipid synthesis, me 2e-26
2cib_A 455 Cytochrome P450 51; heme, heme lipid synthesis, me 8e-09
3b6h_A498 Prostacyclin synthase; enzyme-inhibitor complex, C 2e-25
3b6h_A 498 Prostacyclin synthase; enzyme-inhibitor complex, C 3e-08
3qz1_A496 Steroid 21-hydroxylase; P450 monooxygenase, oxidor 7e-23
3qz1_A 496 Steroid 21-hydroxylase; P450 monooxygenase, oxidor 3e-16
3awm_A415 Fatty acid alpha-hydroxylase; cytochrome P450, per 4e-20
3awm_A 415 Fatty acid alpha-hydroxylase; cytochrome P450, per 2e-06
2hi4_A495 Cytochrome P450 1A2; CYP1A2, monooxygenase, drug m 1e-19
2hi4_A 495 Cytochrome P450 1A2; CYP1A2, monooxygenase, drug m 4e-15
3s79_A503 Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD 1e-19
3s79_A 503 Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD 7e-14
3pm0_A507 Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase 2e-19
3pm0_A 507 Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase 2e-16
3i3k_A461 Lanosterol 14-alpha demethylase; cytochrome P450, 4e-19
3i3k_A 461 Lanosterol 14-alpha demethylase; cytochrome P450, 2e-05
1izo_A417 P450bsbeta, cytochrome P450 152A1; heme protein, p 5e-19
1izo_A 417 P450bsbeta, cytochrome P450 152A1; heme protein, p 1e-05
3czh_A481 Cytochrome P450 2R1; vitamin D, vitamin S 25-hydro 7e-19
3czh_A 481 Cytochrome P450 2R1; vitamin D, vitamin S 25-hydro 4e-14
3tbg_A479 Cytochrome P450 2D6; monooxygenase, thioridazine, 9e-19
3tbg_A 479 Cytochrome P450 2D6; monooxygenase, thioridazine, 2e-12
2ve3_A444 Putative cytochrome P450 120; oxidoreductase, mono 2e-18
2ve3_A 444 Putative cytochrome P450 120; oxidoreductase, mono 3e-06
3dbg_A467 Putative cytochrome P450; cytochrome P450 oxidored 5e-18
3dbg_A 467 Putative cytochrome P450; cytochrome P450 oxidored 9e-06
1po5_A476 Cytochrome P450 2B4; oxidoreductase, membrane prot 5e-18
1po5_A 476 Cytochrome P450 2B4; oxidoreductase, membrane prot 1e-10
3swz_A494 Steroid 17-alpha-hydroxylase/17,20 lyase; cytochro 7e-18
3swz_A 494 Steroid 17-alpha-hydroxylase/17,20 lyase; cytochro 2e-17
2fdv_A476 Cytochrome P450 2A6; CYP2A6, monooxygenase, drug m 8e-18
2fdv_A 476 Cytochrome P450 2A6; CYP2A6, monooxygenase, drug m 2e-10
1r9o_A477 Cytochrome P450 2C9; monooxygenase, drug metaboliz 2e-17
1r9o_A 477 Cytochrome P450 2C9; monooxygenase, drug metaboliz 1e-10
3gw9_A450 Sterol 14alpha-demethylase; CYP51, cytochrome P450 5e-17
3gw9_A 450 Sterol 14alpha-demethylase; CYP51, cytochrome P450 4e-04
3e6i_A476 CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, mono 5e-17
3e6i_A 476 CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, mono 5e-10
3mdm_A456 Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, th 2e-16
1n97_A389 CYP175A1; electron transport; HET: SRT HEM; 1.80A 2e-15
3dsk_A495 Cytochrome P450 74A, chloroplast; P450 fold, fatty 1e-13
3dan_A473 Cytochrome P450 74A2; AOS heme cytochrome P450 str 2e-13
2ij2_A470 Cytochrome P450 BM3; monoxygenase, heme binding pr 3e-13
2ij2_A 470 Cytochrome P450 BM3; monoxygenase, heme binding pr 1e-07
3nxu_A485 Cytochrome P450 3A4; alpha beta protein, cytochrom 3e-12
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-04
>3b98_A Prostaglandin I2 synthase; prostacyclin synthase, cytochrome P450 8A1, CYP8A1, isomerase; HET: HEM; 2.08A {Danio rerio} PDB: 3b99_A* Length = 475 Back     alignment and structure
 Score =  147 bits (374), Expect = 2e-41
 Identities = 21/124 (16%), Positives = 42/124 (33%), Gaps = 10/124 (8%)

Query: 158 GSNIHVNVW-AVARDPAVWKDPLEFRPERFFEEDVDMKGH--------DFRLLPFGAGRR 208
           G  + V  + +   DP + + P  F+ +RF   D   K           +  +P+G    
Sbjct: 351 GDRLCVFPFISPQMDPQIHQQPEMFQFDRFLNADRTEKKDFFKNGARVKYPSVPWGTEDN 410

Query: 209 VCPGAQLGINLVTSMLGHLLHHFAWAPPEGVKPEEIDMSENPGL-VTYMKTPLQAVPTPR 267
           +CPG    ++ +  ++  +L  F     +      +      G  +      L+     R
Sbjct: 411 LCPGRHFAVHAIKELVFTILTRFDVELCDKNATVPLVDPSRYGFGILQPAGDLEIRYRIR 470

