Citrus Sinensis ID: 036977
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 693 | ||||||
| 147802546 | 1409 | hypothetical protein VITISV_007222 [Viti | 0.450 | 0.221 | 0.464 | 5e-70 | |
| 359488027 | 1520 | PREDICTED: disease resistance protein At | 0.450 | 0.205 | 0.461 | 8e-70 | |
| 147787802 | 1517 | hypothetical protein VITISV_005047 [Viti | 0.447 | 0.204 | 0.435 | 2e-65 | |
| 147772601 | 1392 | hypothetical protein VITISV_013427 [Viti | 0.447 | 0.222 | 0.432 | 3e-65 | |
| 302143590 | 948 | unnamed protein product [Vitis vinifera] | 0.447 | 0.327 | 0.435 | 3e-65 | |
| 359488288 | 1340 | PREDICTED: LOW QUALITY PROTEIN: probable | 0.450 | 0.232 | 0.421 | 4e-65 | |
| 302143649 | 1436 | unnamed protein product [Vitis vinifera] | 0.444 | 0.214 | 0.424 | 3e-64 | |
| 147865073 | 1694 | hypothetical protein VITISV_021876 [Viti | 0.445 | 0.182 | 0.433 | 8e-64 | |
| 359488103 | 1530 | PREDICTED: disease resistance protein At | 0.445 | 0.201 | 0.421 | 1e-63 | |
| 359488108 | 1436 | PREDICTED: disease resistance protein At | 0.451 | 0.217 | 0.423 | 1e-63 |
| >gi|147802546|emb|CAN77665.1| hypothetical protein VITISV_007222 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 272 bits (695), Expect = 5e-70, Method: Compositional matrix adjust.
Identities = 150/323 (46%), Positives = 211/323 (65%), Gaps = 11/323 (3%)
Query: 11 SIVSEGAKSLFKPIIRQISYVFKYQSYIDDLKDQVKQLGYKRETVQQPVNHARLQGDELY 70
+I ++ A+ L PI R Y+F Y+S IDDL+ QV++LG R +++ V+ A GDE+
Sbjct: 7 TIAAKVAEYLVAPIGRSFGYLFNYRSNIDDLRQQVEKLGDARARLERSVDEAIRNGDEIE 66
Query: 71 EGVTDWLHSVDEFISEGVAKSIIDDEERAKKFCFKGLCPNLMSRYKLSKQAAKAAEAAAG 130
V WL V F+ E A + E++A + CF G CPNL S+Y+LS++A K A A
Sbjct: 67 ADVDKWLLRVSGFMEE--AGIFFEVEKKANQSCFNGSCPNLKSQYQLSREAKKRARVVAE 124
Query: 131 LVGKGNFSNVSYRPTPKSTGLNDGKDNEAFDSRMKVFQDVMEALKDDKLNIIGVYGMGGV 190
+ G G F VSYR G K +EA +SRM ++MEAL+D +NIIGV+GM GV
Sbjct: 125 IQGDGKFERVSYRAPLPGIGSAPFKGHEALESRMTTLDEIMEALRDAHVNIIGVWGMAGV 184
Query: 191 GKTTLVKQVAKKVMEDKLIDKVVMAEVTQNPDPQKIQDKLASDLGMKFDLNDSIHHRASR 250
GKTTL+KQVAK+V E+KL DKVVMA ++ P+ +KIQ +LA LG+KF+ +S RA+R
Sbjct: 185 GKTTLMKQVAKQVEEEKLFDKVVMAYISSTPELKKIQGELADMLGLKFE-EESEMGRAAR 243
Query: 251 LRERLKQEKRVLIILDNIWTKLELDAVGIPSGDVDEKDREDDQRRCTIILTSRSRDLLCI 310
L ERLK+ K++LIILD+IWT+L+L+ VGIP G DD + C ++LTSR++ +L
Sbjct: 244 LCERLKKVKKILIILDDIWTELDLEKVGIPFG--------DDHKGCKMVLTSRNKHVLSN 295
Query: 311 DMNSQKIFWIDALSKEEALHLAK 333
+M +QK F ++ L +EEAL L K
Sbjct: 296 EMGTQKDFPVEHLQEEEALILFK 318
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|359488027|ref|XP_002269288.2| PREDICTED: disease resistance protein At4g27190-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|147787802|emb|CAN71755.1| hypothetical protein VITISV_005047 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|147772601|emb|CAN62857.1| hypothetical protein VITISV_013427 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|302143590|emb|CBI22343.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|359488288|ref|XP_003633735.1| PREDICTED: LOW QUALITY PROTEIN: probable disease resistance protein At1g61310-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|302143649|emb|CBI22402.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|147865073|emb|CAN83232.1| hypothetical protein VITISV_021876 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|359488103|ref|XP_002263579.2| PREDICTED: disease resistance protein At4g27190-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|359488108|ref|XP_003633701.1| PREDICTED: disease resistance protein At4g27190-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 693 | ||||||
| TAIR|locus:2008440 | 899 | AT1G61180 [Arabidopsis thalian | 0.448 | 0.345 | 0.279 | 9.5e-25 | |
| TAIR|locus:2008510 | 967 | AT1G61190 "AT1G61190" [Arabido | 0.417 | 0.298 | 0.275 | 1.7e-23 | |
| TAIR|locus:2132741 | 892 | AT4G10780 [Arabidopsis thalian | 0.415 | 0.322 | 0.283 | 8.5e-20 | |
| TAIR|locus:2136447 | 985 | AT4G27190 [Arabidopsis thalian | 0.431 | 0.303 | 0.255 | 8.6e-20 | |
| TAIR|locus:2203881 | 893 | AT1G62630 [Arabidopsis thalian | 0.415 | 0.322 | 0.25 | 2.1e-18 | |
| TAIR|locus:2153474 | 874 | AT5G05400 [Arabidopsis thalian | 0.437 | 0.346 | 0.256 | 2.9e-18 | |
| TAIR|locus:2170892 | 848 | AT5G43730 [Arabidopsis thalian | 0.418 | 0.341 | 0.261 | 1e-17 | |
| TAIR|locus:2031356 | 884 | AT1G63360 [Arabidopsis thalian | 0.421 | 0.330 | 0.224 | 1.1e-17 | |
| TAIR|locus:2201986 | 885 | RFL1 "AT1G12210" [Arabidopsis | 0.415 | 0.325 | 0.261 | 1.2e-17 | |
| TAIR|locus:2166320 | 888 | AT5G63020 [Arabidopsis thalian | 0.448 | 0.350 | 0.243 | 1.4e-17 |
| TAIR|locus:2008440 AT1G61180 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 284 (105.0 bits), Expect = 9.5e-25, Sum P(3) = 9.5e-25
Identities = 93/333 (27%), Positives = 159/333 (47%)
Query: 7 AAFSSIVSEGAKS-LFKPIIRQISYVFKYQSYIDDLKDQVKQLGYKRETVQQPVNHARLQ 65
+ FS VS+ + +F +I + SY+ + + L+ +++ L + VQ V +
Sbjct: 3 SCFSLQVSDQTLNRIFNCLIGK-SYIRTLEKNLRALQREMEDLRAIQHEVQNKVARDEAR 61
Query: 66 GDELYEGVTDWLHSVDEFISEGVAKSIID-DEERAKKFCFKGLCPNLM-SRYKLSKQXXX 123
E V WL V+ E K ++ +K C GLC + S YK K+
Sbjct: 62 HQRRLEAVQVWLDRVNSVDIE--CKDLLSVTPVELQKLCLCGLCSKYVCSSYKYGKKVFL 119
Query: 124 XXXXXXGLVGKGNFSNVSYRPTPKSTGLNDGKDNEAFDSRMKVFQDVMEALKDDKLNIIG 183
L +GNF VS +P P+S + + + + + + L +D + I+G
Sbjct: 120 LLEEVKKLNSEGNFDEVS-QPPPRSEV--EERPTQPTIGQEDMLEKAWNRLMEDGVGIMG 176
Query: 184 VYGMGGVGKTTLVKQVAKKVME-DKLIDKVVMAEVTQNPDPQKIQDKLASDLGMKFDL-- 240
++GMGGVGKTTL K++ K E D V+ V++ K+Q+ +A L + DL
Sbjct: 177 LHGMGGVGKTTLFKKIHNKFAEIGGTFDIVIWIVVSKGVMISKLQEDIAEKLHLCDDLWK 236
Query: 241 NDSIHHRASRLRERLKQEKRVLIILDNIWTKLELDAVGIPSGDVDEKDREDDQRRCTIIL 300
N + +A+ + LK KR +++LD+IW K++L+A+GIP + +C +
Sbjct: 237 NKNESDKATDIHRVLKG-KRFVLMLDDIWEKVDLEAIGIPY--------PSEVNKCKVAF 287
Query: 301 TSRSRDLLCIDMNSQKIFWIDALSKEEALHLAK 333
T+RSR++ C +M K ++ L E+A L K
Sbjct: 288 TTRSREV-CGEMGDHKPMQVNCLEPEDAWELFK 319
|
|
| TAIR|locus:2008510 AT1G61190 "AT1G61190" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2132741 AT4G10780 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2136447 AT4G27190 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2203881 AT1G62630 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2153474 AT5G05400 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2170892 AT5G43730 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2031356 AT1G63360 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2201986 RFL1 "AT1G12210" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2166320 AT5G63020 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 693 | |||
| pfam00931 | 285 | pfam00931, NB-ARC, NB-ARC domain | 8e-21 | |
| pfam13401 | 124 | pfam13401, AAA_22, AAA domain | 3e-07 | |
| smart00382 | 148 | smart00382, AAA, ATPases associated with a variety | 1e-06 | |
| cd01120 | 165 | cd01120, RecA-like_NTPases, RecA-like NTPases | 3e-04 | |
| cd01983 | 99 | cd01983, Fer4_NifH, The Fer4_NifH superfamily cont | 0.001 | |
| COG1474 | 366 | COG1474, CDC6, Cdc6-related protein, AAA superfami | 0.004 |
| >gnl|CDD|216202 pfam00931, NB-ARC, NB-ARC domain | Back alignment and domain information |
|---|
Score = 92.8 bits (231), Expect = 8e-21
Identities = 49/174 (28%), Positives = 85/174 (48%), Gaps = 19/174 (10%)
Query: 167 FQDVMEALKD------DKLNIIGVYGMGGVGKTTLVKQVAKKVMEDKLIDKVVMAEVTQN 220
+D++EAL + D L ++G+ GMGGVGKTTL KQ+ D V V++
Sbjct: 1 REDMIEALIEKLLEMSDNLGVVGIVGMGGVGKTTLAKQIYNDDSVGGHFDSVAWVVVSKT 60
Query: 221 PDPQKIQDKLASDLGMKFDL--NDSIHHRASRLRERLKQEKRVLIILDNIWTKLELDAVG 278
++Q + +LG+ + A +++E L + KR L++LD++W K + D +G
Sbjct: 61 YTEFRLQKDILQELGLDDSDWVEKNESELAVKIKEALLR-KRFLLVLDDVWEKNDWDKIG 119
Query: 279 IPSGDVDEKDREDDQRRCTIILTSRSRDLLCIDMNSQ-KIFWIDALSKEEALHL 331
+P D + +I+T+RS + M K +++L EE+ L
Sbjct: 120 VPFPDGEN--------GSRVIVTTRSES-VAGRMGGTSKPHEVESLEPEESWEL 164
|
Length = 285 |
| >gnl|CDD|222104 pfam13401, AAA_22, AAA domain | Back alignment and domain information |
|---|
| >gnl|CDD|214640 smart00382, AAA, ATPases associated with a variety of cellular activities | Back alignment and domain information |
|---|
| >gnl|CDD|238540 cd01120, RecA-like_NTPases, RecA-like NTPases | Back alignment and domain information |
|---|
| >gnl|CDD|238941 cd01983, Fer4_NifH, The Fer4_NifH superfamily contains a variety of proteins which share a common ATP-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|224391 COG1474, CDC6, Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 693 | |||
| KOG4658 | 889 | consensus Apoptotic ATPase [Signal transduction me | 100.0 | |
| PLN03210 | 1153 | Resistant to P. syringae 6; Provisional | 100.0 | |
| PF00931 | 287 | NB-ARC: NB-ARC domain; InterPro: IPR002182 This is | 100.0 | |
| PRK04841 | 903 | transcriptional regulator MalT; Provisional | 99.15 | |
| PF05729 | 166 | NACHT: NACHT domain | 99.12 | |
| PF01637 | 234 | Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 | 99.06 | |
| TIGR03015 | 269 | pepcterm_ATPase putative secretion ATPase, PEP-CTE | 99.02 | |
| PLN03210 | 1153 | Resistant to P. syringae 6; Provisional | 99.0 | |
| TIGR02928 | 365 | orc1/cdc6 family replication initiation protein. M | 98.98 | |
| PRK00411 | 394 | cdc6 cell division control protein 6; Reviewed | 98.96 | |
| COG2909 | 894 | MalT ATP-dependent transcriptional regulator [Tran | 98.88 | |
| TIGR00635 | 305 | ruvB Holliday junction DNA helicase, RuvB subunit. | 98.84 | |
| PRK00080 | 328 | ruvB Holliday junction DNA helicase RuvB; Reviewed | 98.78 | |
| KOG0617 | 264 | consensus Ras suppressor protein (contains leucine | 98.76 | |
| PRK06893 | 229 | DNA replication initiation factor; Validated | 98.71 | |
| PRK13342 | 413 | recombination factor protein RarA; Reviewed | 98.65 | |
| KOG0617 | 264 | consensus Ras suppressor protein (contains leucine | 98.61 | |
| PF13401 | 131 | AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S | 98.59 | |
| PRK07003 | 830 | DNA polymerase III subunits gamma and tau; Validat | 98.59 | |
| PRK12402 | 337 | replication factor C small subunit 2; Reviewed | 98.58 | |
| PF13173 | 128 | AAA_14: AAA domain | 98.58 | |
| COG2256 | 436 | MGS1 ATPase related to the helicase subunit of the | 98.57 | |
| PRK14961 | 363 | DNA polymerase III subunits gamma and tau; Provisi | 98.57 | |
| PRK00440 | 319 | rfc replication factor C small subunit; Reviewed | 98.51 | |
| TIGR03420 | 226 | DnaA_homol_Hda DnaA regulatory inactivator Hda. Me | 98.51 | |
| PRK06645 | 507 | DNA polymerase III subunits gamma and tau; Validat | 98.49 | |
| PRK14949 | 944 | DNA polymerase III subunits gamma and tau; Provisi | 98.49 | |
| PLN03025 | 319 | replication factor C subunit; Provisional | 98.49 | |
| cd00009 | 151 | AAA The AAA+ (ATPases Associated with a wide varie | 98.48 | |
| PRK12323 | 700 | DNA polymerase III subunits gamma and tau; Provisi | 98.48 | |
| PTZ00202 | 550 | tuzin; Provisional | 98.47 | |
| PLN00113 | 968 | leucine-rich repeat receptor-like protein kinase; | 98.47 | |
| PF13191 | 185 | AAA_16: AAA ATPase domain; PDB: 2V1U_A. | 98.45 | |
| PRK04195 | 482 | replication factor C large subunit; Provisional | 98.45 | |
| PRK14963 | 504 | DNA polymerase III subunits gamma and tau; Provisi | 98.44 | |
| cd01128 | 249 | rho_factor Transcription termination factor rho is | 98.43 | |
| PRK14960 | 702 | DNA polymerase III subunits gamma and tau; Provisi | 98.43 | |
| COG1474 | 366 | CDC6 Cdc6-related protein, AAA superfamily ATPase | 98.42 | |
| PRK14962 | 472 | DNA polymerase III subunits gamma and tau; Provisi | 98.4 | |
| PF05496 | 233 | RuvB_N: Holliday junction DNA helicase ruvB N-term | 98.39 | |
| PRK14957 | 546 | DNA polymerase III subunits gamma and tau; Provisi | 98.39 | |
| PLN00113 | 968 | leucine-rich repeat receptor-like protein kinase; | 98.35 | |
| PRK14956 | 484 | DNA polymerase III subunits gamma and tau; Provisi | 98.34 | |
| PTZ00112 | 1164 | origin recognition complex 1 protein; Provisional | 98.34 | |
| PRK08727 | 233 | hypothetical protein; Validated | 98.33 | |
| PRK14964 | 491 | DNA polymerase III subunits gamma and tau; Provisi | 98.33 | |
| PRK14951 | 618 | DNA polymerase III subunits gamma and tau; Provisi | 98.33 | |
| KOG0444 | 1255 | consensus Cytoskeletal regulator Flightless-I (con | 98.33 | |
| TIGR02397 | 355 | dnaX_nterm DNA polymerase III, subunit gamma and t | 98.3 | |
| PRK05564 | 313 | DNA polymerase III subunit delta'; Validated | 98.29 | |
| PRK07994 | 647 | DNA polymerase III subunits gamma and tau; Validat | 98.29 | |
| PRK13341 | 725 | recombination factor protein RarA/unknown domain f | 98.27 | |
| PRK14958 | 509 | DNA polymerase III subunits gamma and tau; Provisi | 98.27 | |