Query: 268 LPSH 271
              H
Sbjct: 471 FHHH 474
>3b98_A Prostaglandin I2 synthase; prostacyclin synthase, cytochrome P450 8A1, CYP8A1, isomerase; HET: HEM; 2.08A {Danio rerio} PDB: 3b99_A* Length = 475 Back     alignment and structure
>3dax_A Cytochrome P450 7A1; cholesterol, cholesterol 7-alpha hydroxylase, structural genomics, structural genomics consortium, SGC, cholesterol metabolism; HET: HEM; 2.15A {Homo sapiens} PDB: 3sn5_A* Length = 491 Back     alignment and structure
>3dax_A Cytochrome P450 7A1; cholesterol, cholesterol 7-alpha hydroxylase, structural genomics, structural genomics consortium, SGC, cholesterol metabolism; HET: HEM; 2.15A {Homo sapiens} PDB: 3sn5_A* Length = 491 Back     alignment and structure
>3k9v_A 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial; mitochondrial cytochrome P450, monotopic membrane protein, monooxygenase; HET: HEM CPS; 2.50A {Rattus norvegicus} PDB: 3k9y_A* Length = 482 Back     alignment and structure
>3k9v_A 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial; mitochondrial cytochrome P450, monotopic membrane protein, monooxygenase; HET: HEM CPS; 2.50A {Rattus norvegicus} PDB: 3k9y_A* Length = 482 Back     alignment and structure
>3n9y_A Cholesterol SIDE-chain cleavage enzyme; cytochrome P450, cholesterol SIDE chain cleavage, structural genomics, structural genomics consortium, SGC; HET: HEM CLR; 2.10A {Homo sapiens} PDB: 3n9z_A* 3na1_A* 3na0_A* 3mzs_A* Length = 487 Back     alignment and structure
>3n9y_A Cholesterol SIDE-chain cleavage enzyme; cytochrome P450, cholesterol SIDE chain cleavage, structural genomics, structural genomics consortium, SGC; HET: HEM CLR; 2.10A {Homo sapiens} PDB: 3n9z_A* 3na1_A* 3na0_A* 3mzs_A* Length = 487 Back     alignment and structure
>2cib_A Cytochrome P450 51; heme, heme lipid synthesis, metal-binding, monooxygenase, NADP, oxidoreductase, protein-inhibitor complex; HET: HEM CM6; 1.50A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 2bz9_A* 1x8v_A* 2ci0_A* 2vku_A* 2w09_A* 2w0b_A* 2w0a_A* 1h5z_A* 1ea1_A* 1e9x_A* 1u13_A* Length = 455 Back     alignment and structure
>2cib_A Cytochrome P450 51; heme, heme lipid synthesis, metal-binding, monooxygenase, NADP, oxidoreductase, protein-inhibitor complex; HET: HEM CM6; 1.50A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 2bz9_A* 1x8v_A* 2ci0_A* 2vku_A* 2w09_A* 2w0b_A* 2w0a_A* 1h5z_A* 1ea1_A* 1e9x_A* 1u13_A* Length = 455 Back     alignment and structure
>3b6h_A Prostacyclin synthase; enzyme-inhibitor complex, CYP8A1, cytochrome P450, endoplasmic reticulum, fatty acid biosynthesis, heme, iron, isomerase; HET: BOG MXD HEM; 1.62A {Homo sapiens} PDB: 2iag_A* Length = 498 Back     alignment and structure
>3b6h_A Prostacyclin synthase; enzyme-inhibitor complex, CYP8A1, cytochrome P450, endoplasmic reticulum, fatty acid biosynthesis, heme, iron, isomerase; HET: BOG MXD HEM; 1.62A {Homo sapiens} PDB: 2iag_A* Length = 498 Back     alignment and structure
>3qz1_A Steroid 21-hydroxylase; P450 monooxygenase, oxidoreductase; HET: HEM 3QZ; 3.00A {Bos taurus} Length = 496 Back     alignment and structure
>3qz1_A Steroid 21-hydroxylase; P450 monooxygenase, oxidoreductase; HET: HEM 3QZ; 3.00A {Bos taurus} Length = 496 Back     alignment and structure
>3awm_A Fatty acid alpha-hydroxylase; cytochrome P450, peroxygenase, oxidoreductase; HET: HEM PLM; 1.65A {Sphingomonas paucimobilis} PDB: 3awq_A* 3awp_A* Length = 415 Back     alignment and structure
>3awm_A Fatty acid alpha-hydroxylase; cytochrome P450, peroxygenase, oxidoreductase; HET: HEM PLM; 1.65A {Sphingomonas paucimobilis} PDB: 3awq_A* 3awp_A* Length = 415 Back     alignment and structure
>2hi4_A Cytochrome P450 1A2; CYP1A2, monooxygenase, drug metabolizing enzyme, alpha-naphthoflavone, benzo(H)flavone, 7,8- benzoflavone, oxidoreductase; HET: HEM BHF; 1.95A {Homo sapiens} Length = 495 Back     alignment and structure
>2hi4_A Cytochrome P450 1A2; CYP1A2, monooxygenase, drug metabolizing enzyme, alpha-naphthoflavone, benzo(H)flavone, 7,8- benzoflavone, oxidoreductase; HET: HEM BHF; 1.95A {Homo sapiens} Length = 495 Back     alignment and structure
>3s79_A Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD; 2.75A {Homo sapiens} PDB: 3eqm_A* 3s7s_A* Length = 503 Back     alignment and structure
>3s79_A Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD; 2.75A {Homo sapiens} PDB: 3eqm_A* 3s7s_A* Length = 503 Back     alignment and structure
>3pm0_A Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase, alpha-naphthoflavone, 17BETA-estradiol, oxidoreductase; HET: HEM BHF; 2.70A {Homo sapiens} Length = 507 Back     alignment and structure
>3pm0_A Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase, alpha-naphthoflavone, 17BETA-estradiol, oxidoreductase; HET: HEM BHF; 2.70A {Homo sapiens} Length = 507 Back     alignment and structure
>1izo_A P450bsbeta, cytochrome P450 152A1; heme protein, protein-fatty acid complex, riken structural genomics/proteomics initiative, RSGI; HET: HEM PAM; 2.10A {Bacillus subtilis} SCOP: a.104.1.1 PDB: 2zqj_A* 2zqx_A* Length = 417 Back     alignment and structure
>1izo_A P450bsbeta, cytochrome P450 152A1; heme protein, protein-fatty acid complex, riken structural genomics/proteomics initiative, RSGI; HET: HEM PAM; 2.10A {Bacillus subtilis} SCOP: a.104.1.1 PDB: 2zqj_A* 2zqx_A* Length = 417 Back     alignment and structure
>3czh_A Cytochrome P450 2R1; vitamin D, vitamin S 25-hydroxylase, drug metabolism, structural genomics, structural genomics consortium, SGC; HET: BCD HEM D2V; 2.30A {Homo sapiens} SCOP: a.104.1.1 PDB: 2ojd_A* 3c6g_A* 3dl9_A* Length = 481 Back     alignment and structure
>3czh_A Cytochrome P450 2R1; vitamin D, vitamin S 25-hydroxylase, drug metabolism, structural genomics, structural genomics consortium, SGC; HET: BCD HEM D2V; 2.30A {Homo sapiens} SCOP: a.104.1.1 PDB: 2ojd_A* 3c6g_A* 3dl9_A* Length = 481 Back     alignment and structure
>3tbg_A Cytochrome P450 2D6; monooxygenase, thioridazine, oxidoreductase; HET: RTZ HEM; 2.10A {Homo sapiens} PDB: 3qm4_A* 2f9q_A* Length = 479 Back     alignment and structure
>3tbg_A Cytochrome P450 2D6; monooxygenase, thioridazine, oxidoreductase; HET: RTZ HEM; 2.10A {Homo sapiens} PDB: 3qm4_A* 2f9q_A* Length = 479 Back     alignment and structure
>2ve3_A Putative cytochrome P450 120; oxidoreductase, monooxygenase, metal-binding, heme, iron; HET: HEM REA; 2.10A {Synechocystis SP} PDB: 2ve4_A* Length = 444 Back     alignment and structure
>2ve3_A Putative cytochrome P450 120; oxidoreductase, monooxygenase, metal-binding, heme, iron; HET: HEM REA; 2.10A {Synechocystis SP} PDB: 2ve4_A* Length = 444 Back     alignment and structure
>3dbg_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP170A1, molecular mechanism, heme, iron, metal-binding, monooxygenase; HET: HEM; 2.60A {Streptomyces coelicolor A3} PDB: 3el3_A* Length = 467 Back     alignment and structure
>3dbg_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP170A1, molecular mechanism, heme, iron, metal-binding, monooxygenase; HET: HEM; 2.60A {Streptomyces coelicolor A3} PDB: 3el3_A* Length = 467 Back     alignment and structure
>1po5_A Cytochrome P450 2B4; oxidoreductase, membrane protein, CYP 2B4, CYP LM2, cytochro monooxygenase; HET: HEM; 1.60A {Oryctolagus cuniculus} SCOP: a.104.1.1 PDB: 3mvr_A* 2bdm_A* 3g5n_A* 3g93_A* 3kw4_A* 3me6_A* 1suo_A* 3r1a_A* 3r1b_A* 2q6n_A* 3tk3_A* 3ibd_A* 3qoa_A* 3qu8_A* Length = 476 Back     alignment and structure
>1po5_A Cytochrome P450 2B4; oxidoreductase, membrane protein, CYP 2B4, CYP LM2, cytochro monooxygenase; HET: HEM; 1.60A {Oryctolagus cuniculus} SCOP: a.104.1.1 PDB: 3mvr_A* 2bdm_A* 3g5n_A* 3g93_A* 3kw4_A* 3me6_A* 1suo_A* 3r1a_A* 3r1b_A* 2q6n_A* 3tk3_A* 3ibd_A* 3qoa_A* 3qu8_A* Length = 476 Back     alignment and structure
>3swz_A Steroid 17-alpha-hydroxylase/17,20 lyase; cytochrome P450, CYP17A1, P450C17, P450 17A1, monooxyg 17A-hydroxylase, heme protein; HET: HEM TOK; 2.40A {Homo sapiens} PDB: 3ruk_A* Length = 494 Back     alignment and structure
>3swz_A Steroid 17-alpha-hydroxylase/17,20 lyase; cytochrome P450, CYP17A1, P450C17, P450 17A1, monooxyg 17A-hydroxylase, heme protein; HET: HEM TOK; 2.40A {Homo sapiens} PDB: 3ruk_A* Length = 494 Back     alignment and structure
>2fdv_A Cytochrome P450 2A6; CYP2A6, monooxygenase, drug metabolizing enzyme, coumarin 7-hydroxylase, nicotine oxidase, oxidoreductase; HET: HEM D2G; 1.65A {Homo sapiens} PDB: 1z11_A* 1z10_A* 2fdu_A* 2fdw_A* 2fdy_A* 3t3r_A* 2pg5_A* 2pg7_A* 2pg6_A* 3t3q_A* 3ebs_A* 2p85_A* 3t3s_A* Length = 476 Back     alignment and structure
>2fdv_A Cytochrome P450 2A6; CYP2A6, monooxygenase, drug metabolizing enzyme, coumarin 7-hydroxylase, nicotine oxidase, oxidoreductase; HET: HEM D2G; 1.65A {Homo sapiens} PDB: 1z11_A* 1z10_A* 2fdu_A* 2fdw_A* 2fdy_A* 3t3r_A* 2pg5_A* 2pg7_A* 2pg6_A* 3t3q_A* 3ebs_A* 2p85_A* 3t3s_A* Length = 476 Back     alignment and structure
>1r9o_A Cytochrome P450 2C9; monooxygenase, drug metabolizing enzyme, oxidoreductas; HET: HEM FLP; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1og5_A* 1og2_A* 2nnj_A* 1pq2_A* 2nni_A* 2nnh_A* 2vn0_A* 1nr6_A* 1dt6_A* 1n6b_A* Length = 477 Back     alignment and structure
>1r9o_A Cytochrome P450 2C9; monooxygenase, drug metabolizing enzyme, oxidoreductas; HET: HEM FLP; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1og5_A* 1og2_A* 2nnj_A* 1pq2_A* 2nni_A* 2nnh_A* 2vn0_A* 1nr6_A* 1dt6_A* 1n6b_A* Length = 477 Back     alignment and structure
>3gw9_A Sterol 14alpha-demethylase; CYP51, cytochrome P450, heme, oxidoreductase, monooxygenase, sterol biosynthesis, lipids, endoplasmic reticulum; HET: HEM VNI; 1.87A {Trypanosoma brucei} PDB: 3g1q_A* 3p99_A* 2wv2_A* 2x2n_A* 3khm_A* 3k1o_A* 3ksw_A* 2wx2_A* 2wuz_A* 3l4d_A* Length = 450 Back     alignment and structure
>3gw9_A Sterol 14alpha-demethylase; CYP51, cytochrome P450, heme, oxidoreductase, monooxygenase, sterol biosynthesis, lipids, endoplasmic reticulum; HET: HEM VNI; 1.87A {Trypanosoma brucei} PDB: 3g1q_A* 3p99_A* 2wv2_A* 2x2n_A* 3khm_A* 3k1o_A* 3ksw_A* 2wx2_A* 2wuz_A* 3l4d_A* Length = 450 Back     alignment and structure
>3e6i_A CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, monooxygenase, acetaminophen, oxidoreductase, heme, endoplasmic reticulum, iron, membrane; HET: HEM; 2.20A {Homo sapiens} PDB: 3e4e_A* 3gph_A* 3koh_A* 3lc4_A* 3t3z_A* Length = 476 Back     alignment and structure
>3e6i_A CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, monooxygenase, acetaminophen, oxidoreductase, heme, endoplasmic reticulum, iron, membrane; HET: HEM; 2.20A {Homo sapiens} PDB: 3e4e_A* 3gph_A* 3koh_A* 3lc4_A* 3t3z_A* Length = 476 Back     alignment and structure
>3mdm_A Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, thioperamide, monooxygenase, metab enzyme, oxidoreductase, heme, cholesterol metabolism; HET: HEM FJZ; 1.60A {Homo sapiens} PDB: 2q9g_A* 2q9f_A* 3mdr_A* 3mdt_A* 3mdv_A* Length = 456 Back     alignment and structure
>1n97_A CYP175A1; electron transport; HET: SRT HEM; 1.80A {Thermus thermophilus} SCOP: a.104.1.1 PDB: 1wiy_A* Length = 389 Back     alignment and structure
>3dsk_A Cytochrome P450 74A, chloroplast; P450 fold, fatty acid biosynthesis, heme, iron, synthesis, lyase, metal-binding, oxylipin biosynthesis; HET: HEM T25; 1.55A {Arabidopsis thaliana} PDB: 2rcm_A* 3dsj_A* 3dsi_A* 2rcl_A* 2rch_A* 3cli_A* Length = 495 Back     alignment and structure
>3dan_A Cytochrome P450 74A2; AOS heme cytochrome P450 structure, fatty acid biosynthesis, heme, iron, lipid synthesis, lyase, metal-binding; HET: HEM; 1.80A {Parthenium argentatum} PDB: 3dam_A* 3dbm_A* Length = 473 Back     alignment and structure
>2ij2_A Cytochrome P450 BM3; monoxygenase, heme binding protein, atomic resolution, oxidoreductase; HET: HEM; 1.20A {Bacillus megaterium} SCOP: a.104.1.1 PDB: 2hpd_A* 1fag_A* 1jpz_A* 1zo9_A* 1zo4_A* 1zoa_A* 3m4v_A* 3ekb_A* 3ben_A* 1fah_A* 2nnb_A* 3kx3_A* 3ekd_A* 3ekf_A* 1smi_A* 1smj_A* 3kx4_A* 2ij3_A* 2ij4_A* 3hf2_A* ... Length = 470 Back     alignment and structure
>2ij2_A Cytochrome P450 BM3; monoxygenase, heme binding protein, atomic resolution, oxidoreductase; HET: HEM; 1.20A {Bacillus megaterium} SCOP: a.104.1.1 PDB: 2hpd_A* 1fag_A* 1jpz_A* 1zo9_A* 1zo4_A* 1zoa_A* 3m4v_A* 3ekb_A* 3ben_A* 1fah_A* 2nnb_A* 3kx3_A* 3ekd_A* 3ekf_A* 1smi_A* 1smj_A* 3kx4_A* 2ij3_A* 2ij4_A* 3hf2_A* ... Length = 470 Back     alignment and structure
>3nxu_A Cytochrome P450 3A4; alpha beta protein, cytochrome P450 fold, hemoprotein, monoo cytochrome P450 reductase, endoplasmic reticulum; HET: HEM RIT; 2.00A {Homo sapiens} PDB: 1w0e_A* 1w0g_A* 2j0d_A* 2v0m_A* 1w0f_A* 1tqn_A* 3ua1_A* 3tjs_A* Length = 485 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query280
3tbg_A479 Cytochrome P450 2D6; monooxygenase, thioridazine, 100.0
3swz_A494 Steroid 17-alpha-hydroxylase/17,20 lyase; cytochro 100.0
3nxu_A485 Cytochrome P450 3A4; alpha beta protein, cytochrom 100.0
3ld6_A461 Lanosterol 14-alpha demethylase; cytochrome P450, 100.0
3e6i_A476 CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, mono 100.0
3s79_A503 Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD 100.0
3pm0_A507 Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase 100.0
3k9v_A482 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitocho 100.0
3qz1_A496 Steroid 21-hydroxylase; P450 monooxygenase, oxidor 100.0
1po5_A476 Cytochrome P450 2B4; oxidoreductase, membrane prot 100.0
2fdv_A476 Cytochrome P450 2A6; CYP2A6, monooxygenase, drug m 100.0
1r9o_A477 Cytochrome P450 2C9; monooxygenase, drug metaboliz 100.0
3czh_A481 Cytochrome P450 2R1; vitamin D, vitamin S 25-hydro 100.0
2hi4_A495 Cytochrome P450 1A2; CYP1A2, monooxygenase, drug m 100.0
2ve3_A444 Putative cytochrome P450 120; oxidoreductase, mono 100.0
3n9y_A487 Cholesterol SIDE-chain cleavage enzyme; cytochrome 100.0
3i3k_A461 Lanosterol 14-alpha demethylase; cytochrome P450, 100.0
2cib_A455 Cytochrome P450 51; heme, heme lipid synthesis, me 100.0
2cd8_A436 Cytochrome P450 monooxygenase; oxidoreductase, PIK 100.0
3gw9_A450 Sterol 14alpha-demethylase; CYP51, cytochrome P450 100.0
3dbg_A467 Putative cytochrome P450; cytochrome P450 oxidored 100.0
3v8d_A491 Cholesterol 7-alpha-monooxygenase; cytochrome, oxi 100.0
2ij2_A470 Cytochrome P450 BM3; monoxygenase, heme binding pr 100.0
3mdm_A456 Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, th 100.0
3b98_A475 Prostaglandin I2 synthase; prostacyclin synthase, 100.0
1jfb_A404 Nitric-oxide reductase cytochrome P450 55A1; cytoc 100.0
1izo_A417 P450bsbeta, cytochrome P450 152A1; heme protein, p 100.0
3dax_A491 Cytochrome P450 7A1; cholesterol, cholesterol 7-al 100.0
1n97_A389 CYP175A1; electron transport; HET: SRT HEM; 1.80A 100.0
3b6h_A498 Prostacyclin synthase; enzyme-inhibitor complex, C 99.98
4fb2_A398 P450CIN; heme, monooxygenase, cindoxin, oxidoreduc 99.98
3awm_A415 Fatty acid alpha-hydroxylase; cytochrome P450, per 99.98
1ued_A406 P450 OXYC, P450 monooxygenase; cytochrome P450 van 99.97
3ejb_B404 Biotin biosynthesis cytochrome P450-like enzyme; p 99.97
2jjn_A411 Cytochrome P450 113A1; oxidoreductase, iron, heme, 99.97
2zbx_A412 Cytochrome P450-SU1; beta prism, heme, iron, metal 99.97
4dnj_A412 Putative cytochrome P450; oxidoreductase; HET: HEM 99.97
3nc3_A441 Cytochrome P450 CYPX; cytochrome P450 oxidase, HAE 99.97
3abb_A408 CYP105D6, cytochrome P450 hydroxylase; oxidoreduct 99.97
3a4g_A411 Vitamin D hydroxylase; cytochrome P450, hemoprotei 99.97
3aba_A403 Cytochrome P450; oxidoreductase, heme, monooxygena 99.97
3ivy_A433 Cytochrome P450 CYP125; cholesterol, monooxygenase 99.97
3lxh_A421 Cytochrome P450; heme, iron, metal-binding, monoox 99.97
1cpt_A428 Cytochrome P450-TERP; oxidoreductase(oxygenase); H 99.97
3oft_A396 Cytochrome P450, CYP101C1; oxidoreductase; HET: HE 99.97
2zwu_A415 Camphor 5-monooxygenase; P450CAM, camphor-hydroxyl 99.97
1s1f_A406 Putative cytochrome P450; cytochrome P450 oxidored 99.97
1gwi_A411 CYP154C1, cytochrome P450 154C1; oxidoreductase, m 99.96
3tyw_A417 Putative cytochrome P450; P450 monooxygenase, oxid 99.96
2xkr_A398 CYP142, putative cytochrome P450 142; oxidoreducta 99.96
3dsk_A495 Cytochrome P450 74A, chloroplast; P450 fold, fatty 99.96
2uuq_A414 CYP130, cytochrome P450 130; iron, heme, monooxyge 99.96
3r9b_A418 Cytochrome P450 164A2; monooxygenase, oxidoreducta 99.96
1odo_A408 Putative cytochrome P450 154A1; P450 monooxygenase 99.96
3dan_A473 Cytochrome P450 74A2; AOS heme cytochrome P450 str 99.96
3mgx_A415 Putative P450 monooxygenase; cytochrome P450 oxida 99.96
2z36_A413 MOXA, cytochrome P450 type compactin 3'',4''- hydr 99.96
2y5n_A417 MYCG, P-450-like protein; oxidoreductase, mycinami 99.96
3rwl_A426 Cytochrome P450 alkane hydroxylase 1 CYP153A7; P45 99.96
1z8o_A404 6-deoxyerythronolide B hydroxylase; heme, CYP, ery 99.96
2dkk_A411 Cytochrome P450; CYP158A1, INHI oxidoreductase; HE 99.96
3buj_A397 CALO2; heme, iron, metal-binding, monooxygenase, o 99.95
3tkt_A450 Cytochrome P450; aromatic hydrocarbon binding of P 99.95
4dxy_A417 Cytochrome P450, CYP101D2; cytochrome P450 mutant, 99.95
2z3t_A425 Cytochrome P450; monoxygenase, oxydoreductase, hem 99.95
3oo3_A384 OXY protein; cytochrome P450, monooxygenase, PCD-t 99.95
1q5d_A419 P450 epoxidase; cytochrome P450, epothilone, oxydo 99.95
2xbk_A404 PIMD protein; epoxidation, oxidoreductase; HET: HE 99.95
1lfk_A398 OXYB, P450 monooxygenase; oxidative phenol couplin 99.94
2wiy_A394 XPLA-heme, cytochrome P450-like protein XPLA; CYT- 99.94
1io7_A368 Cytochrome P450 CYP119; thermophilic, cytochromo P 99.94
1n40_A396 P450 MT2, cytochrome P450 121; heme binding, oxyge 99.94
3p3o_A416 Cytochrome P450; monooxygenase, oxidoreductase; HE 99.93
2wm5_A435 CYP124, putative cytochrome P450 124; metal-bindin 99.93
3b4x_A367 367AA long hypothetical cytochrome P450; HEM prote 99.92
2rfb_A343 Cytochrome P450; heme, iron, metal-binding, monoox 99.92
2yjn_B381 Erycii, DTDP-4-keto-6-deoxy-hexose 3,4-isomerase; 99.78
>3tbg_A Cytochrome P450 2D6; monooxygenase, thioridazine, oxidoreductase; HET: RTZ HEM; 2.10A {Homo sapiens} PDB: 3qm4_A* 2f9q_A* Back     alignment and structure
Probab=100.00  E-value=4.8e-48  Score=340.68  Aligned_cols=244  Identities=26%  Similarity=0.474  Sum_probs=191.1

Q ss_pred             CCCCCCCCCCCCCccccccCC-CCchhHHHHHHHHHhCccchH-------------HHHHHHHHHcCCCCCCCCCccccc
Q 036917           23 LRFNLPPGPRPLPIVGNLYDI-KPVRFRCFAEWAQQYGQSFRF-------------ELAREVLKEHDQQLADRHRSRSAA   88 (280)
Q Consensus        23 ~~~~~pPgP~~~p~lG~~~~~-~~~~~~~~~~~~~kyG~v~~~-------------~~~~~il~~~~~~f~~r~~~~~~~   88 (280)
                      ++.++||||++||+|||++++ .++++..+.+|+++||+||++             +.+++++.+++..|++|+......
T Consensus         7 s~~kLPPGP~~lP~iGn~~~~~~~~~~~~~~~~~~kYG~i~~~~~g~~~~vvv~~p~~i~~vl~~~~~~f~~r~~~~~~~   86 (479)
T 3tbg_A            7 SKGKLPPGPLPLPGLGNLLHVDFQNTPYCFDQLRRRFGDVFSLQLAWTPVVVLNGLAAVREALVTHGEDTADRPPVPITQ   86 (479)
T ss_dssp             --CCCCCCSCCBTTTBTGGGCCTTSHHHHHHHHHHHHCSEEEEEETTEEEEEEEHHHHHHHHHTTTGGGSCBCCCCGGGG
T ss_pred             CCCCCCCCCCCcCcccchHhhcCCCHHHHHHHHHHHhCCEEEEEECCeeEEEECCHHHHHHHHHhCChhhcCCCchHHHH
Confidence            344799999999999999999 578899999999999999876             899999999999999998776665