| PRK05896 | 605 | DNA polymerase III subunits gamma and tau; Validat | 98.25 | |
| PRK14955 | 397 | DNA polymerase III subunits gamma and tau; Provisi | 98.25 | |
| PRK08084 | 235 | DNA replication initiation factor; Provisional | 98.24 | |
| PRK09087 | 226 | hypothetical protein; Validated | 98.23 | |
| PRK09376 | 416 | rho transcription termination factor Rho; Provisio | 98.23 | |
| PRK14970 | 367 | DNA polymerase III subunits gamma and tau; Provisi | 98.21 | |
| COG3899 | 849 | Predicted ATPase [General function prediction only | 98.21 | |
| PRK08691 | 709 | DNA polymerase III subunits gamma and tau; Validat | 98.18 | |
| KOG0444 | 1255 | consensus Cytoskeletal regulator Flightless-I (con | 98.18 | |
| PRK14969 | 527 | DNA polymerase III subunits gamma and tau; Provisi | 98.17 | |
| PRK14954 | 620 | DNA polymerase III subunits gamma and tau; Provisi | 98.16 | |
| TIGR02903 | 615 | spore_lon_C ATP-dependent protease, Lon family. Me | 98.15 | |
| TIGR00678 | 188 | holB DNA polymerase III, delta' subunit. At positi | 98.15 | |
| PRK07471 | 365 | DNA polymerase III subunit delta'; Validated | 98.15 | |
| PRK09112 | 351 | DNA polymerase III subunit delta'; Validated | 98.14 | |
| PRK07940 | 394 | DNA polymerase III subunit delta'; Validated | 98.14 | |
| PRK15370 | 754 | E3 ubiquitin-protein ligase SlrP; Provisional | 98.14 | |
| PRK14959 | 624 | DNA polymerase III subunits gamma and tau; Provisi | 98.13 | |
| KOG2543 | 438 | consensus Origin recognition complex, subunit 5 [R | 98.11 | |
| PRK09111 | 598 | DNA polymerase III subunits gamma and tau; Validat | 98.11 | |
| PF00308 | 219 | Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 | 98.11 | |
| PRK14971 | 614 | DNA polymerase III subunits gamma and tau; Provisi | 98.1 | |
| PRK14952 | 584 | DNA polymerase III subunits gamma and tau; Provisi | 98.1 | |
| TIGR01242 | 364 | 26Sp45 26S proteasome subunit P45 family. Many pro | 98.1 | |
| TIGR00767 | 415 | rho transcription termination factor Rho. Members | 98.1 | |
| KOG0472 | 565 | consensus Leucine-rich repeat protein [Function un | 98.09 | |
| PRK05642 | 234 | DNA replication initiation factor; Validated | 98.08 | |
| PRK07764 | 824 | DNA polymerase III subunits gamma and tau; Validat | 98.08 | |
| TIGR03345 | 852 | VI_ClpV1 type VI secretion ATPase, ClpV1 family. M | 98.07 | |
| PRK08451 | 535 | DNA polymerase III subunits gamma and tau; Validat | 98.07 | |
| PRK15370 | 754 | E3 ubiquitin-protein ligase SlrP; Provisional | 98.06 | |
| KOG2028 | 554 | consensus ATPase related to the helicase subunit o | 98.05 | |
| PRK15386 | 426 | type III secretion protein GogB; Provisional | 98.05 | |
| PRK03992 | 389 | proteasome-activating nucleotidase; Provisional | 98.02 | |
| PRK06305 | 451 | DNA polymerase III subunits gamma and tau; Validat | 98.02 | |
| PHA02544 | 316 | 44 clamp loader, small subunit; Provisional | 98.0 | |
| COG3903 | 414 | Predicted ATPase [General function prediction only | 97.99 | |
| PRK07133 | 725 | DNA polymerase III subunits gamma and tau; Validat | 97.99 | |
| COG2255 | 332 | RuvB Holliday junction resolvasome, helicase subun | 97.99 | |
| KOG0989 | 346 | consensus Replication factor C, subunit RFC4 [Repl | 97.95 | |
| PRK14953 | 486 | DNA polymerase III subunits gamma and tau; Provisi | 97.95 | |
| PRK15387 | 788 | E3 ubiquitin-protein ligase SspH2; Provisional | 97.93 | |
| PRK14950 | 585 | DNA polymerase III subunits gamma and tau; Provisi | 97.93 | |
| PRK06647 | 563 | DNA polymerase III subunits gamma and tau; Validat | 97.93 | |
| TIGR02639 | 731 | ClpA ATP-dependent Clp protease ATP-binding subuni | 97.92 | |
| PF05621 | 302 | TniB: Bacterial TniB protein; InterPro: IPR008868 | 97.92 | |
| KOG0472 | 565 | consensus Leucine-rich repeat protein [Function un | 97.92 | |
| PRK08903 | 227 | DnaA regulatory inactivator Hda; Validated | 97.88 | |
| PRK14087 | 450 | dnaA chromosomal replication initiation protein; P | 97.88 | |
| PRK14088 | 440 | dnaA chromosomal replication initiation protein; P | 97.87 | |
| PRK15387 | 788 | E3 ubiquitin-protein ligase SspH2; Provisional | 97.86 | |
| PRK14948 | 620 | DNA polymerase III subunits gamma and tau; Provisi | 97.85 | |
| PRK14965 | 576 | DNA polymerase III subunits gamma and tau; Provisi | 97.84 | |
| CHL00095 | 821 | clpC Clp protease ATP binding subunit | 97.84 | |
| PF14516 | 331 | AAA_35: AAA-like domain | 97.82 | |
| TIGR03689 | 512 | pup_AAA proteasome ATPase. In the Actinobacteria, | 97.82 | |
| TIGR02881 | 261 | spore_V_K stage V sporulation protein K. Members o | 97.82 | |
| PRK05563 | 559 | DNA polymerase III subunits gamma and tau; Validat | 97.81 | |
| PRK10865 | 857 | protein disaggregation chaperone; Provisional | 97.8 | |
| TIGR00362 | 405 | DnaA chromosomal replication initiator protein Dna | 97.76 | |
| TIGR03346 | 852 | chaperone_ClpB ATP-dependent chaperone ClpB. Membe | 97.73 | |
| TIGR02880 | 284 | cbbX_cfxQ probable Rubsico expression protein CbbX | 97.72 | |
| PRK15386 | 426 | type III secretion protein GogB; Provisional | 97.72 | |
| TIGR01241 | 495 | FtsH_fam ATP-dependent metalloprotease FtsH. HflB( | 97.7 | |
| PRK14086 | 617 | dnaA chromosomal replication initiation protein; P | 97.7 | |
| PRK11331 | 459 | 5-methylcytosine-specific restriction enzyme subun | 97.69 | |
| PRK12422 | 445 | chromosomal replication initiation protein; Provis | 97.69 | |
| KOG4194 | 873 | consensus Membrane glycoprotein LIG-1 [Signal tran | 97.69 | |
| PTZ00454 | 398 | 26S protease regulatory subunit 6B-like protein; P | 97.68 | |
| PRK00149 | 450 | dnaA chromosomal replication initiation protein; R | 97.68 | |
| PRK08181 | 269 | transposase; Validated | 97.67 | |
| PF13855 | 61 | LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF | 97.65 | |
| KOG2227 | 529 | consensus Pre-initiation complex, subunit CDC6, AA | 97.65 | |
| CHL00181 | 287 | cbbX CbbX; Provisional | 97.65 | |
| PTZ00361 | 438 | 26 proteosome regulatory subunit 4-like protein; P | 97.62 | |
| PF14580 | 175 | LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ | 97.61 | |
| PRK11034 | 758 | clpA ATP-dependent Clp protease ATP-binding subuni | 97.6 | |
| PRK06620 | 214 | hypothetical protein; Validated | 97.6 | |
| smart00382 | 148 | AAA ATPases associated with a variety of cellular | 97.57 | |
| COG0593 | 408 | DnaA ATPase involved in DNA replication initiation | 97.54 | |
| KOG0991 | 333 | consensus Replication factor C, subunit RFC2 [Repl | 97.53 | |
| PRK08116 | 268 | hypothetical protein; Validated | 97.52 | |
| KOG0618 | 1081 | consensus Serine/threonine phosphatase 2C containi | 97.52 | |
| KOG1259 | 490 | consensus Nischarin, modulator of integrin alpha5 | 97.49 | |
| PF00004 | 132 | AAA: ATPase family associated with various cellula | 97.45 | |
| PRK10536 | 262 | hypothetical protein; Provisional | 97.41 | |
| COG1373 | 398 | Predicted ATPase (AAA+ superfamily) [General funct | 97.4 | |
| PF14580 | 175 | LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ | 97.4 | |
| PRK07399 | 314 | DNA polymerase III subunit delta'; Validated | 97.39 | |
| CHL00176 | 638 | ftsH cell division protein; Validated | 97.38 | |
| PRK06526 | 254 | transposase; Provisional | 97.38 | |
| KOG3207 | 505 | consensus Beta-tubulin folding cofactor E [Posttra | 97.36 | |
| COG0466 | 782 | Lon ATP-dependent Lon protease, bacterial type [Po | 97.35 | |
| TIGR00763 | 775 | lon ATP-dependent protease La. This protein is ind | 97.35 | |
| CHL00195 | 489 | ycf46 Ycf46; Provisional | 97.32 | |
| PRK14722 | 374 | flhF flagellar biosynthesis regulator FlhF; Provis | 97.31 | |
| PRK08118 | 167 | topology modulation protein; Reviewed | 97.3 | |
| COG1222 | 406 | RPT1 ATP-dependent 26S proteasome regulatory subun | 97.3 | |
| KOG4194 | 873 | consensus Membrane glycoprotein LIG-1 [Signal tran | 97.3 | |
| PRK10787 | 784 | DNA-binding ATP-dependent protease La; Provisional | 97.29 | |
| PF12799 | 44 | LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ | 97.29 | |
| PRK12727 | 559 | flagellar biosynthesis regulator FlhF; Provisional | 97.28 | |
| PF13177 | 162 | DNA_pol3_delta2: DNA polymerase III, delta subunit | 97.27 | |
| PRK05707 | 328 | DNA polymerase III subunit delta'; Validated | 97.22 | |
| PRK08058 | 329 | DNA polymerase III subunit delta'; Validated | 97.21 | |
| PRK00771 | 437 | signal recognition particle protein Srp54; Provisi | 97.2 | |
| PHA00729 | 226 | NTP-binding motif containing protein | 97.2 | |
| TIGR00602 | 637 | rad24 checkpoint protein rad24. This family is bas | 97.19 | |
| PRK12608 | 380 | transcription termination factor Rho; Provisional | 97.17 | |
| PF02562 | 205 | PhoH: PhoH-like protein; InterPro: IPR003714 PhoH | 97.14 | |
| PF04665 | 241 | Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 | 97.14 | |
| COG0542 | 786 | clpA ATP-binding subunits of Clp protease and DnaK | 97.14 | |
| KOG2004 | 906 | consensus Mitochondrial ATP-dependent protease PIM | 97.13 | |
| KOG0618 | 1081 | consensus Serine/threonine phosphatase 2C containi | 97.11 | |
| cd01123 | 235 | Rad51_DMC1_radA Rad51_DMC1_radA,B. This group of r | 97.11 | |
| PRK07261 | 171 | topology modulation protein; Provisional | 97.08 | |
| PRK06871 | 325 | DNA polymerase III subunit delta'; Validated | 97.08 | |
| KOG0739 | 439 | consensus AAA+-type ATPase [Posttranslational modi | 97.08 | |
| TIGR02237 | 209 | recomb_radB DNA repair and recombination protein R | 97.07 | |
| PF00448 | 196 | SRP54: SRP54-type protein, GTPase domain; InterPro | 97.07 | |
| PRK12377 | 248 | putative replication protein; Provisional | 97.07 | |
| PF10443 | 431 | RNA12: RNA12 protein; InterPro: IPR018850 Mitochon | 97.04 | |
| TIGR01243 | 733 | CDC48 AAA family ATPase, CDC48 subfamily. This sub | 97.03 | |
| TIGR02012 | 321 | tigrfam_recA protein RecA. This model describes or | 97.02 | |
| PRK12726 | 407 | flagellar biosynthesis regulator FlhF; Provisional | 96.99 | |
| PF05673 | 249 | DUF815: Protein of unknown function (DUF815); Inte | 96.98 | |
| KOG2228 | 408 | consensus Origin recognition complex, subunit 4 [R | 96.98 | |
| TIGR01243 | 733 | CDC48 AAA family ATPase, CDC48 subfamily. This sub | 96.98 | |
| cd00983 | 325 | recA RecA is a bacterial enzyme which has roles in | 96.98 | |
| PRK08769 | 319 | DNA polymerase III subunit delta'; Validated | 96.97 | |
| PRK09354 | 349 | recA recombinase A; Provisional | 96.96 | |
| KOG0532 | 722 | consensus Leucine-rich repeat (LRR) protein, conta | 96.96 | |
| cd01393 | 226 | recA_like RecA is a bacterial enzyme which has rol | 96.96 | |
| TIGR02639 | 731 | ClpA ATP-dependent Clp protease ATP-binding subuni | 96.95 | |
| COG1223 | 368 | Predicted ATPase (AAA+ superfamily) [General funct | 96.94 | |
| cd00116 | 319 | LRR_RI Leucine-rich repeats (LRRs), ribonuclease i | 96.92 | |
| KOG0735 | 952 | consensus AAA+-type ATPase [Posttranslational modi | 96.91 | |
| cd03238 | 176 | ABC_UvrA The excision repair protein UvrA; Nucleot | 96.86 | |
| PF13207 | 121 | AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6 | 96.86 | |
| PF13855 | 61 | LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF | 96.85 | |
| COG0396 | 251 | sufC Cysteine desulfurase activator ATPase [Posttr | 96.84 | |
| cd00116 | 319 | LRR_RI Leucine-rich repeats (LRRs), ribonuclease i | 96.84 | |
| KOG0741 | 744 | consensus AAA+-type ATPase [Posttranslational modi | 96.84 | |
| PRK09183 | 259 | transposase/IS protein; Provisional | 96.82 | |
| TIGR01425 | 429 | SRP54_euk signal recognition particle protein SRP5 | 96.81 | |
| TIGR02640 | 262 | gas_vesic_GvpN gas vesicle protein GvpN. Members o | 96.78 | |
| TIGR02238 | 313 | recomb_DMC1 meiotic recombinase Dmc1. This model d | 96.77 | |
| COG1875 | 436 | NYN ribonuclease and ATPase of PhoH family domains | 96.75 | |
| COG0542 | 786 | clpA ATP-binding subunits of Clp protease and DnaK | 96.74 | |
| PRK05541 | 176 | adenylylsulfate kinase; Provisional | 96.73 | |
| COG0470 | 325 | HolB ATPase involved in DNA replication [DNA repli | 96.73 | |
| TIGR03499 | 282 | FlhF flagellar biosynthetic protein FlhF. | 96.72 | |
| COG2812 | 515 | DnaX DNA polymerase III, gamma/tau subunits [DNA r | 96.72 | |
| cd03246 | 173 | ABCC_Protease_Secretion This family represents the | 96.71 | |
| cd03223 | 166 | ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cass | 96.7 | |
| PRK07952 | 244 | DNA replication protein DnaC; Validated | 96.7 | |
| KOG0733 | 802 | consensus Nuclear AAA ATPase (VCP subfamily) [Post | 96.7 | |
| cd01120 | 165 | RecA-like_NTPases RecA-like NTPases. This family i | 96.69 | |