Q ss_pred             cccCC--CCceEEccCCchHHHHHhhhhhcccChHHHh--hhhHHHHHHHHHHHHHHhhcCCCCeee-------------
Q 036917           89 KFSRD--GKDLIWADYGPHYVKVRKVCTLELFTPKRLE--ALRPIREDEVTAMVESIFKDCTDPHNF-------------  151 (280)
Q Consensus        89 ~~~~~--~~~~~~~~~g~~w~~~R~~~~~~~~~~~~l~--~~~~~~~~~~~~l~~~l~~~~~~~~~~-------------  151 (280)
                      .+..+  ..+++++.+|+.|+.+|+.+. +.|+...+.  .+...+......+...+....+..+++             
T Consensus        87 ~~~~~~~~~~~~~~~~g~~w~~~R~~~~-~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~  165 (479)
T 3tbg_A           87 ILGFGPRSQGVFLARYGPAWREQRRFSV-STLRNLGLGKKSLEQWVTEEAACLCAAFANHSGRPFRPNGLLDKAVSNVIA  165 (479)
T ss_dssp             GGTCBTTBCCSTTCCSSHHHHHHHHHHH-HHHHHTTSTTCHHHHHHHHHHHHHHHHHHTTTTCCBCTHHHHHHHHHHHHH
T ss_pred             HhccCCCCCceeeCCCCHHHHHHHHHHH-HHhcchhhhHHHHHHHHHHHHHHHHHHHHhccCCcccHHHHHHHHHHHHHH
Confidence            54432  345667778999999999998 666555443  345566666677777666655555443             


Q ss_pred             -eeec---------------------------------------------------------------------------
Q 036917          152 -VAFT---------------------------------------------------------------------------  155 (280)
Q Consensus       152 -~~~~---------------------------------------------------------------------------  155 (280)
                       ..++                                                                           
T Consensus       166 ~~~fg~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  245 (479)
T 3tbg_A          166 SLTCGRRFEYDDPRFLRLLDLAQEGLKEESGFLREVLNAVPVLLHIPALAGKVLRFQKAFLTQLDELLTEHRMTWDPAQP  245 (479)
T ss_dssp             HHHHSCCCCTTCHHHHHHHHHHHHHHHTTSSHHHHHHHHSGGGGGSHHHHHHHTHHHHHHHHHHHHHHHHHHHHCCTTSC
T ss_pred             HhhcCCcccccchhhhhhhhhhhhhhhhhhhhhhhhhcccchhccchhhHHHHHHHHHHHHHHHHHHHHHHHHhhhcccc
Confidence             0000                                                                           


Q ss_pred             --------------------------------------------------------------------------------
Q 036917          156 --------------------------------------------------------------------------------  155 (280)
Q Consensus       156 --------------------------------------------------------------------------------  155 (280)
                                                                                                      
T Consensus       246 ~~d~~~~~~~~~~~~~~~~~~~l~~~~i~~~~~~~~~AG~dTta~~l~~~l~~L~~~P~~q~kl~~Ei~~~~~~~~~~~~  325 (479)
T 3tbg_A          246 PRDLTEAFLAEMEKAKGNPESSFNDENLRIVVADLFSAGMVTTSTTLAWGLLLMILHPDVQRRVQQEIDDVIGQVRRPEM  325 (479)
T ss_dssp             CCSHHHHHHHHHHHTTTCTTCSCSHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCHHHHHHHHHHHHHHTCSSSCCCH
T ss_pred             cchhhhhhhhhhhhcccCCccchhhHHHHHHHHHHHHhhhhhhHHHHHHHHHHhccCHHHHHHHHHHHHHHHhhccccch
Confidence                                                                                            


Q ss_pred             ------------------------------------------CCcceEEEeeehhccCCCCCCCCCCCCCCcccccCcCC
Q 036917          156 ------------------------------------------LSGSNIHVNVWAVARDPAVWKDPLEFRPERFFEEDVDM  193 (280)
Q Consensus       156 ------------------------------------------pkgt~v~~~~~~~~~d~~~~~~~~~F~peR~l~~~~~~  193 (280)
                                                                ||||.|+++.|++|+||++|+||++|+||||+++++..
T Consensus       326 ~~l~~lpyl~avi~EtlRl~p~~~~~~~~~~~~d~~~~g~~IP~Gt~V~~~~~~~h~d~~~~~dP~~F~PeRfl~~~~~~  405 (479)
T 3tbg_A          326 GDQAHMPYTTAVIHEVQRFGDIVPLGVTHMTSRDIEVQGFRIPKGTTLITNLSSVLKDEAVWEKPFRFHPEHFLDAQGHF  405 (479)
T ss_dssp             HHHTTCHHHHHHHHHHHHHHCSSTTCCCEECSSCEEETTEEECTTCEEEEEHHHHHTCTTTSSSTTSCCGGGGBCTTCCB
T ss_pred             hhhccccccccceeeeccccccccccceeecCCCceECCEEecCCCeeeechhhhcCChhhCCCccccCccccCCCCccc
Confidence                                                      99999999999999999999999999999999877654


Q ss_pred             CCCCCccccCCCCCCCCccHHHHHHHHHHHHHHHHHHccccCCCCCCCCCCCCCCCCCccccccCCceEeeeecCCCc
Q 036917          194 KGHDFRLLPFGAGRRVCPGAQLGINLVTSMLGHLLHHFAWAPPEGVKPEEIDMSENPGLVTYMKTPLQAVPTPRLPSH  271 (280)
Q Consensus       194 ~~~~~~~~~Fg~G~r~C~G~~~A~~e~~~~l~~ll~~f~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~R~~~~  271 (280)
                      . .++.|+|||+|+|.|+|++||++|+++++|.||++|+|++++++  .........+++..| .+++|+++||++.|
T Consensus       406 ~-~~~~~~pFG~G~R~C~G~~lA~~e~~~~la~ll~~f~~~~~~~~--~~~~~~~~~~~~~~P-~~~~v~~~pRs~~h  479 (479)
T 3tbg_A          406 V-KPEAFLPFSAGRRACLGEPLARMELFLFFTSLLQHFSFSVPTGQ--PRPSHHGVFAFLVSP-SPYELCAVPRHHHH  479 (479)
T ss_dssp             C-CCTTCCTTCCSTTSCTTHHHHHHHHHHHHHHHHHHEEEECCTTS--CCCCSCEEESSSEEE-CCCCBEEEEC----
T ss_pred             C-CCCceecCCCCCcCChhHHHHHHHHHHHHHHHHHccEEEeCCCC--CCccccccceeeecC-CCeEEEEEECCCCC
Confidence            4 45689999999999999999999999999999999999998873  122223234556655 68999999999876
>3swz_A Steroid 17-alpha-hydroxylase/17,20 lyase; cytochrome P450, CYP17A1, P450C17, P450 17A1, monooxyg 17A-hydroxylase, heme protein; HET: HEM TOK; 2.40A {Homo sapiens} PDB: 3ruk_A* Back     alignment and structure
>3nxu_A Cytochrome P450 3A4; alpha beta protein, cytochrome P450 fold, hemoprotein, monoo cytochrome P450 reductase, endoplasmic reticulum; HET: HEM RIT; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1w0e_A* 1w0g_A* 2j0d_A* 2v0m_A* 1w0f_A* 1tqn_A* 3ua1_A* 3tjs_A* Back     alignment and structure
>3ld6_A Lanosterol 14-alpha demethylase; cytochrome P450, ketoconazole, S genomics, structural genomics consortium, SGC; HET: HEM KKK BCD; 2.80A {Homo sapiens} PDB: 3juv_A* 3jus_A* Back     alignment and structure
>3e6i_A CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, monooxygenase, acetaminophen, oxidoreductase, heme, endoplasmic reticulum, iron, membrane; HET: HEM; 2.20A {Homo sapiens} PDB: 3e4e_A* 3gph_A* 3koh_A* 3lc4_A* 3t3z_A* Back     alignment and structure
>3s79_A Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD; 2.75A {Homo sapiens} PDB: 3eqm_A* 3s7s_A* 4gl5_A* 4gl7_A* Back     alignment and structure
>3pm0_A Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase, alpha-naphthoflavone, 17BETA-estradiol, oxidoreductase; HET: HEM BHF; 2.70A {Homo sapiens} Back     alignment and structure
>3k9v_A 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial; mitochondrial cytochrome P450, monotopic membrane protein, monooxygenase; HET: HEM CPS; 2.50A {Rattus norvegicus} PDB: 3k9y_A* Back     alignment and structure
>3qz1_A Steroid 21-hydroxylase; P450 monooxygenase, oxidoreductase; HET: HEM 3QZ; 3.00A {Bos taurus} Back     alignment and structure
>1po5_A Cytochrome P450 2B4; oxidoreductase, membrane protein, CYP 2B4, CYP LM2, cytochro monooxygenase; HET: HEM; 1.60A {Oryctolagus cuniculus} SCOP: a.104.1.1 PDB: 3mvr_A* 2bdm_A* 3g5n_A* 3g93_A* 3kw4_A* 3me6_A* 1suo_A* 3r1a_A* 3r1b_A* 2q6n_A* 3tk3_A* 3ibd_A* 3qoa_A* 3qu8_A* Back     alignment and structure
>2fdv_A Cytochrome P450 2A6; CYP2A6, monooxygenase, drug metabolizing enzyme, coumarin 7-hydroxylase, nicotine oxidase, oxidoreductase; HET: HEM D2G; 1.65A {Homo sapiens} PDB: 1z11_A* 1z10_A* 2fdu_A* 2fdw_A* 2fdy_A* 3t3r_A* 2pg5_A* 2pg7_A* 2pg6_A* 3t3q_A* 3ebs_A* 2p85_A* 3t3s_A* Back     alignment and structure
>1r9o_A Cytochrome P450 2C9; monooxygenase, drug metabolizing enzyme, oxidoreductas; HET: HEM FLP; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1og5_A* 1og2_A* 2nnj_A* 1pq2_A* 2nni_A* 2nnh_A* 2vn0_A* 1nr6_A* 1dt6_A* 1n6b_A* Back     alignment and structure
>3czh_A Cytochrome P450 2R1; vitamin D, vitamin S 25-hydroxylase, drug metabolism, structural genomics, structural genomics consortium, SGC; HET: BCD HEM D2V; 2.30A {Homo sapiens} SCOP: a.104.1.1 PDB: 2ojd_A* 3c6g_A* 3dl9_A* Back     alignment and structure
>2hi4_A Cytochrome P450 1A2; CYP1A2, monooxygenase, drug metabolizing enzyme, alpha-naphthoflavone, benzo(H)flavone, 7,8- benzoflavone, oxidoreductase; HET: HEM BHF; 1.95A {Homo sapiens} Back     alignment and structure
>2ve3_A Putative cytochrome P450 120; oxidoreductase, monooxygenase, metal-binding, heme, iron; HET: HEM REA; 2.10A {Synechocystis SP} PDB: 2ve4_A* Back     alignment and structure
>3n9y_A Cholesterol SIDE-chain cleavage enzyme; cytochrome P450, cholesterol SIDE chain cleavage, structural genomics, structural genomics consortium, SGC; HET: HEM CLR; 2.10A {Homo sapiens} PDB: 3n9z_A* 3na1_A* 3na0_A* 3mzs_A* Back     alignment and structure
>2cib_A Cytochrome P450 51; heme, heme lipid synthesis, metal-binding, monooxygenase, NADP, oxidoreductase, protein-inhibitor complex; HET: HEM CM6; 1.50A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 2bz9_A* 1x8v_A* 2ci0_A* 2vku_A* 2w09_A* 2w0b_A* 2w0a_A* 1h5z_A* 1ea1_A* 1e9x_A* 1u13_A* Back     alignment and structure
>2cd8_A Cytochrome P450 monooxygenase; oxidoreductase, PIKC, macrolide monooxygenase, antibiotic biosynthesis, heme, iron, metal-binding; HET: HEM PXI; 1.7A {Streptomyces venezuelae} PDB: 2c6h_A* 2bvj_A* 2ca0_A* 2c7x_A* 2vzm_A* 2vz7_A* 2vsj_A* 2wi9_A* 2whw_A* Back     alignment and structure
>3gw9_A Sterol 14alpha-demethylase; CYP51, cytochrome P450, heme, oxidoreductase, monooxygenase, sterol biosynthesis, lipids, endoplasmic reticulum; HET: HEM VNI; 1.87A {Trypanosoma brucei} PDB: 3tik_A* 3g1q_A* 3p99_A* 2wv2_A* 2x2n_A* 3khm_A* 3k1o_A* 3ksw_A* 2wx2_A* 2wuz_A* 3l4d_A* Back     alignment and structure
>3dbg_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP170A1, molecular mechanism, heme, iron, metal-binding, monooxygenase; HET: HEM; 2.60A {Streptomyces coelicolor A3} PDB: 3el3_A* Back     alignment and structure
>3v8d_A Cholesterol 7-alpha-monooxygenase; cytochrome, oxidoreductase; HET: HEM 0GV; 1.90A {Homo sapiens} PDB: 3sn5_A* 3dax_A* Back     alignment and structure
>2ij2_A Cytochrome P450 BM3; monoxygenase, heme binding protein, atomic resolution, oxidoreductase; HET: HEM; 1.20A {Bacillus megaterium} SCOP: a.104.1.1 PDB: 2hpd_A* 1fag_A* 1jpz_A* 1zo9_A* 1zo4_A* 1zoa_A* 3m4v_A* 3ekb_A* 3ben_A* 1fah_A* 2nnb_A* 3kx3_A* 3ekd_A* 3ekf_A* 1smi_A* 1smj_A* 3kx4_A* 2ij3_A* 2ij4_A* 3hf2_A* ... Back     alignment and structure
>3mdm_A Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, thioperamide, monooxygenase, metab enzyme, oxidoreductase, heme, cholesterol metabolism; HET: HEM FJZ; 1.60A {Homo sapiens} PDB: 2q9g_A* 2q9f_A* 3mdr_A* 3mdt_A* 3mdv_A* 4enh_A* 4fia_A* Back     alignment and structure
>3b98_A Prostaglandin I2 synthase; prostacyclin synthase, cytochrome P450 8A1, CYP8A1, isomerase; HET: HEM; 2.08A {Danio rerio} PDB: 3b99_A* Back     alignment and structure
>1jfb_A Nitric-oxide reductase cytochrome P450 55A1; cytochrome P450NOR, atomic resolutio structural genomics/proteomics initiative, RSGI; HET: HEM; 1.00A {Fusarium oxysporum} SCOP: a.104.1.1 PDB: 1jfc_A* 1gej_A* 1ged_A* 1ehe_A* 1gei_A* 1rom_A* 2rom_A* 1ehf_A* 1cl6_A* 1ehg_A* 1cmj_A* 1f25_A* 1f24_A* 1xqd_A* 1f26_A* 1cmn_A* 1ulw_A* Back     alignment and structure
>1izo_A P450bsbeta, cytochrome P450 152A1; heme protein, protein-fatty acid complex, riken structural genomics/proteomics initiative, RSGI; HET: HEM PAM; 2.10A {Bacillus subtilis} SCOP: a.104.1.1 PDB: 2zqj_A* 2zqx_A* Back     alignment and structure
>3dax_A Cytochrome P450 7A1; cholesterol, cholesterol 7-alpha hydroxylase, structural genomics, structural genomics consortium, SGC, cholesterol metabolism; HET: HEM; 2.15A {Homo sapiens} PDB: 3sn5_A* Back     alignment and structure
>1n97_A CYP175A1; electron transport; HET: SRT HEM; 1.80A {Thermus thermophilus} SCOP: a.104.1.1 PDB: 1wiy_A* Back     alignment and structure
>3b6h_A Prostacyclin synthase; enzyme-inhibitor complex, CYP8A1, cytochrome P450, endoplasmic reticulum, fatty acid biosynthesis, heme, iron, isomerase; HET: BOG MXD HEM; 1.62A {Homo sapiens} PDB: 2iag_A* Back     alignment and structure
>4fb2_A P450CIN; heme, monooxygenase, cindoxin, oxidoreductase; HET: HEM EDO; 1.37A {Citrobacter braakii} PDB: 4fmx_A* 4fyz_A* 1t2b_A* 3bdz_A* 3be0_A* Back     alignment and structure
>3awm_A Fatty acid alpha-hydroxylase; cytochrome P450, peroxygenase, oxidoreductase; HET: HEM PLM; 1.65A {Sphingomonas paucimobilis} PDB: 3awq_A* 3awp_A* Back     alignment and structure
>1ued_A P450 OXYC, P450 monooxygenase; cytochrome P450 vancomycin biosynthesis, oxidoreductase; HET: HEM PG4; 1.90A {Amycolatopsis orientalis} SCOP: a.104.1.1 Back     alignment and structure
>3ejb_B Biotin biosynthesis cytochrome P450-like enzyme; protein-protein complex, cytochrome P450 fold, carrier protein, 4-helix bundle, cytoplasm; HET: ZMP HTG HEM; 2.00A {Bacillus subtilis} SCOP: a.104.1.0 PDB: 3ejd_B* 3eje_B* Back     alignment and structure
>2jjn_A Cytochrome P450 113A1; oxidoreductase, iron, heme, monooxygenase, metal-binding, AN biosynthesis, TIE-ROD mechanism of action; HET: HEM; 1.59A {Saccharopolyspora erythraea} PDB: 2jjo_A* 2jjp_A* 2xfh_A* 2wio_A* 2vrv_A* Back     alignment and structure
>2zbx_A Cytochrome P450-SU1; beta prism, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.50A {Streptomyces griseolus} PDB: 2zby_A* 2zbz_A* 3cv8_A* 3cv9_A* Back     alignment and structure
>4dnj_A Putative cytochrome P450; oxidoreductase; HET: HEM ANN; 1.80A {Rhodopseudomonas palustris} PDB: 2fr7_A* 4do1_A* 4dnz_A* Back     alignment and structure
>3nc3_A Cytochrome P450 CYPX; cytochrome P450 oxidase, HAEM protein, oxidoreductase; HET: HEM; 2.66A {Bacillus subtilis} PDB: 3nc5_A* 3nc6_A* 3nc7_A* Back     alignment and structure
>3abb_A CYP105D6, cytochrome P450 hydroxylase; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding; HET: HEM; 2.30A {Streptomyces avermitilis} Back     alignment and structure