| PRK05703 | 424 | flhF flagellar biosynthesis regulator FlhF; Valida | 96.67 | |
| smart00763 | 361 | AAA_PrkA PrkA AAA domain. This is a family of PrkA | 96.67 | |
| cd03214 | 180 | ABC_Iron-Siderophores_B12_Hemin ABC transporters, | 96.66 | |
| COG1126 | 240 | GlnQ ABC-type polar amino acid transport system, A | 96.66 | |
| PRK06696 | 223 | uridine kinase; Validated | 96.66 | |
| PLN03187 | 344 | meiotic recombination protein DMC1 homolog; Provis | 96.66 | |
| cd03216 | 163 | ABC_Carb_Monos_I This family represents the domain | 96.65 | |
| KOG0734 | 752 | consensus AAA+-type ATPase containing the peptidas | 96.64 | |
| KOG3665 | 699 | consensus ZYG-1-like serine/threonine protein kina | 96.64 | |
| PF08423 | 256 | Rad51: Rad51; InterPro: IPR013632 This domain is f | 96.63 | |
| cd01131 | 198 | PilT Pilus retraction ATPase PilT. PilT is a nucle | 96.62 | |
| PRK07993 | 334 | DNA polymerase III subunit delta'; Validated | 96.61 | |
| COG3267 | 269 | ExeA Type II secretory pathway, component ExeA (pr | 96.6 | |
| PRK06921 | 266 | hypothetical protein; Provisional | 96.6 | |
| PRK08533 | 230 | flagellar accessory protein FlaH; Reviewed | 96.58 | |
| PRK09361 | 225 | radB DNA repair and recombination protein RadB; Pr | 96.57 | |
| KOG2120 | 419 | consensus SCF ubiquitin ligase, Skp2 component [Po | 96.57 | |
| COG1121 | 254 | ZnuC ABC-type Mn/Zn transport systems, ATPase comp | 96.56 | |
| PLN03150 | 623 | hypothetical protein; Provisional | 96.55 | |
| COG1484 | 254 | DnaC DNA replication protein [DNA replication, rec | 96.55 | |
| COG1136 | 226 | SalX ABC-type antimicrobial peptide transport syst | 96.55 | |
| PRK11889 | 436 | flhF flagellar biosynthesis regulator FlhF; Provis | 96.54 | |
| PF00154 | 322 | RecA: recA bacterial DNA recombination protein; In | 96.53 | |
| PRK04296 | 190 | thymidine kinase; Provisional | 96.53 | |
| PRK10867 | 433 | signal recognition particle protein; Provisional | 96.53 | |
| PRK09270 | 229 | nucleoside triphosphate hydrolase domain-containin | 96.52 | |
| PRK14723 | 767 | flhF flagellar biosynthesis regulator FlhF; Provis | 96.51 | |
| PRK06090 | 319 | DNA polymerase III subunit delta'; Validated | 96.51 | |
| TIGR03877 | 237 | thermo_KaiC_1 KaiC domain protein, Ph0284 family. | 96.49 | |
| KOG1969 | 877 | consensus DNA replication checkpoint protein CHL12 | 96.48 | |
| PRK06835 | 329 | DNA replication protein DnaC; Validated | 96.48 | |
| TIGR00959 | 428 | ffh signal recognition particle protein. This mode | 96.47 | |
| PF01695 | 178 | IstB_IS21: IstB-like ATP binding protein; InterPro | 96.46 | |
| TIGR03346 | 852 | chaperone_ClpB ATP-dependent chaperone ClpB. Membe | 96.45 | |
| cd03247 | 178 | ABCC_cytochrome_bd The CYD subfamily implicated in | 96.44 | |
| cd03222 | 177 | ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibi | 96.44 | |
| cd03230 | 173 | ABC_DR_subfamily_A This family of ATP-binding prot | 96.43 | |
| COG0488 | 530 | Uup ATPase components of ABC transporters with dup | 96.42 | |
| PRK04132 | 846 | replication factor C small subunit; Provisional | 96.41 | |
| KOG2035 | 351 | consensus Replication factor C, subunit RFC3 [Cell | 96.41 | |
| cd01394 | 218 | radB RadB. The archaeal protein radB shares simila | 96.4 | |
| TIGR03345 | 852 | VI_ClpV1 type VI secretion ATPase, ClpV1 family. M | 96.39 | |
| PRK10865 | 857 | protein disaggregation chaperone; Provisional | 96.38 | |
| TIGR02858 | 270 | spore_III_AA stage III sporulation protein AA. Mem | 96.36 | |
| COG2884 | 223 | FtsE Predicted ATPase involved in cell division [C | 96.36 | |
| COG4608 | 268 | AppF ABC-type oligopeptide transport system, ATPas | 96.36 | |
| PRK12723 | 388 | flagellar biosynthesis regulator FlhF; Provisional | 96.34 | |
| KOG4658 | 889 | consensus Apoptotic ATPase [Signal transduction me | 96.33 | |
| COG0541 | 451 | Ffh Signal recognition particle GTPase [Intracellu | 96.28 | |
| KOG3665 | 699 | consensus ZYG-1-like serine/threonine protein kina | 96.27 | |
| COG1618 | 179 | Predicted nucleotide kinase [Nucleotide transport | 96.27 | |
| PRK08939 | 306 | primosomal protein DnaI; Reviewed | 96.27 | |
| CHL00095 | 821 | clpC Clp protease ATP binding subunit | 96.25 | |
| PTZ00035 | 337 | Rad51 protein; Provisional | 96.25 | |
| KOG0730 | 693 | consensus AAA+-type ATPase [Posttranslational modi | 96.24 | |
| PRK14974 | 336 | cell division protein FtsY; Provisional | 96.23 | |
| PRK06067 | 234 | flagellar accessory protein FlaH; Validated | 96.22 | |
| PRK06547 | 172 | hypothetical protein; Provisional | 96.22 | |
| PRK11034 | 758 | clpA ATP-dependent Clp protease ATP-binding subuni | 96.22 | |
| PRK04301 | 317 | radA DNA repair and recombination protein RadA; Va | 96.2 | |
| PRK15455 | 644 | PrkA family serine protein kinase; Provisional | 96.18 | |
| PLN03186 | 342 | DNA repair protein RAD51 homolog; Provisional | 96.17 | |
| KOG3207 | 505 | consensus Beta-tubulin folding cofactor E [Posttra | 96.17 | |
| PLN00020 | 413 | ribulose bisphosphate carboxylase/oxygenase activa | 96.17 | |
| cd03228 | 171 | ABCC_MRP_Like The MRP (Mutidrug Resistance Protein | 96.17 | |
| cd02025 | 220 | PanK Pantothenate kinase (PanK) catalyzes the phos | 96.16 | |
| TIGR02239 | 316 | recomb_RAD51 DNA repair protein RAD51. This eukary | 96.16 | |
| cd03221 | 144 | ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is | 96.15 | |
| PRK10733 | 644 | hflB ATP-dependent metalloprotease; Reviewed | 96.15 | |
| cd03115 | 173 | SRP The signal recognition particle (SRP) mediates | 96.14 | |
| TIGR00554 | 290 | panK_bact pantothenate kinase, bacterial type. Sho | 96.14 | |
| cd03229 | 178 | ABC_Class3 This class is comprised of all BPD (Bin | 96.13 | |
| KOG0731 | 774 | consensus AAA+-type ATPase containing the peptidas | 96.13 | |
| COG0468 | 279 | RecA RecA/RadA recombinase [DNA replication, recom | 96.12 | |
| KOG4237 | 498 | consensus Extracellular matrix protein slit, conta | 96.1 | |
| cd01133 | 274 | F1-ATPase_beta F1 ATP synthase beta subunit, nucle | 96.08 | |
| PF12799 | 44 | LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ | 96.08 | |
| KOG0744 | 423 | consensus AAA+-type ATPase [Posttranslational modi | 96.08 | |
| COG1120 | 258 | FepC ABC-type cobalamin/Fe3+-siderophores transpor | 96.07 | |
| cd03281 | 213 | ABC_MSH5_euk MutS5 homolog in eukaryotes. The MutS | 96.06 | |
| TIGR02236 | 310 | recomb_radA DNA repair and recombination protein R | 96.04 | |
| cd00267 | 157 | ABC_ATPase ABC (ATP-binding cassette) transporter | 96.03 | |
| PF05659 | 147 | RPW8: Arabidopsis broad-spectrum mildew resistance | 96.01 | |
| PF13238 | 129 | AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB | 95.99 | |
| PRK13543 | 214 | cytochrome c biogenesis protein CcmA; Provisional | 95.99 | |
| PRK06964 | 342 | DNA polymerase III subunit delta'; Validated | 95.97 | |
| TIGR03878 | 259 | thermo_KaiC_2 KaiC domain protein, AF_0795 family. | 95.96 | |
| cd01121 | 372 | Sms Sms (bacterial radA) DNA repair protein. This | 95.96 | |
| PRK09519 | 790 | recA DNA recombination protein RecA; Reviewed | 95.92 | |
| KOG1514 | 767 | consensus Origin recognition complex, subunit 1, a | 95.9 | |
| TIGR00064 | 272 | ftsY signal recognition particle-docking protein F | 95.9 | |
| PF00485 | 194 | PRK: Phosphoribulokinase / Uridine kinase family; | 95.9 | |
| PRK04328 | 249 | hypothetical protein; Provisional | 95.88 | |
| PLN03150 | 623 | hypothetical protein; Provisional | 95.84 | |
| cd03220 | 224 | ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transpo | 95.82 | |
| cd03217 | 200 | ABC_FeS_Assembly ABC-type transport system involve | 95.79 | |
| PRK09544 | 251 | znuC high-affinity zinc transporter ATPase; Review | 95.79 | |
| COG1102 | 179 | Cmk Cytidylate kinase [Nucleotide transport and me | 95.78 | |
| PTZ00301 | 210 | uridine kinase; Provisional | 95.78 | |
| KOG1532 | 366 | consensus GTPase XAB1, interacts with DNA repair p | 95.77 | |
| PRK12724 | 432 | flagellar biosynthesis regulator FlhF; Provisional | 95.77 | |
| PRK08233 | 182 | hypothetical protein; Provisional | 95.77 | |
| cd02019 | 69 | NK Nucleoside/nucleotide kinase (NK) is a protein | 95.75 | |
| PRK05480 | 209 | uridine/cytidine kinase; Provisional | 95.74 | |
| TIGR03740 | 223 | galliderm_ABC gallidermin-class lantibiotic protec | 95.74 | |
| PRK14721 | 420 | flhF flagellar biosynthesis regulator FlhF; Provis | 95.72 | |
| PRK13531 | 498 | regulatory ATPase RavA; Provisional | 95.72 | |
| PF07728 | 139 | AAA_5: AAA domain (dynein-related subfamily); Inte | 95.7 | |
| cd01124 | 187 | KaiC KaiC is a circadian clock protein primarily f | 95.66 | |
| PRK00889 | 175 | adenylylsulfate kinase; Provisional | 95.65 | |
| cd03283 | 199 | ABC_MutS-like MutS-like homolog in eukaryotes. The | 95.65 | |
| PRK07667 | 193 | uridine kinase; Provisional | 95.64 | |
| cd03213 | 194 | ABCG_EPDR ABCG transporters are involved in eye pi | 95.61 | |
| PF13671 | 143 | AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1 | 95.6 | |
| cd03215 | 182 | ABC_Carb_Monos_II This family represents domain II | 95.59 | |
| TIGR00235 | 207 | udk uridine kinase. Model contains a number of lon | 95.59 | |
| cd03232 | 192 | ABC_PDR_domain2 The pleiotropic drug resistance-li | 95.59 | |
| ) proteins. It has been suggested that torsins play a role in effectively managing protein folding and that possible breakdown in a neuroprotective mechanism that is, in part, mediated by torsins may be responsible for the neuronal dysfunction associated with dystonia [].; GO: 0005524 ATP binding, 0051085 chaperone mediated protein folding requiring cofactor" target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=PF06309">PF06309 | 127 | Torsin: Torsin; InterPro: IPR010448 This family co | 95.59 | |
| KOG0728 | 404 | consensus 26S proteasome regulatory complex, ATPas | 95.58 | |
| cd01135 | 276 | V_A-ATPase_B V/A-type ATP synthase (non-catalytic) | 95.58 | |
| PRK13537 | 306 | nodulation ABC transporter NodI; Provisional | 95.56 | |
| KOG0532 | 722 | consensus Leucine-rich repeat (LRR) protein, conta | 95.56 | |
| PRK05973 | 237 | replicative DNA helicase; Provisional | 95.55 | |
| COG1066 | 456 | Sms Predicted ATP-dependent serine protease [Postt | 95.53 | |
| COG4555 | 245 | NatA ABC-type Na+ transport system, ATPase compone | 95.53 | |
| COG1131 | 293 | CcmA ABC-type multidrug transport system, ATPase c | 95.53 | |
| PRK06995 | 484 | flhF flagellar biosynthesis regulator FlhF; Valida | 95.51 | |
| COG0467 | 260 | RAD55 RecA-superfamily ATPases implicated in signa | 95.5 | |
| PRK06762 | 166 | hypothetical protein; Provisional | 95.5 | |
| PF06745 | 226 | KaiC: KaiC; InterPro: IPR014774 This entry represe | 95.5 | |
| PTZ00494 | 664 | tuzin-like protein; Provisional | 95.49 | |
| PF13481 | 193 | AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C. | 95.49 | |
| PRK05439 | 311 | pantothenate kinase; Provisional | 95.48 | |
| PRK08699 | 325 | DNA polymerase III subunit delta'; Validated | 95.48 | |
| COG1419 | 407 | FlhF Flagellar GTP-binding protein [Cell motility | 95.46 | |
| KOG2120 | 419 | consensus SCF ubiquitin ligase, Skp2 component [Po | 95.44 | |
| COG0572 | 218 | Udk Uridine kinase [Nucleotide transport and metab | 95.43 | |
| KOG0743 | 457 | consensus AAA+-type ATPase [Posttranslational modi | 95.42 | |
| cd02027 | 149 | APSK Adenosine 5'-phosphosulfate kinase (APSK) cat | 95.41 | |
| PF01583 | 156 | APS_kinase: Adenylylsulphate kinase; InterPro: IPR | 95.36 | |
| TIGR01360 | 188 | aden_kin_iso1 adenylate kinase, isozyme 1 subfamil | 95.34 | |
| COG1703 | 323 | ArgK Putative periplasmic protein kinase ArgK and | 95.34 | |
| PRK13545 | 549 | tagH teichoic acids export protein ATP-binding sub | 95.28 | |
| PF03308 | 266 | ArgK: ArgK protein; InterPro: IPR005129 Bacterial | 95.27 | |
| PRK03839 | 180 | putative kinase; Provisional | 95.26 | |
| KOG0924 | 1042 | consensus mRNA splicing factor ATP-dependent RNA h | 95.24 | |
| PRK04040 | 188 | adenylate kinase; Provisional | 95.24 | |
| PF03205 | 140 | MobB: Molybdopterin guanine dinucleotide synthesis | 95.2 | |
| PF12775 | 272 | AAA_7: P-loop containing dynein motor region D3; P | 95.18 | |
| PRK06851 | 367 | hypothetical protein; Provisional | 95.18 | |
| TIGR02655 | 484 | circ_KaiC circadian clock protein KaiC. Members of | 95.15 | |
| TIGR02030 | 337 | BchI-ChlI magnesium chelatase ATPase subunit I. Th | 95.13 | |
| PRK12597 | 461 | F0F1 ATP synthase subunit beta; Provisional | 95.13 | |
| KOG0729 | 435 | consensus 26S proteasome regulatory complex, ATPas | 95.1 | |