>3a4g_A Vitamin D hydroxylase; cytochrome P450, hemoprotein, monoox oxidoreductase; HET: HEM; 1.75A {Pseudonocardia autotrophica} PDB: 3a4h_A* 3a51_A* 3a4z_A* 3a50_A* Back     alignment and structure
>3aba_A Cytochrome P450; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding, oxidoreductase-antibiotic complex; HET: HEM FLI; 1.80A {Streptomyces avermitilis} PDB: 3e5j_A* 3e5k_A* 3e5l_A* Back     alignment and structure
>3ivy_A Cytochrome P450 CYP125; cholesterol, monooxygenase, H iron, metal-binding, oxidoreductase; HET: HEM; 1.35A {Mycobacterium tuberculosis} PDB: 3iw0_A* 3iw1_A* 3iw2_A* 2x5w_A* 2x5l_A* 2xc3_A* 2xn8_A* Back     alignment and structure
>3lxh_A Cytochrome P450; heme, iron, metal-binding, monooxygena oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} SCOP: a.104.1.0 PDB: 3lxi_A* Back     alignment and structure
>1cpt_A Cytochrome P450-TERP; oxidoreductase(oxygenase); HET: HEM; 2.30A {Pseudomonas SP} SCOP: a.104.1.1 Back     alignment and structure
>3oft_A Cytochrome P450, CYP101C1; oxidoreductase; HET: HEM; 1.90A {Novosphingobium aromaticivorans} PDB: 3ofu_A* Back     alignment and structure
>2zwu_A Camphor 5-monooxygenase; P450CAM, camphor-hydroxylase, heme, iron, metal-binding, oxidoreductase, substrate-soaking, cytoplasm; HET: HEM CAM; 1.30A {Pseudomonas putida} PDB: 1gem_A* 1iwi_A* 2l8m_A* 2z97_A* 1gek_A* 2zax_A* 2zaw_A* 2zwt_A* 1rf9_A* 1lwl_A* 1iwk_A* 1iwj_A* 2zui_A* 2fe6_A* 1geb_A* 1yrc_A* 1noo_A* 1cp4_A* 1pha_A* 1phc_A* ... Back     alignment and structure
>1s1f_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP158A2, anti biosynthesis, oxidoreductase; HET: HEM PIM; 1.50A {Streptomyces coelicolor} SCOP: a.104.1.1 PDB: 1se6_A* 2d0e_A* 1t93_A* 2d09_A* 3tzo_A* Back     alignment and structure
>1gwi_A CYP154C1, cytochrome P450 154C1; oxidoreductase, macrolide antibiotics, 12- and 14- carbon macrolactone monooxygenase, heme; HET: HEM; 1.92A {Streptomyces coelicolor} SCOP: a.104.1.1 Back     alignment and structure
>3tyw_A Putative cytochrome P450; P450 monooxygenase, oxidoreductase; HET: HEM; 2.90A {Streptomyces coelicolor} PDB: 4fxb_A* Back     alignment and structure
>2xkr_A CYP142, putative cytochrome P450 142; oxidoreductase; HET: HEM; 1.60A {Mycobacterium tuberculosis} Back     alignment and structure
>3dsk_A Cytochrome P450 74A, chloroplast; P450 fold, fatty acid biosynthesis, heme, iron, synthesis, lyase, metal-binding, oxylipin biosynthesis; HET: HEM T25; 1.55A {Arabidopsis thaliana} PDB: 2rcm_A* 3dsj_A* 3dsi_A* 2rcl_A* 2rch_A* 3cli_A* Back     alignment and structure
>2uuq_A CYP130, cytochrome P450 130; iron, heme, monooxygenase, metal-binding, oxidoreductase, hypothetical protein; HET: HEM; 1.46A {Mycobacterium tuberculosis} PDB: 2uvn_A* 2whf_A* 2wh8_A* 2wgy_A* Back     alignment and structure
>3r9b_A Cytochrome P450 164A2; monooxygenase, oxidoreductase; HET: HEM D12; 1.89A {Mycobacterium smegmatis} PDB: 3r9c_A* Back     alignment and structure
>1odo_A Putative cytochrome P450 154A1; P450 monooxygenase, oxidoreductase; HET: HEM PIM; 1.85A {Streptomyces coelicolor} SCOP: a.104.1.1 Back     alignment and structure
>3dan_A Cytochrome P450 74A2; AOS heme cytochrome P450 structure, fatty acid biosynthesis, heme, iron, lipid synthesis, lyase, metal-binding; HET: HEM; 1.80A {Parthenium argentatum} PDB: 3dam_A* 3dbm_A* Back     alignment and structure
>3mgx_A Putative P450 monooxygenase; cytochrome P450 oxidase, HAEM protein, vancomycin biosynthes carrier protein, oxidoreductase; HET: HEM; 2.10A {Amycolatopsis balhimycina} Back     alignment and structure
>2z36_A MOXA, cytochrome P450 type compactin 3'',4''- hydroxylase; CYP105, oxidoreductase; HET: HEM MES; 2.80A {Nonomuraea recticatena} Back     alignment and structure
>2y5n_A MYCG, P-450-like protein; oxidoreductase, mycinamicin biosynthesis; HET: HEM MYV; 1.62A {Micromonospora griseorubida} PDB: 2y46_A* 2y5z_A* 2y98_A* 2yca_A* 2ygx_A* Back     alignment and structure
>3rwl_A Cytochrome P450 alkane hydroxylase 1 CYP153A7; P450 monooxygenase, oxidoreductase; HET: HEM; 2.00A {Sphingopyxis macrogoltabida} Back     alignment and structure
>1z8o_A 6-deoxyerythronolide B hydroxylase; heme, CYP, erythromycin, oxidoreductase; HET: HEM DEB; 1.70A {Saccharopolyspora erythraea} SCOP: a.104.1.1 PDB: 1z8p_A* 1z8q_A* 1jio_A* 1jip_A* 1eup_A* 1egy_A* 1jin_A* 1oxa_A* Back     alignment and structure
>2dkk_A Cytochrome P450; CYP158A1, INHI oxidoreductase; HET: HEM; 1.97A {Streptomyces coelicolor} PDB: 2nz5_A* 2nza_A* Back     alignment and structure
>3buj_A CALO2; heme, iron, metal-binding, monooxygenase, oxidoreducta binding protein; HET: HEM; 2.47A {Micromonospora echinospora} Back     alignment and structure
>3tkt_A Cytochrome P450; aromatic hydrocarbon binding of P450 E oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} Back     alignment and structure
>4dxy_A Cytochrome P450, CYP101D2; cytochrome P450 mutant, HAEM-dependent, mono-oxygenases, oxidoreductase; HET: HEM; 2.00A {Novosphingobium aromaticivorans} PDB: 3nv6_A* 3nv5_A* Back     alignment and structure
>2z3t_A Cytochrome P450; monoxygenase, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM; 1.90A {Streptomyces SP} PDB: 2z3u_A* 3a1l_A* Back     alignment and structure
>3oo3_A OXY protein; cytochrome P450, monooxygenase, PCD-teicoplanin aglycone, oxidoreductase; HET: HEM; 2.20A {Actinoplanes teichomyceticus} SCOP: a.104.1.0 PDB: 3o1a_A* Back     alignment and structure
>1q5d_A P450 epoxidase; cytochrome P450, epothilone, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM EPB; 1.93A {Sorangium cellulosum} SCOP: a.104.1.1 PDB: 1q5e_A* 1pkf_A* Back     alignment and structure
>2xbk_A PIMD protein; epoxidation, oxidoreductase; HET: HEM XBK; 1.95A {Streptomyces natalensis} PDB: 2x9p_A* Back     alignment and structure
>1lfk_A OXYB, P450 monooxygenase; oxidative phenol coupling reaction P450 vancomycin, oxidoreductase; HET: HEM; 1.70A {Amycolatopsis orientalis} SCOP: a.104.1.1 PDB: 1lg9_A* 1lgf_A* Back     alignment and structure
>2wiy_A XPLA-heme, cytochrome P450-like protein XPLA; CYT-P450, RDX, bioremediation, electron transport; HET: HEM; 1.49A {Rhodococcus} PDB: 2wiv_A* Back     alignment and structure
>1io7_A Cytochrome P450 CYP119; thermophilic, cytochromo P450, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: HEM; 1.50A {Sulfolobus solfataricus} SCOP: a.104.1.1 PDB: 1f4u_A* 1f4t_A* 1io9_A* 1io8_A* Back     alignment and structure
>1n40_A P450 MT2, cytochrome P450 121; heme binding, oxygen binding, P450 fold, structural genomics, PSI, protein structure initiative; HET: HEM; 1.06A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 1n4g_A* 2ij5_A* 2ij7_A* 3g5f_A* 3g5h_A* 3cy0_A* 3cy1_A* 3cxv_A* 3cxx_A* 3cxz_A* 3cxy_A* Back     alignment and structure
>3p3o_A Cytochrome P450; monooxygenase, oxidoreductase; HET: HEM; 1.54A {Streptomyces thioluteus} PDB: 3p3x_A* 3p3z_A* 3p3l_A* Back     alignment and structure
>2wm5_A CYP124, putative cytochrome P450 124; metal-binding, oxidoreductase, omega-hydroxylation, iron, heme, fatty acid, monooxygenase; HET: HEM; 1.50A {Mycobacterium tuberculosis} PDB: 2wm4_A* Back     alignment and structure
>3b4x_A 367AA long hypothetical cytochrome P450; HEM protein, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.94A {Sulfolobus tokodaii} PDB: 1ue8_A* Back     alignment and structure
>2rfb_A Cytochrome P450; heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 2.50A {Picrophilus torridus} PDB: 2rfc_A* Back     alignment and structure
>2yjn_B Erycii, DTDP-4-keto-6-deoxy-hexose 3,4-isomerase; transferase, cytochrome P450; 3.09A {Saccharopolyspora erythraea} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 280
d1po5a_465 a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabb 8e-26
d1po5a_ 465 a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabb 7e-13
d3czha1463 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2 2e-23
d3czha1 463 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2 2e-14
d1tqna_472 a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Huma 2e-23
d1tqna_ 472 a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Huma 2e-11
d1r9oa_467 a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Huma 2e-23
d1r9oa_ 467 a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Huma 2e-14
d2ciba1445 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-stero 2e-21
d2ciba1 445 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-stero 4e-10
d2ij2a1453 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus 2e-16
d2ij2a1 453 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus 3e-12
d1izoa_411 a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Ba 8e-15
d1izoa_ 411 a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Ba 6e-05
d1cpta_428 a.104.1.1 (A:) Cytochrome P450-TERP {Pseudomonas s 1e-12
d1n97a_385 a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [Tax 3e-12
d1z8oa1402 a.104.1.1 (A:3-404) Cytochrome P450-ERYF {Saccharo 7e-12
d1odoa_401 a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyce 9e-12
d1lfka_394 a.104.1.1 (A:) p450 monoxygenase OxyB {Amycolatops 1e-10
d1jfba_399 a.104.1.1 (A:) Cytochrome P450-NOR, nitric reducta 1e-10
d1s1fa_399 a.104.1.1 (A:) Cyp158a2 {Streptomyces coelicolor [ 3e-10
d1ueda_403 a.104.1.1 (A:) p450 monoxygenase OxyC {Amycolatops 4e-10
d1ue8a_367 a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus tokodai 6e-10
d1q5da_401 a.104.1.1 (A:) Cytochrome P450epok {Sorangium cell 1e-09
d1n40a_395 a.104.1.1 (A:) Cyp121 monooxygenase (P450 Mt2) {My 3e-09
d1gwia_403 a.104.1.1 (A:) Cyp154c1 monooxygenase {Streptomyce 8e-09
d1io7a_366 a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus solfata 7e-08
d1re9a_404 a.104.1.1 (A:) Cytochrome P450-CAM {Pseudomonas pu 9e-08
>d1po5a_ a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 465 Back     information, alignment and structure

class: All alpha proteins
fold: Cytochrome P450
superfamily: Cytochrome P450
family: Cytochrome P450
domain: Mammalian cytochrome p450 2b4
species: Rabbit (Oryctolagus cuniculus) [TaxId: 9986]

 Score =  103 bits (257), Expect = 8e-26
 Identities = 25/110 (22%), Positives = 47/110 (42%), Gaps = 3/110 (2%)

Query: 158 GSNIHVNVWAVARDPAVWKDPLEFRPERFFEEDVDMKGHDFRLLPFGAGRRVCPGAQLGI 217
            + +   + +   DP  ++ P  F P  F + +  +K  +   +PF  G+R+C G  +  
Sbjct: 358 NTEVFPVLSSALHDPRYFETPNTFNPGHFLDANGALK-RNEGFMPFSLGKRICLGEGIAR 416

Query: 218 NLVTSMLGHLLHHFAWAPPEGVKPEEIDMSENPGLVTYMKTPLQAVPTPR 267
             +      +L +F+ A P  V PE+ID++     V  +    Q     R
Sbjct: 417 TELFLFFTTILQNFSIASP--VPPEDIDLTPRESGVGNVPPSYQIRFLAR 464
>d1po5a_ a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 465 Back     information, alignment and structure
>d3czha1 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapiens) [TaxId: 9606]} Length = 463 Back     information, alignment and structure
>d3czha1 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapiens) [TaxId: 9606]} Length = 463 Back     information, alignment and structure
>d1tqna_ a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Human (Homo sapiens) [TaxId: 9606]} Length = 472 Back     information, alignment and structure
>d1tqna_ a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Human (Homo sapiens) [TaxId: 9606]} Length = 472 Back     information, alignment and structure
>d1r9oa_ a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Human (Homo sapiens) [TaxId: 9606]} Length = 467 Back     information, alignment and structure
>d1r9oa_ a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Human (Homo sapiens) [TaxId: 9606]} Length = 467 Back     information, alignment and structure
>d2ciba1 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-sterol demethylase (cyp51) {Mycobacterium tuberculosis [TaxId: 1773]} Length = 445 Back     information, alignment and structure
>d2ciba1 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-sterol demethylase (cyp51) {Mycobacterium tuberculosis [TaxId: 1773]} Length = 445 Back     information, alignment and structure
>d2ij2a1 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 1404]} Length = 453 Back     information, alignment and structure
>d2ij2a1 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 1404]} Length = 453 Back     information, alignment and structure
>d1izoa_ a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis [TaxId: 1423]} Length = 411 Back     information, alignment and structure
>d1izoa_ a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis [TaxId: 1423]} Length = 411 Back     information, alignment and structure
>d1cpta_ a.104.1.1 (A:) Cytochrome P450-TERP {Pseudomonas sp. [TaxId: 306]} Length = 428 Back     information, alignment and structure
>d1n97a_ a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [TaxId: 274]} Length = 385 Back     information, alignment and structure
>d1z8oa1 a.104.1.1 (A:3-404) Cytochrome P450-ERYF {Saccharopolyspora erythraea [TaxId: 1836]} Length = 402 Back     information, alignment and structure
>d1odoa_ a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Length = 401 Back     information, alignment and structure
>d1lfka_ a.104.1.1 (A:) p450 monoxygenase OxyB {Amycolatopsis orientalis [TaxId: 31958]} Length = 394 Back     information, alignment and structure
>d1jfba_ a.104.1.1 (A:) Cytochrome P450-NOR, nitric reductase {Fungus (Fusarium oxysporum) [TaxId: 5507]} Length = 399 Back     information, alignment and structure
>d1s1fa_ a.104.1.1 (A:) Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]} Length = 399 Back     information, alignment and structure
>d1ueda_ a.104.1.1 (A:) p450 monoxygenase OxyC {Amycolatopsis orientalis [TaxId: 31958]} Length = 403 Back     information, alignment and structure
>d1ue8a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Length = 367 Back     information, alignment and structure
>d1q5da_ a.104.1.1 (A:) Cytochrome P450epok {Sorangium cellulosum [TaxId: 56]} Length = 401 Back     information, alignment and structure
>d1n40a_ a.104.1.1 (A:) Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tuberculosis [TaxId: 1773]} Length = 395 Back     information, alignment and structure
>d1gwia_ a.104.1.1 (A:) Cyp154c1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Length = 403 Back     information, alignment and structure
>d1io7a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Length = 366 Back     information, alignment and structure
>d1re9a_ a.104.1.1 (A:) Cytochrome P450-CAM {Pseudomonas putida [TaxId: 303]} Length = 404 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query280
d1tqna_472 Mammalian cytochrome P450 3a4 {Human (Homo sapiens 100.0
d1r9oa_467 Mammalian cytochrome p450 2c9 {Human (Homo sapiens 100.0
d3czha1463 Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapie 100.0
d1po5a_465 Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus 100.0
d2ij2a1453 Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 100.0
d2ciba1445 Cytochrome p450 14 alpha-sterol demethylase (cyp51 100.0
d1izoa_411 Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis 100.0
d1n97a_385 Cyp175a1 {Thermus thermophilus [TaxId: 274]} 100.0
d1odoa_401 Cyp154a1 monooxygenase {Streptomyces coelicolor [T 99.98
d1ueda_403 p450 monoxygenase OxyC {Amycolatopsis orientalis [ 99.97
d1gwia_403 Cyp154c1 monooxygenase {Streptomyces coelicolor [T 99.97
d1q5da_401 Cytochrome P450epok {Sorangium cellulosum [TaxId: 99.97
d1jfba_399 Cytochrome P450-NOR, nitric reductase {Fungus (Fus 99.97
d1s1fa_399 Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]} 99.97
d1z8oa1402 Cytochrome P450-ERYF {Saccharopolyspora erythraea 99.96
d1cpta_428 Cytochrome P450-TERP {Pseudomonas sp. [TaxId: 306] 99.96
d1re9a_404 Cytochrome P450-CAM {Pseudomonas putida [TaxId: 30 99.96
d1lfka_394 p450 monoxygenase OxyB {Amycolatopsis orientalis [ 99.95
d1io7a_366 Cyp119 {Archaeon Sulfolobus solfataricus [TaxId: 2 99.95
d1ue8a_367 Cyp119 {Archaeon Sulfolobus tokodaii [TaxId: 11195 99.93
d1n40a_395 Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tub 99.92
>d1tqna_ a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: Cytochrome P450
superfamily: Cytochrome P450
family: Cytochrome P450
domain: Mammalian cytochrome P450 3a4
species: Human (Homo sapiens) [TaxId: 9606]