| TIGR01420 | 343 | pilT_fam pilus retraction protein PilT. This model | 95.1 | |
| cd03282 | 204 | ABC_MSH4_euk MutS4 homolog in eukaryotes. The MutS | 95.09 | |
| COG3640 | 255 | CooC CO dehydrogenase maturation factor [Cell divi | 95.09 | |
| PRK00625 | 173 | shikimate kinase; Provisional | 95.06 | |
| KOG0733 | 802 | consensus Nuclear AAA ATPase (VCP subfamily) [Post | 95.05 | |
| PRK13536 | 340 | nodulation factor exporter subunit NodI; Provision | 95.04 | |
| cd02023 | 198 | UMPK Uridine monophosphate kinase (UMPK, EC 2.7.1. | 95.04 | |
| TIGR00150 | 133 | HI0065_YjeE ATPase, YjeE family. Members of this f | 95.03 | |
| COG4618 | 580 | ArpD ABC-type protease/lipase transport system, AT | 95.02 | |
| TIGR03881 | 229 | KaiC_arch_4 KaiC domain protein, PAE1156 family. M | 95.02 | |
| COG0464 | 494 | SpoVK ATPases of the AAA+ class [Posttranslational | 95.02 | |
| PF08433 | 270 | KTI12: Chromatin associated protein KTI12 ; InterP | 95.01 | |
| PRK15439 | 510 | autoinducer 2 ABC transporter ATP-binding protein | 94.99 | |
| KOG1259 | 490 | consensus Nischarin, modulator of integrin alpha5 | 94.98 | |
| PRK10751 | 173 | molybdopterin-guanine dinucleotide biosynthesis pr | 94.97 | |
| cd01122 | 271 | GP4d_helicase GP4d_helicase is a homohexameric 5'- | 94.96 | |
| TIGR02322 | 179 | phosphon_PhnN phosphonate metabolism protein/1,5-b | 94.95 | |
| COG1224 | 450 | TIP49 DNA helicase TIP49, TBP-interacting protein | 94.94 | |
| PRK11823 | 446 | DNA repair protein RadA; Provisional | 94.92 | |
| TIGR00416 | 454 | sms DNA repair protein RadA. The gene protuct code | 94.9 | |
| COG1428 | 216 | Deoxynucleoside kinases [Nucleotide transport and | 94.89 | |
| PRK10416 | 318 | signal recognition particle-docking protein FtsY; | 94.88 | |
| PF03215 | 519 | Rad17: Rad17 cell cycle checkpoint protein | 94.87 | |
| COG2274 | 709 | SunT ABC-type bacteriocin/lantibiotic exporters, c | 94.85 | |
| cd00544 | 169 | CobU Adenosylcobinamide kinase / adenosylcobinamid | 94.84 | |
| COG3910 | 233 | Predicted ATPase [General function prediction only | 94.84 | |
| cd02024 | 187 | NRK1 Nicotinamide riboside kinase (NRK) is an enzy | 94.83 | |
| TIGR00390 | 441 | hslU ATP-dependent protease HslVU, ATPase subunit. | 94.82 | |
| TIGR01359 | 183 | UMP_CMP_kin_fam UMP-CMP kinase family. This subfam | 94.82 | |
| TIGR03575 | 340 | selen_PSTK_euk L-seryl-tRNA(Sec) kinase, eukaryoti | 94.82 | |
| COG2607 | 287 | Predicted ATPase (AAA+ superfamily) [General funct | 94.82 | |
| TIGR03305 | 449 | alt_F1F0_F1_bet alternate F1F0 ATPase, F1 subunit | 94.81 | |
| PRK13765 | 637 | ATP-dependent protease Lon; Provisional | 94.76 | |
| PF00910 | 107 | RNA_helicase: RNA helicase; InterPro: IPR000605 He | 94.76 | |
| PRK13409 | 590 | putative ATPase RIL; Provisional | 94.75 | |
| cd00561 | 159 | CobA_CobO_BtuR ATP:corrinoid adenosyltransferase B | 94.75 | |
| PRK05342 | 412 | clpX ATP-dependent protease ATP-binding subunit Cl | 94.74 | |
| cd03227 | 162 | ABC_Class2 ABC-type Class 2 contains systems invol | 94.74 | |
| PRK00131 | 175 | aroK shikimate kinase; Reviewed | 94.74 | |
| PRK06217 | 183 | hypothetical protein; Validated | 94.73 | |
| PRK13407 | 334 | bchI magnesium chelatase subunit I; Provisional | 94.72 | |
| PRK06731 | 270 | flhF flagellar biosynthesis regulator FlhF; Valida | 94.72 | |
| TIGR02655 | 484 | circ_KaiC circadian clock protein KaiC. Members of | 94.7 | |
| PRK07132 | 299 | DNA polymerase III subunit delta'; Validated | 94.7 | |
| COG0488 | 530 | Uup ATPase components of ABC transporters with dup | 94.7 | |
| PF07726 | 131 | AAA_3: ATPase family associated with various cellu | 94.68 | |
| cd00227 | 175 | CPT Chloramphenicol (Cm) phosphotransferase (CPT). | 94.65 | |
| KOG4341 | 483 | consensus F-box protein containing LRR [General fu | 94.65 | |
| COG1124 | 252 | DppF ABC-type dipeptide/oligopeptide/nickel transp | 94.63 | |
| cd02028 | 179 | UMPK_like Uridine monophosphate kinase_like (UMPK_ | 94.63 | |
| PF00625 | 183 | Guanylate_kin: Guanylate kinase; InterPro: IPR0081 | 94.62 | |
| PRK10463 | 290 | hydrogenase nickel incorporation protein HypB; Pro | 94.62 | |
| PRK09280 | 463 | F0F1 ATP synthase subunit beta; Validated | 94.62 | |
| PLN02165 | 334 | adenylate isopentenyltransferase | 94.6 | |
| CHL00081 | 350 | chlI Mg-protoporyphyrin IX chelatase | 94.6 | |
| PF13245 | 76 | AAA_19: Part of AAA domain | 94.59 | |
| TIGR01650 | 327 | PD_CobS cobaltochelatase, CobS subunit. This model | 94.58 | |
| PRK09435 | 332 | membrane ATPase/protein kinase; Provisional | 94.58 | |
| TIGR00764 | 608 | lon_rel lon-related putative ATP-dependent proteas | 94.57 | |
| KOG0735 | 952 | consensus AAA+-type ATPase [Posttranslational modi | 94.56 | |
| KOG0727 | 408 | consensus 26S proteasome regulatory complex, ATPas | 94.55 | |
| KOG0736 | 953 | consensus Peroxisome assembly factor 2 containing | 94.54 | |
| PRK13768 | 253 | GTPase; Provisional | 94.49 | |
| COG0003 | 322 | ArsA Predicted ATPase involved in chromosome parti | 94.48 | |
| cd02020 | 147 | CMPK Cytidine monophosphate kinase (CMPK) catalyze | 94.47 | |
| PHA02774 | 613 | E1; Provisional | 94.47 | |
| PRK13949 | 169 | shikimate kinase; Provisional | 94.46 | |
| COG3854 | 308 | SpoIIIAA ncharacterized protein conserved in bacte | 94.45 | |
| TIGR03263 | 180 | guanyl_kin guanylate kinase. Members of this famil | 94.44 | |
| TIGR00073 | 207 | hypB hydrogenase accessory protein HypB. HypB is i | 94.44 | |
| TIGR00176 | 155 | mobB molybdopterin-guanine dinucleotide biosynthes | 94.44 | |
| cd02021 | 150 | GntK Gluconate kinase (GntK) catalyzes the phospho | 94.43 | |
| COG1763 | 161 | MobB Molybdopterin-guanine dinucleotide biosynthes | 94.42 | |
| PRK00300 | 205 | gmk guanylate kinase; Provisional | 94.39 | |
| cd01125 | 239 | repA Hexameric Replicative Helicase RepA. RepA is | 94.38 | |
| PRK03846 | 198 | adenylylsulfate kinase; Provisional | 94.37 | |
| TIGR02788 | 308 | VirB11 P-type DNA transfer ATPase VirB11. The VirB | 94.37 | |
| TIGR02902 | 531 | spore_lonB ATP-dependent protease LonB. Members of | 94.35 | |
| PF03193 | 161 | DUF258: Protein of unknown function, DUF258; Inter | 94.34 | |
| PF05970 | 364 | PIF1: PIF1-like helicase; InterPro: IPR010285 This | 94.32 | |
| COG0563 | 178 | Adk Adenylate kinase and related kinases [Nucleoti | 94.31 | |
| TIGR01039 | 461 | atpD ATP synthase, F1 beta subunit. The sequences | 94.3 | |
| PF06068 | 398 | TIP49: TIP49 C-terminus; InterPro: IPR010339 This | 94.3 | |
| PF13479 | 213 | AAA_24: AAA domain | 94.28 | |
| PRK08149 | 428 | ATP synthase SpaL; Validated | 94.28 | |
| PRK05917 | 290 | DNA polymerase III subunit delta'; Validated | 94.26 | |
| PRK12678 | 672 | transcription termination factor Rho; Provisional | 94.26 | |
| KOG3347 | 176 | consensus Predicted nucleotide kinase/nuclear prot | 94.24 | |
| PF08477 | 119 | Miro: Miro-like protein; InterPro: IPR013684 Mitoc | 94.24 | |
| TIGR00382 | 413 | clpX endopeptidase Clp ATP-binding regulatory subu | 94.24 | |
| PRK06002 | 450 | fliI flagellum-specific ATP synthase; Validated | 94.24 | |
| PRK08972 | 444 | fliI flagellum-specific ATP synthase; Validated | 94.23 | |
| cd00984 | 242 | DnaB_C DnaB helicase C terminal domain. The hexame | 94.23 | |
| PRK14530 | 215 | adenylate kinase; Provisional | 94.23 | |
| COG4886 | 394 | Leucine-rich repeat (LRR) protein [Function unknow | 94.23 | |
| PF00006 | 215 | ATP-synt_ab: ATP synthase alpha/beta family, nucle | 94.22 | |
| cd00820 | 107 | PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPC | 94.21 | |
| cd00071 | 137 | GMPK Guanosine monophosphate kinase (GMPK, EC 2.7. | 94.21 | |
| PTZ00185 | 574 | ATPase alpha subunit; Provisional | 94.19 | |
| PRK08927 | 442 | fliI flagellum-specific ATP synthase; Validated | 94.18 | |
| PRK14527 | 191 | adenylate kinase; Provisional | 94.18 | |
| PRK13947 | 171 | shikimate kinase; Provisional | 94.17 | |
| PF02374 | 305 | ArsA_ATPase: Anion-transporting ATPase; PDB: 2WOO_ | 94.16 | |
| PF13086 | 236 | AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV | 94.14 | |
| PF03266 | 168 | NTPase_1: NTPase; InterPro: IPR004948 This entry r | 94.13 | |
| PRK10078 | 186 | ribose 1,5-bisphosphokinase; Provisional | 94.13 | |
| PF03029 | 238 | ATP_bind_1: Conserved hypothetical ATP binding pro | 94.12 | |
| KOG1859 | 1096 | consensus Leucine-rich repeat proteins [General fu | 94.11 | |
| PF12061 | 402 | DUF3542: Protein of unknown function (DUF3542); In | 94.06 | |
| PRK14737 | 186 | gmk guanylate kinase; Provisional | 94.06 | |
| PRK15429 | 686 | formate hydrogenlyase transcriptional activator Fh | 94.05 | |
| cd01129 | 264 | PulE-GspE PulE/GspE The type II secretory pathway | 94.03 | |
| PRK13409 | 590 | putative ATPase RIL; Provisional | 94.02 | |
| PRK05057 | 172 | aroK shikimate kinase I; Reviewed | 93.99 | |
| cd00464 | 154 | SK Shikimate kinase (SK) is the fifth enzyme in th | 93.98 | |
| KOG2170 | 344 | consensus ATPase of the AAA+ superfamily [General | 93.97 | |
| PF13604 | 196 | AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL | 93.96 | |
| TIGR01313 | 163 | therm_gnt_kin carbohydrate kinase, thermoresistant | 93.93 | |
| cd03284 | 216 | ABC_MutS1 MutS1 homolog in eukaryotes. The MutS pr | 93.91 | |
| TIGR01040 | 466 | V-ATPase_V1_B V-type (H+)-ATPase V1, B subunit. Th | 93.9 | |
| PRK14529 | 223 | adenylate kinase; Provisional | 93.89 | |
| PF01078 | 206 | Mg_chelatase: Magnesium chelatase, subunit ChlI; I | 93.88 | |
| PRK13695 | 174 | putative NTPase; Provisional | 93.88 | |
| PRK05201 | 443 | hslU ATP-dependent protease ATP-binding subunit Hs | 93.87 | |
| cd01672 | 200 | TMPK Thymidine monophosphate kinase (TMPK), also k | 93.86 | |
| COG2019 | 189 | AdkA Archaeal adenylate kinase [Nucleotide transpo | 93.86 | |
| PF00158 | 168 | Sigma54_activat: Sigma-54 interaction domain; Inte | 93.85 | |
| PRK06936 | 439 | type III secretion system ATPase; Provisional | 93.85 | |
| PF00005 | 137 | ABC_tran: ABC transporter This structure is on hol | 93.84 | |
| TIGR03880 | 224 | KaiC_arch_3 KaiC domain protein, AF_0351 family. T | 93.84 | |
| PRK11174 | 588 | cysteine/glutathione ABC transporter membrane/ATP- | 93.84 | |
| smart00534 | 185 | MUTSac ATPase domain of DNA mismatch repair MUTS f | 93.82 | |
| PRK12339 | 197 | 2-phosphoglycerate kinase; Provisional | 93.8 | |
| KOG1051 | 898 | consensus Chaperone HSP104 and related ATP-depende | 93.8 | |
| PRK13975 | 196 | thymidylate kinase; Provisional | 93.79 |
| >KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
Probab=100.00 E-value=2.3e-65 Score=580.95 Aligned_cols=550 Identities=20% Similarity=0.266 Sum_probs=405.1
Q ss_pred HHHHHHHHHHHHHHHhHHHHHHhhcCCcchHHHHHHHHHHHHHHHHHHHhHHHhHHHH-----------------hhhcc
Q 036977 41 LKDQVKQLGYKRETVQQPVNHARLQGDELYEGVTDWLHSVDEFISEGVAKSIIDDEER-----------------AKKFC 103 (693)
Q Consensus 41 l~~~l~~l~~~l~~i~~~l~~ae~~~~~~~~~~~~wl~~l~~~~y~~~~ed~ld~~~~-----------------~~~~~ 103 (693)
.++.+..|+..+..++.+++|++.++.. ...+..|.+.+++++|+ ++|+++.+.- .+.-|
T Consensus 26 ~~~~i~~Lk~~L~~l~~~l~d~~a~~~~-~~~~~~~~e~~~~~~~~--~e~~~~~~~v~~~~~~~~~~l~~~~~~~~~~c 102 (889)
T KOG4658|consen 26 KDNYILELKENLKALQSALEDLDAKRDD-LERRVNWEEDVGDLVYL--AEDIIWLFLVEEIERKANDLLSTRSVERQRLC 102 (889)
T ss_pred hHHHHHHHHHHHHHHHHHHHHHHhhcch-HHHHHHHHHHHHHHHHH--HHHHHHHHHHHHHHHHHhHHhhhhHHHHHHHh
Confidence 3456666666667777777888887644 78899999999999999 9999988641 11222
Q ss_pred ccCC-CCchhhhcHHHHHHHHHHHHHHHHhcCCCCCccccCC-CCCCCCCCCCCCCccccchHHHHHHHHHHHhcCCceE
Q 036977 104 FKGL-CPNLMSRYKLSKQAAKAAEAAAGLVGKGNFSNVSYRP-TPKSTGLNDGKDNEAFDSRMKVFQDVMEALKDDKLNI 181 (693)
Q Consensus 104 ~~~~-~~~~~~~~~~~~~i~~~~~~l~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~gR~~~~~~l~~~L~~~~~~v 181 (693)
+..+ ..+...-+.+++++.++...++.+...+.++.+...+ +++.....+-.+... +|.+..++++.+.|.+++.++
T Consensus 103 ~~~~~~~~~~~~~~~~~rv~~~l~~ve~l~~~~~~~~~~~~~~~~~~~e~~~~~~~~~-VG~e~~~~kl~~~L~~d~~~i 181 (889)
T KOG4658|consen 103 LCGFCSKNVSDSYKYGKRVSKVLREVESLGSKGVFEVVGESLDPREKVETRPIQSESD-VGLETMLEKLWNRLMEDDVGI 181 (889)
T ss_pred hhhhHhHhhhhhHhHHHHHHHHHHHHHHhccccceecccccccchhhcccCCCCcccc-ccHHHHHHHHHHHhccCCCCE
Confidence 2222 2234445666777777777777775555566555422 222222222223333 999999999999999888899
Q ss_pred EEEEecCCCcHHHHHHHHHHHhh-ccCCCCEEEEEEecCCCChHHHHHHHHHHhCCCCCC--CCCHHHHHHHHHHHHhcC
Q 036977 182 IGVYGMGGVGKTTLVKQVAKKVM-EDKLIDKVVMAEVTQNPDPQKIQDKLASDLGMKFDL--NDSIHHRASRLRERLKQE 258 (693)
Q Consensus 182 i~I~G~gGiGKTtLa~~v~~~~~-~~~~F~~~~wv~vs~~~~~~~~~~~i~~~l~~~~~~--~~~~~~~~~~l~~~L~~~ 258 (693)
++|+||||+||||||+.++++.. ++.+|+.++||+||+.++...++++|+..++..... ....++.+..+.+.|+.
T Consensus 182 v~i~GMGGvGKTTL~~qi~N~~~~v~~~Fd~~iWV~VSk~f~~~~iq~~Il~~l~~~~~~~~~~~~~~~~~~i~~~L~~- 260 (889)
T KOG4658|consen 182 VGIYGMGGVGKTTLARQIFNKFDEVGNHFDGVIWVVVSKEFTTRKIQQTILERLGLLDEEWEDKEEDELASKLLNLLEG- 260 (889)
T ss_pred EEEECCCcccHHHHHHHHhcccchhcccCceEEEEEEcccccHHhHHHHHHHHhccCCcccchhhHHHHHHHHHHHhcc-
Confidence 99999999999999999999998 899999999999999999999999999999875443 13346788899999998
Q ss_pred CcEEEEEeCCCCccCccccCCCCCCcccccccccCCCeEEEEecCChhhhhhhcCCCcEEEcCCCCHHHHHHHHHHhhhh
Q 036977 259 KRVLIILDNIWTKLELDAVGIPSGDVDEKDREDDQRRCTIILTSRSRDLLCIDMNSQKIFWIDALSKEEALHLAKLQHLE 338 (693)
Q Consensus 259 k~~LlVlDdv~~~~~~~~l~~~~~~~~~~~~~~~~~~~~IivTtR~~~v~~~~~~~~~~~~l~~L~~~ea~~Lf~~~~~~ 338 (693)
+||+|||||||+..+|+.++.|+|. ..+||+|++|||++.|+...|+....+++..|+++|||+||++.++.
T Consensus 261 krfllvLDDIW~~~dw~~I~~~~p~--------~~~g~KvvlTTRs~~V~~~~m~~~~~~~v~~L~~~eaW~LF~~~v~~ 332 (889)
T KOG4658|consen 261 KRFLLVLDDIWEEVDWDKIGVPFPS--------RENGSKVVLTTRSEEVCGRAMGVDYPIEVECLTPEEAWDLFQKKVGP 332 (889)
T ss_pred CceEEEEecccccccHHhcCCCCCC--------ccCCeEEEEEeccHhhhhccccCCccccccccCccccHHHHHHhhcc
Confidence 9999999999999999999999998 78899999999999998766888889999999999999999999985
Q ss_pred hhhccccccccccCCCCCCCchhhHHHHHhhhcCCCccc----------------c---ccccccc------cccccccc
Q 036977 339 ISYCESMEGVVDTTGWSERDEGKLIELKVFPKLHSLKLE----------------W---LPELTSF------ANTGQIHS 393 (693)
Q Consensus 339 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~I~~~c~glPLa----------------w---l~~~~~~------~~~~~i~~ 393 (693)
.. ....+.++++|++|+++|+|+||| | .+.+.+. +..+.+++
T Consensus 333 ~~-------------~~~~~~i~~lak~v~~kC~GLPLAl~viG~~ma~K~t~~eW~~~~~~l~s~~~~~~~~~~~~i~~ 399 (889)
T KOG4658|consen 333 NT-------------LGSHPDIEELAKEVAEKCGGLPLALNVLGGLLACKKTVQEWRRALNVLKSSLAADFSGMEESILP 399 (889)
T ss_pred cc-------------ccccccHHHHHHHHHHHhCChHHHHHHHHHHhcCCCcHHHHHHHHccccccccCCCCchhhhhHH
Confidence 51 113344899999999999999999 6 2222221 23568999
Q ss_pred chhccccCchhHhhhhhhhcccccCCC---Ccchhhhccc-CCCccccc-----ccCcchhhhhhhhcCCCCchhhhccc
Q 036977 394 DLVVEFPSLLNLEIHGCNNMLRFISTS---SPADTLHSEM-QSPPLFDE-----KVGIPSSLVNLKVSGCPKLEEIVGHV 464 (693)
Q Consensus 394 ~l~~sy~~L~~~~lk~cfl~~~~fp~~---~~~~Li~lw~-~g~~~~~~-----~~~~~~~l~~L~~~~l~~~~~~~~~~ 464 (693)
++.+||++||+ ++|.||+|||+||++ ....|+.+|+ |||+...+ ++.+..|+++|+.++++..+.
T Consensus 400 iLklSyd~L~~-~lK~CFLycalFPED~~I~~e~Li~yWiaEGfi~~~~~~~~~~d~G~~~i~~LV~~~Ll~~~~----- 473 (889)
T KOG4658|consen 400 ILKLSYDNLPE-ELKSCFLYCALFPEDYEIKKEKLIEYWIAEGFIDPLDGGETAEDVGYDYIEELVRASLLIEER----- 473 (889)
T ss_pred hhhccHhhhhH-HHHHHHHhhccCCcccccchHHHHHHHHhccCcCccccccchhcchHHHHHHHHHHHHHhhcc-----
Confidence 99999999995 999999999999999 7899999999 99886522 678999999999999994433
Q ss_pred cccccccccccCCccEEEEcCCcccccccccccCC-----CCCcccccc--------chhhcccccccccccCccccccc
Q 036977 465 GQEVKENRIAFSKLKVLILDDLPRLTSFLSKKEEG-----EPHHWEGNL--------NSTIQKCYEEMIGFRDIKDLQLS 531 (693)
Q Consensus 465 ~~~~~~~~~~~~~l~~~~~hdli~~~~~~~~~~~~-----~~~~~~~~~--------~~~~~~l~~l~~~~~~l~~l~~~ 531 (693)
...+..+++|||++|++| ..++. .++.+.... .......+++++.++.+.+++..
T Consensus 474 ---------~~~~~~~~kmHDvvRe~a---l~ias~~~~~~e~~iv~~~~~~~~~~~~~~~~~~rr~s~~~~~~~~~~~~ 541 (889)
T KOG4658|consen 474 ---------DEGRKETVKMHDVVREMA---LWIASDFGKQEENQIVSDGVGLSEIPQVKSWNSVRRMSLMNNKIEHIAGS 541 (889)
T ss_pred ---------cccceeEEEeeHHHHHHH---HHHhccccccccceEEECCcCccccccccchhheeEEEEeccchhhccCC
Confidence 113455999999999999 77776 444333321 11223445555555555443222
Q ss_pred cCCCcccccCCCCCCcccccCcceeeecCCCC-CCcCCCchhhcCCCCCCEEEecCCCCCccccccceeccCCCCccccc
Q 036977 532 HFPRLQEIWHGQALPVSFFNNLRELVVDDCTN-MSSAIPANLLRCLNNLRYLEVRNCDSLEEVLHLEELNAKEEHIGPLF 610 (693)
Q Consensus 532 ~~~~L~~~~~~~~~~~~~~~~L~~L~i~~c~~-~~~~~~~~~l~~L~~L~~L~l~~c~~l~~l~~L~~L~l~~~~l~~~~ 610 (693)
. ..++|++|-+.+-.. +.. .+...+..++.|++|++++|.++.+||. .+
T Consensus 542 ~----------------~~~~L~tLll~~n~~~l~~-is~~ff~~m~~LrVLDLs~~~~l~~LP~-------------~I 591 (889)
T KOG4658|consen 542 S----------------ENPKLRTLLLQRNSDWLLE-ISGEFFRSLPLLRVLDLSGNSSLSKLPS-------------SI 591 (889)
T ss_pred C----------------CCCccceEEEeecchhhhh-cCHHHHhhCcceEEEECCCCCccCcCCh-------------HH
Confidence 1 123677777776432 221 2233477899999999999887775543 45
Q ss_pred CCCCCcCEeecCCCcCcccccccccCCCCcCEEecccccccccccccccccceee
Q 036977 611 PRLSWLRLIDLPKLKRFYNFTGNIIELPELRYLTIENCPDMETFISNSTSVLHMT 665 (693)
Q Consensus 611 ~~L~~L~~L~L~~c~~l~~LP~~i~~L~~L~~L~i~~C~~L~~lp~~~~~l~~l~ 665 (693)
+.|-+||+|++++ +.+..||.++++|..|.+|++..+..+..+|.....|.+|+
T Consensus 592 ~~Li~LryL~L~~-t~I~~LP~~l~~Lk~L~~Lnl~~~~~l~~~~~i~~~L~~Lr 645 (889)
T KOG4658|consen 592 GELVHLRYLDLSD-TGISHLPSGLGNLKKLIYLNLEVTGRLESIPGILLELQSLR 645 (889)
T ss_pred hhhhhhhcccccC-CCccccchHHHHHHhhheeccccccccccccchhhhccccc
Confidence 5566666666665 55666666666666666666666555555544333333333
|
|
| >PLN03210 Resistant to P | Back alignment and domain information |
|---|
| >PF00931 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is the NB-ARC domain, a novel signalling motif found in bacteria and eukaryotes, shared by plant resistance gene products and regulators of cell death in animals [] | Back alignment and domain information |
|---|
| >PRK04841 transcriptional regulator MalT; Provisional | Back alignment and domain information |
|---|
| >PF05729 NACHT: NACHT domain | Back alignment and domain information |
|---|
| >PF01637 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 This domain has been found in a number of bacterial and archaeal proteins, all of which contain a conserved P-loop motif that is involved in binding ATP | Back alignment and domain information |
|---|
| >TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily | Back alignment and domain information |
|---|
| >PLN03210 Resistant to P | Back alignment and domain information |
|---|
| >TIGR02928 orc1/cdc6 family replication initiation protein | Back alignment and domain information |
|---|
| >PRK00411 cdc6 cell division control protein 6; Reviewed | Back alignment and domain information |
|---|
| >COG2909 MalT ATP-dependent transcriptional regulator [Transcription] | Back alignment and domain information |
|---|
| >TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit | Back alignment and domain information |
|---|
| >PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed | Back alignment and domain information |
|---|
| >KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK06893 DNA replication initiation factor; Validated | Back alignment and domain information |
|---|
| >PRK13342 recombination factor protein RarA; Reviewed | Back alignment and domain information |
|---|
| >KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B | Back alignment and domain information |
|---|
| >PRK07003 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK12402 replication factor C small subunit 2; Reviewed | Back alignment and domain information |
|---|
| >PF13173 AAA_14: AAA domain | Back alignment and domain information |
|---|
| >COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK14961 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK00440 rfc replication factor C small subunit; Reviewed | Back alignment and domain information |
|---|
| >TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda | Back alignment and domain information |
|---|
| >PRK06645 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK14949 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PLN03025 replication factor C subunit; Provisional | Back alignment and domain information |
|---|
| >cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold | Back alignment and domain information |
|---|
| >PRK12323 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PTZ00202 tuzin; Provisional | Back alignment and domain information |
|---|
| >PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >PF13191 AAA_16: AAA ATPase domain; PDB: 2V1U_A | Back alignment and domain information |
|---|
| >PRK04195 replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >PRK14963 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >cd01128 rho_factor Transcription termination factor rho is a bacterial ATP-dependent RNA/DNA helicase | Back alignment and domain information |
|---|
| >PRK14960 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK14962 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair | Back alignment and domain information |
|---|
| >PRK14957 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >PRK14956 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PTZ00112 origin recognition complex 1 protein; Provisional | Back alignment and domain information |
|---|
| >PRK08727 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK14964 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK14951 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] | Back alignment and domain information |
|---|
| >TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau | Back alignment and domain information |
|---|
| >PRK05564 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK07994 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed | Back alignment and domain information |
|---|
| >PRK14958 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK05896 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK14955 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK08084 DNA replication initiation factor; Provisional | Back alignment and domain information |
|---|
| >PRK09087 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK09376 rho transcription termination factor Rho; Provisional | Back alignment and domain information |
|---|
| >PRK14970 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >COG3899 Predicted ATPase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK08691 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] | Back alignment and domain information |
|---|
| >PRK14969 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK14954 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >TIGR02903 spore_lon_C ATP-dependent protease, Lon family | Back alignment and domain information |
|---|
| >TIGR00678 holB DNA polymerase III, delta' subunit | Back alignment and domain information |
|---|
| >PRK07471 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK09112 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK07940 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional | Back alignment and domain information |
|---|
| >PRK14959 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >KOG2543 consensus Origin recognition complex, subunit 5 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PRK09111 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication | Back alignment and domain information |
|---|
| >PRK14971 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK14952 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >TIGR01242 26Sp45 26S proteasome subunit P45 family | Back alignment and domain information |
|---|
| >TIGR00767 rho transcription termination factor Rho | Back alignment and domain information |
|---|
| >KOG0472 consensus Leucine-rich repeat protein [Function unknown] | Back alignment and domain information |
|---|
| >PRK05642 DNA replication initiation factor; Validated | Back alignment and domain information |
|---|
| >PRK07764 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family | Back alignment and domain information |
|---|
| >PRK08451 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional | Back alignment and domain information |
|---|
| >KOG2028 consensus ATPase related to the helicase subunit of the Holliday junction resolvase [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PRK15386 type III secretion protein GogB; Provisional | Back alignment and domain information |
|---|
| >PRK03992 proteasome-activating nucleotidase; Provisional | Back alignment and domain information |
|---|
| >PRK06305 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PHA02544 44 clamp loader, small subunit; Provisional | Back alignment and domain information |
|---|
| >COG3903 Predicted ATPase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK07133 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >COG2255 RuvB Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >KOG0989 consensus Replication factor C, subunit RFC4 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PRK14953 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional | Back alignment and domain information |
|---|
| >PRK14950 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK06647 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA | Back alignment and domain information |
|---|
| >PF05621 TniB: Bacterial TniB protein; InterPro: IPR008868 This family consists of several bacterial TniB NTP-binding proteins | Back alignment and domain information |
|---|
| >KOG0472 consensus Leucine-rich repeat protein [Function unknown] | Back alignment and domain information |
|---|
| >PRK08903 DnaA regulatory inactivator Hda; Validated | Back alignment and domain information |
|---|
| >PRK14087 dnaA chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >PRK14088 dnaA chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional | Back alignment and domain information |
|---|
| >PRK14948 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK14965 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >CHL00095 clpC Clp protease ATP binding subunit | Back alignment and domain information |
|---|
| >PF14516 AAA_35: AAA-like domain | Back alignment and domain information |
|---|
| >TIGR03689 pup_AAA proteasome ATPase | Back alignment and domain information |
|---|
| >TIGR02881 spore_V_K stage V sporulation protein K | Back alignment and domain information |
|---|
| >PRK05563 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK10865 protein disaggregation chaperone; Provisional | Back alignment and domain information |
|---|
| >TIGR00362 DnaA chromosomal replication initiator protein DnaA | Back alignment and domain information |
|---|
| >TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB | Back alignment and domain information |
|---|
| >TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX | Back alignment and domain information |
|---|
| >PRK15386 type III secretion protein GogB; Provisional | Back alignment and domain information |
|---|
| >TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH | Back alignment and domain information |
|---|
| >PRK14086 dnaA chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional | Back alignment and domain information |
|---|
| >PRK12422 chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional | Back alignment and domain information |
|---|
| >PRK00149 dnaA chromosomal replication initiation protein; Reviewed | Back alignment and domain information |
|---|
| >PRK08181 transposase; Validated | Back alignment and domain information |
|---|
| >PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A | Back alignment and domain information |
|---|
| >KOG2227 consensus Pre-initiation complex, subunit CDC6, AAA+ superfamily ATPase [Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >CHL00181 cbbX CbbX; Provisional | Back alignment and domain information |
|---|
| >PTZ00361 26 proteosome regulatory subunit 4-like protein; Provisional | Back alignment and domain information |
|---|
| >PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A | Back alignment and domain information |
|---|
| >PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK06620 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >smart00382 AAA ATPases associated with a variety of cellular activities | Back alignment and domain information |
|---|
| >COG0593 DnaA ATPase involved in DNA replication initiation [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >KOG0991 consensus Replication factor C, subunit RFC2 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PRK08116 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport | Back alignment and domain information |
|---|
| >PRK10536 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >COG1373 Predicted ATPase (AAA+ superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A | Back alignment and domain information |
|---|
| >PRK07399 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >CHL00176 ftsH cell division protein; Validated | Back alignment and domain information |
|---|
| >PRK06526 transposase; Provisional | Back alignment and domain information |
|---|
| >KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG0466 Lon ATP-dependent Lon protease, bacterial type [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR00763 lon ATP-dependent protease La | Back alignment and domain information |
|---|
| >CHL00195 ycf46 Ycf46; Provisional | Back alignment and domain information |
|---|
| >PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PRK08118 topology modulation protein; Reviewed | Back alignment and domain information |
|---|
| >COG1222 RPT1 ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK10787 DNA-binding ATP-dependent protease La; Provisional | Back alignment and domain information |
|---|
| >PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B | Back alignment and domain information |
|---|
| >PRK12727 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PF13177 DNA_pol3_delta2: DNA polymerase III, delta subunit; PDB: 1NJF_B 3GLG_G 1XXH_I 1NJG_A 3GLF_B 3GLI_G 1IQP_E 2GNO_A 1SXJ_E 1A5T_A | Back alignment and domain information |
|---|
| >PRK05707 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK08058 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK00771 signal recognition particle protein Srp54; Provisional | Back alignment and domain information |
|---|
| >PHA00729 NTP-binding motif containing protein | Back alignment and domain information |
|---|
| >TIGR00602 rad24 checkpoint protein rad24 | Back alignment and domain information |
|---|
| >PRK12608 transcription termination factor Rho; Provisional | Back alignment and domain information |
|---|
| >PF02562 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH is a cytoplasmic protein and predicted ATPase that is induced by phosphate starvation and belongings to the phosphate regulon (pho) in Escherichia coli [] | Back alignment and domain information |
|---|
| >PF04665 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 This entry contains uncharacterised proteins belonging to the B354L family which include the pox virus A32 protein | Back alignment and domain information |
|---|
| >COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG2004 consensus Mitochondrial ATP-dependent protease PIM1/LON [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd01123 Rad51_DMC1_radA Rad51_DMC1_radA,B | Back alignment and domain information |
|---|
| >PRK07261 topology modulation protein; Provisional | Back alignment and domain information |
|---|
| >PRK06871 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >KOG0739 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR02237 recomb_radB DNA repair and recombination protein RadB | Back alignment and domain information |
|---|
| >PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] | Back alignment and domain information |
|---|
| >PRK12377 putative replication protein; Provisional | Back alignment and domain information |
|---|
| >PF10443 RNA12: RNA12 protein; InterPro: IPR018850 Mitochondrial escape protein 2 (also known as RNA12) plays a role in maintaining the mitochondrial genome and in controlling mtDNA escape [, ] | Back alignment and domain information |
|---|
| >TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily | Back alignment and domain information |
|---|
| >TIGR02012 tigrfam_recA protein RecA | Back alignment and domain information |
|---|
| >PRK12726 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PF05673 DUF815: Protein of unknown function (DUF815); InterPro: IPR008533 This domain consists of several bacterial proteins of unknown function | Back alignment and domain information |
|---|
| >KOG2228 consensus Origin recognition complex, subunit 4 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily | Back alignment and domain information |
|---|
| >cd00983 recA RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response | Back alignment and domain information |
|---|
| >PRK08769 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK09354 recA recombinase A; Provisional | Back alignment and domain information |
|---|
| >KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] | Back alignment and domain information |
|---|
| >cd01393 recA_like RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response | Back alignment and domain information |
|---|
| >TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA | Back alignment and domain information |
|---|
| >COG1223 Predicted ATPase (AAA+ superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily | Back alignment and domain information |
|---|
| >KOG0735 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd03238 ABC_UvrA The excision repair protein UvrA; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion | Back alignment and domain information |
|---|
| >PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A | Back alignment and domain information |
|---|
| >PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A | Back alignment and domain information |
|---|
| >COG0396 sufC Cysteine desulfurase activator ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily | Back alignment and domain information |
|---|
| >KOG0741 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK09183 transposase/IS protein; Provisional | Back alignment and domain information |
|---|
| >TIGR01425 SRP54_euk signal recognition particle protein SRP54 | Back alignment and domain information |
|---|
| >TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN | Back alignment and domain information |
|---|
| >TIGR02238 recomb_DMC1 meiotic recombinase Dmc1 | Back alignment and domain information |
|---|
| >COG1875 NYN ribonuclease and ATPase of PhoH family domains [General function prediction only] | Back alignment and domain information |
|---|
| >COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK05541 adenylylsulfate kinase; Provisional | Back alignment and domain information |
|---|
| >COG0470 HolB ATPase involved in DNA replication [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >TIGR03499 FlhF flagellar biosynthetic protein FlhF | Back alignment and domain information |
|---|
| >COG2812 DnaX DNA polymerase III, gamma/tau subunits [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >cd03246 ABCC_Protease_Secretion This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain | Back alignment and domain information |
|---|
| >cd03223 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette transporter (Pat) is involved in the import of very long-chain fatty acids (VLCFA) into the peroxisome | Back alignment and domain information |
|---|
| >PRK07952 DNA replication protein DnaC; Validated | Back alignment and domain information |
|---|
| >KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd01120 RecA-like_NTPases RecA-like NTPases | Back alignment and domain information |
|---|
| >PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated | Back alignment and domain information |
|---|
| >smart00763 AAA_PrkA PrkA AAA domain | Back alignment and domain information |
|---|
| >cd03214 ABC_Iron-Siderophores_B12_Hemin ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea | Back alignment and domain information |
|---|
| >COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK06696 uridine kinase; Validated | Back alignment and domain information |
|---|
| >PLN03187 meiotic recombination protein DMC1 homolog; Provisional | Back alignment and domain information |
|---|
| >cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos) | Back alignment and domain information |
|---|
| >KOG0734 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] | Back alignment and domain information |
|---|
| >PF08423 Rad51: Rad51; InterPro: IPR013632 This domain is found at the C terminus of the DNA repair and recombination protein Rad51 | Back alignment and domain information |
|---|
| >cd01131 PilT Pilus retraction ATPase PilT | Back alignment and domain information |
|---|
| >PRK07993 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >COG3267 ExeA Type II secretory pathway, component ExeA (predicted ATPase) [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >PRK06921 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK08533 flagellar accessory protein FlaH; Reviewed | Back alignment and domain information |
|---|
| >PRK09361 radB DNA repair and recombination protein RadB; Provisional | Back alignment and domain information |
|---|
| >KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG1121 ZnuC ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PLN03150 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] | Back alignment and domain information |
|---|
| >PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PF00154 RecA: recA bacterial DNA recombination protein; InterPro: IPR013765 The recA gene product is a multifunctional enzyme that plays a role in homologous recombination, DNA repair and induction of the SOS response [] | Back alignment and domain information |
|---|
| >PRK04296 thymidine kinase; Provisional | Back alignment and domain information |
|---|
| >PRK10867 signal recognition particle protein; Provisional | Back alignment and domain information |
|---|
| >PRK09270 nucleoside triphosphate hydrolase domain-containing protein; Reviewed | Back alignment and domain information |
|---|
| >PRK14723 flhF flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PRK06090 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >TIGR03877 thermo_KaiC_1 KaiC domain protein, Ph0284 family | Back alignment and domain information |
|---|
| >KOG1969 consensus DNA replication checkpoint protein CHL12/CTF18 [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PRK06835 DNA replication protein DnaC; Validated | Back alignment and domain information |
|---|
| >TIGR00959 ffh signal recognition particle protein | Back alignment and domain information |
|---|
| >PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif | Back alignment and domain information |
|---|
| >TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB | Back alignment and domain information |
|---|
| >cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis | Back alignment and domain information |
|---|
| >cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids | Back alignment and domain information |
|---|
| >cd03230 ABC_DR_subfamily_A This family of ATP-binding proteins belongs to a multisubunit transporter involved in drug resistance (BcrA and DrrA), nodulation, lipid transport, and lantibiotic immunity | Back alignment and domain information |
|---|
| >COG0488 Uup ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] | Back alignment and domain information |
|---|
| >PRK04132 replication factor C small subunit; Provisional | Back alignment and domain information |
|---|
| >KOG2035 consensus Replication factor C, subunit RFC3 [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >cd01394 radB RadB | Back alignment and domain information |
|---|
| >TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family | Back alignment and domain information |
|---|
| >PRK10865 protein disaggregation chaperone; Provisional | Back alignment and domain information |
|---|
| >TIGR02858 spore_III_AA stage III sporulation protein AA | Back alignment and domain information |
|---|
| >COG2884 FtsE Predicted ATPase involved in cell division [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >COG4608 AppF ABC-type oligopeptide transport system, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK12723 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG0541 Ffh Signal recognition particle GTPase [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] | Back alignment and domain information |
|---|
| >COG1618 Predicted nucleotide kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PRK08939 primosomal protein DnaI; Reviewed | Back alignment and domain information |
|---|
| >CHL00095 clpC Clp protease ATP binding subunit | Back alignment and domain information |
|---|
| >PTZ00035 Rad51 protein; Provisional | Back alignment and domain information |
|---|
| >KOG0730 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK14974 cell division protein FtsY; Provisional | Back alignment and domain information |
|---|
| >PRK06067 flagellar accessory protein FlaH; Validated | Back alignment and domain information |
|---|
| >PRK06547 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK04301 radA DNA repair and recombination protein RadA; Validated | Back alignment and domain information |
|---|
| >PRK15455 PrkA family serine protein kinase; Provisional | Back alignment and domain information |
|---|
| >PLN03186 DNA repair protein RAD51 homolog; Provisional | Back alignment and domain information |
|---|
| >KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PLN00020 ribulose bisphosphate carboxylase/oxygenase activase -RuBisCO activase (RCA); Provisional | Back alignment and domain information |
|---|
| >cd03228 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export | Back alignment and domain information |
|---|
| >cd02025 PanK Pantothenate kinase (PanK) catalyzes the phosphorylation of pantothenic acid to form 4'-phosphopantothenic, which is the first of five steps in coenzyme A (CoA) biosynthetic pathway | Back alignment and domain information |
|---|
| >TIGR02239 recomb_RAD51 DNA repair protein RAD51 | Back alignment and domain information |
|---|
| >cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth | Back alignment and domain information |
|---|
| >PRK10733 hflB ATP-dependent metalloprotease; Reviewed | Back alignment and domain information |
|---|
| >cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes | Back alignment and domain information |
|---|
| >TIGR00554 panK_bact pantothenate kinase, bacterial type | Back alignment and domain information |
|---|
| >cd03229 ABC_Class3 This class is comprised of all BPD (Binding Protein Dependent) systems that are largely represented in archaea and eubacteria and are primarily involved in scavenging solutes from the environment | Back alignment and domain information |
|---|
| >KOG0731 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG0468 RecA RecA/RadA recombinase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd01133 F1-ATPase_beta F1 ATP synthase beta subunit, nucleotide-binding domain | Back alignment and domain information |
|---|
| >PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B | Back alignment and domain information |
|---|
| >KOG0744 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG1120 FepC ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] | Back alignment and domain information |
|---|
| >cd03281 ABC_MSH5_euk MutS5 homolog in eukaryotes | Back alignment and domain information |
|---|
| >TIGR02236 recomb_radA DNA repair and recombination protein RadA | Back alignment and domain information |
|---|
| >cd00267 ABC_ATPase ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules | Back alignment and domain information |
|---|
| >PF05659 RPW8: Arabidopsis broad-spectrum mildew resistance protein RPW8; InterPro: IPR008808 This entry represents the RPW8 domain found in several broad-spectrum mildew resistance proteins from Arabidopsis thaliana and other dicots | Back alignment and domain information |
|---|
| >PF13238 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB_A 3IIM_A 2AXP_A 3KB2_A 1KHT_A 1NKS_A 3H86_C | Back alignment and domain information |
|---|
| >PRK13543 cytochrome c biogenesis protein CcmA; Provisional | Back alignment and domain information |
|---|
| >PRK06964 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >TIGR03878 thermo_KaiC_2 KaiC domain protein, AF_0795 family | Back alignment and domain information |
|---|
| >cd01121 Sms Sms (bacterial radA) DNA repair protein | Back alignment and domain information |
|---|
| >PRK09519 recA DNA recombination protein RecA; Reviewed | Back alignment and domain information |
|---|
| >KOG1514 consensus Origin recognition complex, subunit 1, and related proteins [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >TIGR00064 ftsY signal recognition particle-docking protein FtsY | Back alignment and domain information |
|---|
| >PF00485 PRK: Phosphoribulokinase / Uridine kinase family; InterPro: IPR006083 Phosphoribulokinase (PRK) 2 | Back alignment and domain information |
|---|
| >PRK04328 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PLN03150 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd03220 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transporter subfamily is involved in extracellular polysaccharide export | Back alignment and domain information |
|---|
| >cd03217 ABC_FeS_Assembly ABC-type transport system involved in Fe-S cluster assembly, ATPase component | Back alignment and domain information |
|---|
| >PRK09544 znuC high-affinity zinc transporter ATPase; Reviewed | Back alignment and domain information |
|---|
| >COG1102 Cmk Cytidylate kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PTZ00301 uridine kinase; Provisional | Back alignment and domain information |
|---|
| >KOG1532 consensus GTPase XAB1, interacts with DNA repair protein XPA [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PRK12724 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PRK08233 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd02019 NK Nucleoside/nucleotide kinase (NK) is a protein superfamily consisting of multiple families of enzymes that share structural similarity and are functionally related to the catalysis of the reversible phosphate group transfer from nucleoside triphosphates to nucleosides/nucleotides, nucleoside monophosphates, or sugars | Back alignment and domain information |
|---|
| >PRK05480 uridine/cytidine kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR03740 galliderm_ABC gallidermin-class lantibiotic protection ABC transporter, ATP-binding subunit | Back alignment and domain information |
|---|
| >PRK14721 flhF flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PRK13531 regulatory ATPase RavA; Provisional | Back alignment and domain information |
|---|
| >PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] | Back alignment and domain information |
|---|
| >cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs | Back alignment and domain information |
|---|
| >PRK00889 adenylylsulfate kinase; Provisional | Back alignment and domain information |
|---|
| >cd03283 ABC_MutS-like MutS-like homolog in eukaryotes | Back alignment and domain information |
|---|
| >PRK07667 uridine kinase; Provisional | Back alignment and domain information |
|---|
| >cd03213 ABCG_EPDR ABCG transporters are involved in eye pigment (EP) precursor transport, regulation of lipid-trafficking mechanisms, and pleiotropic drug resistance (DR) | Back alignment and domain information |
|---|
| >PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B | Back alignment and domain information |
|---|
| >cd03215 ABC_Carb_Monos_II This family represents domain II of the carbohydrate uptake proteins that transport only monosaccharides (Monos) | Back alignment and domain information |
|---|
| >TIGR00235 udk uridine kinase | Back alignment and domain information |
|---|
| >cd03232 ABC_PDR_domain2 The pleiotropic drug resistance-like (PDR) family of ATP-binding cassette (ABC) transporters | Back alignment and domain information |
|---|
| >PF06309 Torsin: Torsin; InterPro: IPR010448 This family consists of several eukaryotic torsin proteins | Back alignment and domain information |
|---|
| >KOG0728 consensus 26S proteasome regulatory complex, ATPase RPT6 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd01135 V_A-ATPase_B V/A-type ATP synthase (non-catalytic) subunit B | Back alignment and domain information |
|---|
| >PRK13537 nodulation ABC transporter NodI; Provisional | Back alignment and domain information |
|---|
| >KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] | Back alignment and domain information |
|---|
| >PRK05973 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >COG1066 Sms Predicted ATP-dependent serine protease [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG4555 NatA ABC-type Na+ transport system, ATPase component [Energy production and conversion / Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >COG1131 CcmA ABC-type multidrug transport system, ATPase component [Defense mechanisms] | Back alignment and domain information |
|---|
| >PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated | Back alignment and domain information |
|---|
| >COG0467 RAD55 RecA-superfamily ATPases implicated in signal transduction [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK06762 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF06745 KaiC: KaiC; InterPro: IPR014774 This entry represents a domain within bacterial and archaeal proteins, most of which are hypothetical | Back alignment and domain information |
|---|
| >PTZ00494 tuzin-like protein; Provisional | Back alignment and domain information |
|---|
| >PF13481 AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C | Back alignment and domain information |
|---|
| >PRK05439 pantothenate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK08699 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >COG1419 FlhF Flagellar GTP-binding protein [Cell motility and secretion] | Back alignment and domain information |
|---|
| >KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG0572 Udk Uridine kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >KOG0743 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd02027 APSK Adenosine 5'-phosphosulfate kinase (APSK) catalyzes the phosphorylation of adenosine 5'-phosphosulfate to form 3'-phosphoadenosine 5'-phosphosulfate (PAPS) | Back alignment and domain information |
|---|
| >PF01583 APS_kinase: Adenylylsulphate kinase; InterPro: IPR002891 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases | Back alignment and domain information |
|---|
| >TIGR01360 aden_kin_iso1 adenylate kinase, isozyme 1 subfamily | Back alignment and domain information |
|---|
| >COG1703 ArgK Putative periplasmic protein kinase ArgK and related GTPases of G3E family [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK13545 tagH teichoic acids export protein ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PF03308 ArgK: ArgK protein; InterPro: IPR005129 Bacterial periplasmic transport systems require the function of a specific substrate-binding protein, located in the periplasm, and several cytoplasmic membrane transport components | Back alignment and domain information |
|---|
| >PRK03839 putative kinase; Provisional | Back alignment and domain information |
|---|
| >KOG0924 consensus mRNA splicing factor ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >PRK04040 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >PF03205 MobB: Molybdopterin guanine dinucleotide synthesis protein B; PDB: 2F1R_B 1P9N_A 1NP6_B 2NPI_A 1XJC_A | Back alignment and domain information |
|---|
| >PF12775 AAA_7: P-loop containing dynein motor region D3; PDB: 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A 3VKH_A 3VKG_A | Back alignment and domain information |
|---|
| >PRK06851 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02655 circ_KaiC circadian clock protein KaiC | Back alignment and domain information |
|---|
| >TIGR02030 BchI-ChlI magnesium chelatase ATPase subunit I | Back alignment and domain information |
|---|
| >PRK12597 F0F1 ATP synthase subunit beta; Provisional | Back alignment and domain information |
|---|
| >KOG0729 consensus 26S proteasome regulatory complex, ATPase RPT1 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR01420 pilT_fam pilus retraction protein PilT | Back alignment and domain information |
|---|
| >cd03282 ABC_MSH4_euk MutS4 homolog in eukaryotes | Back alignment and domain information |
|---|
| >COG3640 CooC CO dehydrogenase maturation factor [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PRK00625 shikimate kinase; Provisional | Back alignment and domain information |
|---|
| >KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK13536 nodulation factor exporter subunit NodI; Provisional | Back alignment and domain information |
|---|
| >cd02023 UMPK Uridine monophosphate kinase (UMPK, EC 2 | Back alignment and domain information |
|---|
| >TIGR00150 HI0065_YjeE ATPase, YjeE family | Back alignment and domain information |
|---|
| >COG4618 ArpD ABC-type protease/lipase transport system, ATPase and permease components [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR03881 KaiC_arch_4 KaiC domain protein, PAE1156 family | Back alignment and domain information |
|---|
| >COG0464 SpoVK ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF08433 KTI12: Chromatin associated protein KTI12 ; InterPro: IPR013641 This is a family of chromatin associated proteins which interact with the Elongator complex, a component of the elongating form of RNA polymerase II [] | Back alignment and domain information |
|---|
| >PRK15439 autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional | Back alignment and domain information |
|---|
| >KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >PRK10751 molybdopterin-guanine dinucleotide biosynthesis protein B; Provisional | Back alignment and domain information |
|---|
| >cd01122 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' helicases | Back alignment and domain information |
|---|
| >TIGR02322 phosphon_PhnN phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN | Back alignment and domain information |
|---|
| >COG1224 TIP49 DNA helicase TIP49, TBP-interacting protein [Transcription] | Back alignment and domain information |
|---|
| >PRK11823 DNA repair protein RadA; Provisional | Back alignment and domain information |
|---|
| >TIGR00416 sms DNA repair protein RadA | Back alignment and domain information |
|---|
| >COG1428 Deoxynucleoside kinases [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PRK10416 signal recognition particle-docking protein FtsY; Provisional | Back alignment and domain information |
|---|
| >PF03215 Rad17: Rad17 cell cycle checkpoint protein | Back alignment and domain information |
|---|
| >COG2274 SunT ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms] | Back alignment and domain information |
|---|
| >cd00544 CobU Adenosylcobinamide kinase / adenosylcobinamide phosphate guanyltransferase (CobU) | Back alignment and domain information |
|---|
| >COG3910 Predicted ATPase [General function prediction only] | Back alignment and domain information |
|---|
| >cd02024 NRK1 Nicotinamide riboside kinase (NRK) is an enzyme involved in the metabolism of nicotinamide adenine dinucleotide (NAD+) | Back alignment and domain information |
|---|
| >TIGR00390 hslU ATP-dependent protease HslVU, ATPase subunit | Back alignment and domain information |
|---|
| >TIGR01359 UMP_CMP_kin_fam UMP-CMP kinase family | Back alignment and domain information |
|---|
| >TIGR03575 selen_PSTK_euk L-seryl-tRNA(Sec) kinase, eukaryotic | Back alignment and domain information |
|---|
| >COG2607 Predicted ATPase (AAA+ superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR03305 alt_F1F0_F1_bet alternate F1F0 ATPase, F1 subunit beta | Back alignment and domain information |
|---|
| >PRK13765 ATP-dependent protease Lon; Provisional | Back alignment and domain information |
|---|
| >PF00910 RNA_helicase: RNA helicase; InterPro: IPR000605 Helicases have been classified in 5 superfamilies (SF1-SF5) | Back alignment and domain information |
|---|
| >PRK13409 putative ATPase RIL; Provisional | Back alignment and domain information |
|---|
| >cd00561 CobA_CobO_BtuR ATP:corrinoid adenosyltransferase BtuR/CobO/CobP | Back alignment and domain information |
|---|
| >PRK05342 clpX ATP-dependent protease ATP-binding subunit ClpX; Provisional | Back alignment and domain information |
|---|
| >cd03227 ABC_Class2 ABC-type Class 2 contains systems involved in cellular processes other than transport | Back alignment and domain information |
|---|
| >PRK00131 aroK shikimate kinase; Reviewed | Back alignment and domain information |
|---|
| >PRK06217 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK13407 bchI magnesium chelatase subunit I; Provisional | Back alignment and domain information |
|---|
| >PRK06731 flhF flagellar biosynthesis regulator FlhF; Validated | Back alignment and domain information |
|---|
| >TIGR02655 circ_KaiC circadian clock protein KaiC | Back alignment and domain information |
|---|
| >PRK07132 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >COG0488 Uup ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] | Back alignment and domain information |
|---|
| >PF07726 AAA_3: ATPase family associated with various cellular activities (AAA); InterPro: IPR011703 This entry includes some of the AAA proteins not detected by the IPR003959 from INTERPRO model | Back alignment and domain information |
|---|
| >cd00227 CPT Chloramphenicol (Cm) phosphotransferase (CPT) | Back alignment and domain information |
|---|
| >KOG4341 consensus F-box protein containing LRR [General function prediction only] | Back alignment and domain information |
|---|
| >COG1124 DppF ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >cd02028 UMPK_like Uridine monophosphate kinase_like (UMPK_like) is a family of proteins highly similar to the uridine monophosphate kinase (UMPK, EC 2 | Back alignment and domain information |
|---|
| >PF00625 Guanylate_kin: Guanylate kinase; InterPro: IPR008144 Guanylate kinase (2 | Back alignment and domain information |
|---|
| >PRK10463 hydrogenase nickel incorporation protein HypB; Provisional | Back alignment and domain information |
|---|
| >PRK09280 F0F1 ATP synthase subunit beta; Validated | Back alignment and domain information |
|---|
| >PLN02165 adenylate isopentenyltransferase | Back alignment and domain information |
|---|
| >CHL00081 chlI Mg-protoporyphyrin IX chelatase | Back alignment and domain information |
|---|
| >PF13245 AAA_19: Part of AAA domain | Back alignment and domain information |
|---|
| >TIGR01650 PD_CobS cobaltochelatase, CobS subunit | Back alignment and domain information |
|---|
| >PRK09435 membrane ATPase/protein kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR00764 lon_rel lon-related putative ATP-dependent protease | Back alignment and domain information |
|---|
| >KOG0735 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0727 consensus 26S proteasome regulatory complex, ATPase RPT3 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0736 consensus Peroxisome assembly factor 2 containing the AAA+-type ATPase domain [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK13768 GTPase; Provisional | Back alignment and domain information |
|---|
| >COG0003 ArsA Predicted ATPase involved in chromosome partitioning [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >cd02020 CMPK Cytidine monophosphate kinase (CMPK) catalyzes the reversible phosphorylation of cytidine monophosphate (CMP) to produce cytidine diphosphate (CDP), using ATP as the preferred phosphoryl donor | Back alignment and domain information |
|---|
| >PHA02774 E1; Provisional | Back alignment and domain information |
|---|
| >PRK13949 shikimate kinase; Provisional | Back alignment and domain information |
|---|
| >COG3854 SpoIIIAA ncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >TIGR03263 guanyl_kin guanylate kinase | Back alignment and domain information |
|---|
| >TIGR00073 hypB hydrogenase accessory protein HypB | Back alignment and domain information |
|---|
| >TIGR00176 mobB molybdopterin-guanine dinucleotide biosynthesis protein MobB | Back alignment and domain information |
|---|
| >cd02021 GntK Gluconate kinase (GntK) catalyzes the phosphoryl transfer from ATP to gluconate | Back alignment and domain information |
|---|
| >COG1763 MobB Molybdopterin-guanine dinucleotide biosynthesis protein [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PRK00300 gmk guanylate kinase; Provisional | Back alignment and domain information |
|---|
| >cd01125 repA Hexameric Replicative Helicase RepA | Back alignment and domain information |
|---|
| >PRK03846 adenylylsulfate kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR02788 VirB11 P-type DNA transfer ATPase VirB11 | Back alignment and domain information |
|---|
| >TIGR02902 spore_lonB ATP-dependent protease LonB | Back alignment and domain information |
|---|
| >PF03193 DUF258: Protein of unknown function, DUF258; InterPro: IPR004881 This entry contains Escherichia coli (strain K12) RsgA, which may play a role in 30S ribosomal subunit biogenesis | Back alignment and domain information |
|---|
| >PF05970 PIF1: PIF1-like helicase; InterPro: IPR010285 This entry represents PIF1 helicase and related proteins | Back alignment and domain information |
|---|
| >COG0563 Adk Adenylate kinase and related kinases [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR01039 atpD ATP synthase, F1 beta subunit | Back alignment and domain information |
|---|
| >PF06068 TIP49: TIP49 C-terminus; InterPro: IPR010339 This family consists of the C-terminal region of several eukaryotic and archaeal RuvB-like 1 (Pontin or TIP49a) and RuvB-like 2 (Reptin or TIP49b) proteins | Back alignment and domain information |
|---|
| >PF13479 AAA_24: AAA domain | Back alignment and domain information |
|---|
| >PRK08149 ATP synthase SpaL; Validated | Back alignment and domain information |
|---|
| >PRK05917 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK12678 transcription termination factor Rho; Provisional | Back alignment and domain information |
|---|
| >KOG3347 consensus Predicted nucleotide kinase/nuclear protein involved oxidative stress response [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PF08477 Miro: Miro-like protein; InterPro: IPR013684 Mitochondrial Rho proteins (Miro-1, Q8IXI2 from SWISSPROT and Miro-2, Q8IXI1 from SWISSPROT) are atypical Rho GTPases | Back alignment and domain information |
|---|
| >TIGR00382 clpX endopeptidase Clp ATP-binding regulatory subunit (clpX) | Back alignment and domain information |
|---|
| >PRK06002 fliI flagellum-specific ATP synthase; Validated | Back alignment and domain information |
|---|
| >PRK08972 fliI flagellum-specific ATP synthase; Validated | Back alignment and domain information |
|---|
| >cd00984 DnaB_C DnaB helicase C terminal domain | Back alignment and domain information |
|---|
| >PRK14530 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >COG4886 Leucine-rich repeat (LRR) protein [Function unknown] | Back alignment and domain information |
|---|
| >PF00006 ATP-synt_ab: ATP synthase alpha/beta family, nucleotide-binding domain This Pfam entry corresponds to chains a,b,c,d,e and f; InterPro: IPR000194 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane | Back alignment and domain information |
|---|
| >cd00820 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPCK), a critical gluconeogenic enzyme, catalyzes the first committed step in the diversion of tricarboxylic acid cycle intermediates toward gluconeogenesis | Back alignment and domain information |
|---|
| >cd00071 GMPK Guanosine monophosphate kinase (GMPK, EC 2 | Back alignment and domain information |
|---|
| >PTZ00185 ATPase alpha subunit; Provisional | Back alignment and domain information |
|---|
| >PRK08927 fliI flagellum-specific ATP synthase; Validated | Back alignment and domain information |
|---|
| >PRK14527 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK13947 shikimate kinase; Provisional | Back alignment and domain information |
|---|
| >PF02374 ArsA_ATPase: Anion-transporting ATPase; PDB: 2WOO_A 3IBG_B 3SJA_A 3H84_B 3SJD_A 3ZS9_A 3A37_A 2WOJ_A 3SJC_B 3A36_B | Back alignment and domain information |
|---|
| >PF13086 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A | Back alignment and domain information |
|---|
| >PF03266 NTPase_1: NTPase; InterPro: IPR004948 This entry represents a family of nucleoside-triphosphatases which have activity towards ATP, GTP, CTP, TTP and UTP and may hydrolyse nucleoside diphosphates with lower efficiency [] | Back alignment and domain information |
|---|
| >PRK10078 ribose 1,5-bisphosphokinase; Provisional | Back alignment and domain information |
|---|
| >PF03029 ATP_bind_1: Conserved hypothetical ATP binding protein; InterPro: IPR004130 Members of this family are found in a range of archaea and eukaryotes and have hypothesised ATP binding activity | Back alignment and domain information |
|---|
| >KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] | Back alignment and domain information |
|---|
| >PF12061 DUF3542: Protein of unknown function (DUF3542); InterPro: IPR021929 R1 is a gene for resistance to late blight, the most destructive disease in potato cultivation worldwide | Back alignment and domain information |
|---|
| >PRK14737 gmk guanylate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK15429 formate hydrogenlyase transcriptional activator FhlA; Provisional | Back alignment and domain information |
|---|
| >cd01129 PulE-GspE PulE/GspE The type II secretory pathway is the main terminal branch of the general secretory pathway (GSP) | Back alignment and domain information |
|---|
| >PRK13409 putative ATPase RIL; Provisional | Back alignment and domain information |
|---|
| >PRK05057 aroK shikimate kinase I; Reviewed | Back alignment and domain information |
|---|
| >cd00464 SK Shikimate kinase (SK) is the fifth enzyme in the shikimate pathway, a seven-step biosynthetic pathway which converts erythrose-4-phosphate to chorismic acid, found in bacteria, fungi and plants | Back alignment and domain information |
|---|
| >KOG2170 consensus ATPase of the AAA+ superfamily [General function prediction only] | Back alignment and domain information |
|---|
| >PF13604 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A | Back alignment and domain information |
|---|
| >TIGR01313 therm_gnt_kin carbohydrate kinase, thermoresistant glucokinase family | Back alignment and domain information |
|---|
| >cd03284 ABC_MutS1 MutS1 homolog in eukaryotes | Back alignment and domain information |
|---|
| >TIGR01040 V-ATPase_V1_B V-type (H+)-ATPase V1, B subunit | Back alignment and domain information |
|---|
| >PRK14529 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >PF01078 Mg_chelatase: Magnesium chelatase, subunit ChlI; InterPro: IPR000523 Magnesium-chelatase is a three-component enzyme that catalyses the insertion of Mg2+ into protoporphyrin IX | Back alignment and domain information |
|---|
| >PRK13695 putative NTPase; Provisional | Back alignment and domain information |
|---|
| >PRK05201 hslU ATP-dependent protease ATP-binding subunit HslU; Provisional | Back alignment and domain information |
|---|
| >cd01672 TMPK Thymidine monophosphate kinase (TMPK), also known as thymidylate kinase, catalyzes the phosphorylation of thymidine monophosphate (TMP) to thymidine diphosphate (TDP) utilizing ATP as its preferred phophoryl donor | Back alignment and domain information |
|---|
| >COG2019 AdkA Archaeal adenylate kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PF00158 Sigma54_activat: Sigma-54 interaction domain; InterPro: IPR002078 Some bacterial regulatory proteins activate the expression of genes from promoters recognised by core RNA polymerase associated with the alternative sigma-54 factor | Back alignment and domain information |
|---|
| >PRK06936 type III secretion system ATPase; Provisional | Back alignment and domain information |
|---|
| >PF00005 ABC_tran: ABC transporter This structure is on hold until Dec 1999; InterPro: IPR003439 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems | Back alignment and domain information |
|---|
| >TIGR03880 KaiC_arch_3 KaiC domain protein, AF_0351 family | Back alignment and domain information |
|---|
| >PRK11174 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed | Back alignment and domain information |
|---|
| >smart00534 MUTSac ATPase domain of DNA mismatch repair MUTS family | Back alignment and domain information |
|---|
| >PRK12339 2-phosphoglycerate kinase; Provisional | Back alignment and domain information |
|---|
| >KOG1051 consensus Chaperone HSP104 and related ATP-dependent Clp proteases [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK13975 thymidylate kinase; Provisional | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 693 | |||
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 1e-36 | |
| 2a5y_B | 549 | CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis | 2e-23 | |
| 1z6t_A | 591 | APAF-1, apoptotic protease activating factor 1; ca | 4e-17 | |
| 3sfz_A | 1249 | APAF-1, apoptotic peptidase activating factor 1; a | 2e-14 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 2e-04 | |
| 1fnn_A | 389 | CDC6P, cell division control protein 6; ORC1, AAA | 9e-04 | |
| 2ast_B | 336 | S-phase kinase-associated protein 2; SCF-substrate | 9e-04 |
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
Score = 146 bits (370), Expect = 1e-36
Identities = 114/698 (16%), Positives = 221/698 (31%), Gaps = 180/698 (25%)
Query: 40 DLKDQVKQLGYKRETVQQPVNHARLQGDELYEGVTDWLHSVDEFISEGVAKSII---DDE 96
D + Q YK + + V + + V D S+ +S+ II D
Sbjct: 8 DFETGEHQYQYK-DIL--SVFEDAFVDNFDCKDVQDMPKSI---LSKEEIDHIIMSKDAV 61
Query: 97 ERAKKFCFKGLCPNLMSRYKLSKQAAKAAEAAAGLVGKG-NFSNVSYRPTPKSTGLNDGK 155
F L SKQ + ++ F + + +
Sbjct: 62 SGTL-RLFWTLL---------SKQEEMVQKFVEEVLRINYKFLMSPIKTEQRQPSMMTRM 111
Query: 156 ----------DNEAFD----SRMKVFQDVMEALKDDKLN-IIGVYGMGGVGKTTLVKQVA 200
DN+ F SR++ + + +AL + + + + G+ G GKT + V
Sbjct: 112 YIEQRDRLYNDNQVFAKYNVSRLQPYLKLRQALLELRPAKNVLIDGVLGSGKTWVALDVC 171
Query: 201 K-KVMEDKLIDKVVMAEVTQNPDPQKIQDKLASDLGMKFDLN--------DSIHHRASRL 251
++ K+ K+ + P+ + + L L + D N +I R +
Sbjct: 172 LSYKVQCKMDFKIFWLNLKNCNSPETVLEML-QKLLYQIDPNWTSRSDHSSNIKLRIHSI 230
Query: 252 RERL------KQEKRVLIILDNIWTKLELDAVGIPSGDVDEKDREDDQRRCTIILTSRSR 305
+ L K + L++L N+ +A + C I+LT+R +
Sbjct: 231 QAELRRLLKSKPYENCLLVLLNVQNAKAWNAFNL---------------SCKILLTTRFK 275
Query: 306 DLLCIDMNSQKIFWIDALSKEEALHLAKLQHLEISYCESMEGVVDTTGWSERDEGKLIEL 365
+ D LS H++ L H ++ DE
Sbjct: 276 QV------------TDFLSAATTTHIS-LDHHSMTL--------------TPDEV----K 304
Query: 366 KVFPKLHSLKLEWLPELTSFANTGQIH-------SDLVVEFPSLL-NLEIHGCNNMLRFI 417
+ K + + LP + ++ + + + N + C+ + I
Sbjct: 305 SLLLKYLDCRPQDLPREVL-----TTNPRRLSIIAESIRDGLATWDNWKHVNCDKLTTII 359
Query: 418 STS----SPADTLHSEM-QSPPLFDEKVGIPSSLVNLKVSGCPKLEEIVGHVGQEVKENR 472
+S PA+ + +M +F IP+ L L + ++ V V ++ +
Sbjct: 360 ESSLNVLEPAE--YRKMFDRLSVFPPSAHIPTIL--LSLIWFDVIKSDVMVVVNKLHKYS 415
Query: 473 IAFSKLKVLILDDLPRLTSFLSKKEEGEPHHWEGNLNSTIQKCYEEMIGFRDIKDLQL-- 530
+ + K + +P + L K E E L+ +I Y F D DL
Sbjct: 416 LVEKQPKESTI-SIPSIYLELKVKLENEY-----ALHRSIVDHYNIPKTF-DSDDLIPPY 468
Query: 531 ------SHFPR-LQEIWHGQALPVSFFNNLRELVVDDCTNMSSAIPANLLRCLNNLRYLE 583
SH L+ I H + R + +D R+LE
Sbjct: 469 LDQYFYSHIGHHLKNIEHPER-----MTLFRMVFLD-------------------FRFLE 504
Query: 584 VR------NCDSLEEVLH-LEELNAKEEHIGPLFPRLSWLRLIDLPKLKRF-YNFTGNII 635
+ ++ +L+ L++L + +I P+ RL++ + F N+I
Sbjct: 505 QKIRHDSTAWNASGSILNTLQQLKFYKPYICDNDPKYE--RLVNA--ILDFLPKIEENLI 560
Query: 636 ELPELRYLTIENCPDMETFISNSTSVLHMTADNKEAQK 673
L I + + A +K+ Q+
Sbjct: 561 CSKYTDLLRIA--------LMAEDEAIFEEA-HKQVQR 589
|
| >2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Length = 549 | Back alignment and structure |
|---|
| >1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Length = 591 | Back alignment and structure |
|---|
| >3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Length = 1249 | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 | Back alignment and structure |
|---|
| >1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Length = 389 | Back alignment and structure |
|---|
| >2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 693 | |||
| 2a5y_B | 549 | CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis | 100.0 | |
| 3sfz_A | 1249 | APAF-1, apoptotic peptidase activating factor 1; a | 99.97 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 99.97 | |
| 1z6t_A | 591 | APAF-1, apoptotic protease activating factor 1; ca | 99.96 | |
| 2qen_A | 350 | Walker-type ATPase; unknown function; HET: ADP; 2. | 99.38 | |
| 1w5s_A | 412 | Origin recognition complex subunit 2 ORC2; replica | 99.28 | |
| 2fna_A | 357 | Conserved hypothetical protein; structural genomic | 99.25 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 99.2 | |
| 2chg_A | 226 | Replication factor C small subunit; DNA-binding pr | 99.18 | |
| 1njg_A | 250 | DNA polymerase III subunit gamma; rossman-like fol | 99.17 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 99.16 | |
| 2qby_A | 386 | CDC6 homolog 1, cell division control protein 6 ho | 99.14 | |
| 2qby_B | 384 | CDC6 homolog 3, cell division control protein 6 ho | 99.12 | |
| 3qfl_A | 115 | MLA10; coiled-coil, (CC) domain, NLRS, nucleotide- | 99.11 | |
| 2v1u_A | 387 | Cell division control protein 6 homolog; DNA repli | 99.05 | |
| 1fnn_A | 389 | CDC6P, cell division control protein 6; ORC1, AAA | 99.01 | |
| 1sxj_B | 323 | Activator 1 37 kDa subunit; clamp loader, processi | 98.99 | |
| 4ezg_A | 197 | Putative uncharacterized protein; internalin-A, le | 98.96 | |
| 3e6j_A | 229 | Variable lymphocyte receptor diversity region; var | 98.89 | |
| 2o6q_A | 270 | Variable lymphocyte receptor A; leucine-rich repea | 98.89 | |
| 3m19_A | 251 | Variable lymphocyte receptor A diversity region; a | 98.89 | |
| 3rfs_A | 272 | Internalin B, repeat modules, variable lymphocyte | 98.86 | |
| 2xwt_C | 239 | Thyrotropin receptor; signaling protein-immune sys | 98.84 | |
| 2o6q_A | 270 | Variable lymphocyte receptor A; leucine-rich repea | 98.8 | |
| 3zyi_A | 452 | Leucine-rich repeat-containing protein 4; cell adh | 98.8 | |
| 3zyj_A | 440 | Leucine-rich repeat-containing protein 4C; cell ad | 98.8 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 98.8 | |
| 1ozn_A | 285 | Reticulon 4 receptor; NOGO receptor, MAD, myelinat | 98.79 | |
| 1iqp_A | 327 | RFCS; clamp loader, extended AAA-ATPase domain, co | 98.77 | |
| 1p9a_G | 290 | Platelet glycoprotein IB alpha chain precursor; pl | 98.77 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 98.77 | |
| 1h6u_A | 308 | Internalin H; cell adhesion, leucine rich repeat, | 98.76 | |
| 1h6t_A | 291 | Internalin B; cell adhesion, leucine rich repeat, | 98.76 | |
| 2ft3_A | 332 | Biglycan; proteoglycan, dimer interface, structura | 98.76 | |
| 4ezg_A | 197 | Putative uncharacterized protein; internalin-A, le | 98.75 | |
| 3zyi_A | 452 | Leucine-rich repeat-containing protein 4; cell adh | 98.74 | |
| 1m9s_A | 605 | Internalin B; cell invasion, GW domains, SH3 domai | 98.74 | |