Probab=100.00  E-value=2e-44  Score=314.46  Aligned_cols=232  Identities=22%  Similarity=0.426  Sum_probs=191.7

Q ss_pred             CCCCCCCccccccCCCCchhHHHHHHHHHhCccchH-------------HHHHHHHHHcCC-CCCCCCCccccccccCCC
Q 036917           29 PGPRPLPIVGNLYDIKPVRFRCFAEWAQQYGQSFRF-------------ELAREVLKEHDQ-QLADRHRSRSAAKFSRDG   94 (280)
Q Consensus        29 PgP~~~p~lG~~~~~~~~~~~~~~~~~~kyG~v~~~-------------~~~~~il~~~~~-~f~~r~~~~~~~~~~~~~   94 (280)
                      |||++||+|||++++.++++.++.+|++|||+||++             +.+++++.++.. .+++++........   +
T Consensus        12 PGP~~~P~iG~~~~~~~~~~~~~~~~~~kyG~i~~~~l~~~~~vvv~~p~~~~~il~~~~~~~~~~~~~~~~~~~~---~   88 (472)
T d1tqna_          12 PGPTPLPFLGNILSYHKGFCMFDMECHKKYGKVWGFYDGQQPVLAITDPDMIKTVLVKECYSVFTNRRPFGPVGFM---K   88 (472)
T ss_dssp             CCCCCBTTTBTGGGGGGCHHHHHHHHHHHHCSEEEEEETTEEEEEECCHHHHHHHHTTTTTTTCCBCCCCSCCGGG---G
T ss_pred             CCCCCcCceeEHHHhhCCHHHHHHHHHHHhCCEEEEEECCeeEEEECCHHHHHHHHhcCCcccccCCccccccccc---C
Confidence            799999999999999999999999999999999987             999999976653 44544433222222   2


Q ss_pred             CceEEccCCchHHHHHhhhhhcccChHHHhhhhHHHHHHHHHHHHHHhhcC--CCCeee--------------eeec---
Q 036917           95 KDLIWADYGPHYVKVRKVCTLELFTPKRLEALRPIREDEVTAMVESIFKDC--TDPHNF--------------VAFT---  155 (280)
Q Consensus        95 ~~~~~~~~g~~w~~~R~~~~~~~~~~~~l~~~~~~~~~~~~~l~~~l~~~~--~~~~~~--------------~~~~---  155 (280)
                      .++.+ .+|+.|+.+|++++ +.|+..+++.+.+.+.++++.+++.+.+..  +..+++              +.++   
T Consensus        89 ~~i~~-~~g~~~~~~R~~~~-~~~~~~~l~~~~~~~~~~~~~~~~~l~~~~~~~~~~dl~~~~~~~~~~v~~~~~~G~~~  166 (472)
T d1tqna_          89 SAISI-AEDEEWKRLRSLLS-PTFTSGKLKEMVPIIAQYGDVLVRNLRREAETGKPVTLKDVFGAYSMDVITSTSFGVNI  166 (472)
T ss_dssp             GSTTT-CCHHHHHHHHHHTT-GGGSHHHHHTTHHHHHHHHHHHHHHHHHHHHHSSCEEHHHHHHHHHHHHHHHTSSCCCC
T ss_pred             Cceec-cCcHHHHHhhhhcC-ccccchhhhcccchhhhhhhcccccccccccccccchhhhhhhccchhhhhheeccccc
Confidence            24444 45999999999999 899999999999999999999999887542  333443              0000   


Q ss_pred             --------------------------------------------------------------------------------
Q 036917          156 --------------------------------------------------------------------------------  155 (280)
Q Consensus       156 --------------------------------------------------------------------------------  155 (280)
                                                                                                      
T Consensus       167 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  246 (472)
T d1tqna_         167 DSLNNPQDPFVENTKKLLRFDFLDPFFLSITVFPFLIPILEVLNICVFPREVTNFLRKSVKRMKESRLEDTQKHRVDFLQ  246 (472)
T ss_dssp             CGGGCTTCHHHHHHTTCCCCCTTSHHHHHHHHCGGGHHHHHHTTCCSSCHHHHHHHHHHHHHHHTTTTTTCSCCCCCHHH
T ss_pred             ccccccchhhhHHHHHHhhhhhccchhcccccccccccccccccccccchhhhHHHHHHHHHhhhcccccccccccchhh
Confidence                                                                                            


Q ss_pred             --------------------------------------------------------------------------------
Q 036917          156 --------------------------------------------------------------------------------  155 (280)
Q Consensus       156 --------------------------------------------------------------------------------  155 (280)
                                                                                                      
T Consensus       247 ~~~~~~~~~~~~~~~~ls~~ei~~~~l~l~~Ag~~tta~~l~~~l~~L~~~Pe~~~klr~Ei~~~~~~~~~~~~~~l~~~  326 (472)
T d1tqna_         247 LMIDSQNSKETESHKALSDLELVAQSIIFIFAGYETTSSVLSFIMYELATHPDVQQKLQEEIDAVLPNKAPPTYDTVLQM  326 (472)
T ss_dssp             HHHHHHCC----CCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCHHHHHHHHHHHHHHSTTTCCCCHHHHHHC
T ss_pred             hhhhcccccccccccchhhhHHHhhhhhhhhcccccccccceeeccccccCccccccccceeheeccccccchHHHhhcc
Confidence                                                                                            


Q ss_pred             -----------------------------------CCcceEEEeeehhccCCCCCCCCCCCCCCcccccCcCCCCCCCcc
Q 036917          156 -----------------------------------LSGSNIHVNVWAVARDPAVWKDPLEFRPERFFEEDVDMKGHDFRL  200 (280)
Q Consensus       156 -----------------------------------pkgt~v~~~~~~~~~d~~~~~~~~~F~peR~l~~~~~~~~~~~~~  200 (280)
                                                         ||||.|+++.+++|+||++|+||++|+||||++++.+.. .++.+
T Consensus       327 ~~l~a~i~E~lRl~p~~~~~~r~~~~d~~~~g~~ipkGt~v~~~~~~~~~d~~~~~dp~~F~PeRfl~~~~~~~-~~~~~  405 (472)
T d1tqna_         327 EYLDMVVNETLRLFPIAMRLERVCKKDVEINGMFIPKGVVVMIPSYALHRDPKYWTEPEKFLPERFSKKNKDNI-DPYIY  405 (472)
T ss_dssp             HHHHHHHHHHHHHCCTTCCEEEECCSCEEETTEEECTTCEEEECHHHHHTCTTTSSSTTSCCGGGGSTTTGGGC-CTTTS
T ss_pred             ccccceeeeccccCCcccccccccccCccccCceeCCCCEEEEechhhhcCchhCCCccccCccccCCCCcccC-CCcee
Confidence                                               999999999999999999999999999999998776543 45689


Q ss_pred             ccCCCCCCCCccHHHHHHHHHHHHHHHHHHccccCCCCCCCCCCCCCCCCCccccccCCceEeeeecCC
Q 036917          201 LPFGAGRRVCPGAQLGINLVTSMLGHLLHHFAWAPPEGVKPEEIDMSENPGLVTYMKTPLQAVPTPRLP  269 (280)
Q Consensus       201 ~~Fg~G~r~C~G~~~A~~e~~~~l~~ll~~f~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~R~~  269 (280)
                      +|||+|+|.|+|++||++|++++++.||++|+|+++++   .+++.+...+.++.|..++.|+++||+.
T Consensus       406 ~~FG~G~r~C~G~~~A~~~~~~~la~ll~~f~~~~~~~---~~~~~~~~~~~~~~p~~~~~~~~~~R~~  471 (472)
T d1tqna_         406 TPFGSGPRNCIGMRFALMNMKLALIRVLQNFSFKPCKE---TQIPLKLSLGGLLQPEKPVVLKVESRDG  471 (472)
T ss_dssp             CTTCCSTTSCTTHHHHHHHHHHHHHHHHTTEEEECCTT---CCSSCCBCSSSSCCBSSCCEEEEEETTC
T ss_pred             cCCCCCCccChhHHHHHHHHHHHHHHHHHhCEEEeCCC---CCCCceeccceEEeeCCCEEEEEEECCC
Confidence            99999999999999999999999999999999998877   4555555567777888999999999985
>d1r9oa_ a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3czha1 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1po5a_ a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d2ij2a1 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
>d2ciba1 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-sterol demethylase (cyp51) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1izoa_ a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1n97a_ a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1odoa_ a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1ueda_ a.104.1.1 (A:) p450 monoxygenase OxyC {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d1gwia_ a.104.1.1 (A:) Cyp154c1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1q5da_ a.104.1.1 (A:) Cytochrome P450epok {Sorangium cellulosum [TaxId: 56]} Back     information, alignment and structure
>d1jfba_ a.104.1.1 (A:) Cytochrome P450-NOR, nitric reductase {Fungus (Fusarium oxysporum) [TaxId: 5507]} Back     information, alignment and structure
>d1s1fa_ a.104.1.1 (A:) Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1z8oa1 a.104.1.1 (A:3-404) Cytochrome P450-ERYF {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1cpta_ a.104.1.1 (A:) Cytochrome P450-TERP {Pseudomonas sp. [TaxId: 306]} Back     information, alignment and structure
>d1re9a_ a.104.1.1 (A:) Cytochrome P450-CAM {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1lfka_ a.104.1.1 (A:) p450 monoxygenase OxyB {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d1io7a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1ue8a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1n40a_ a.104.1.1 (A:) Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure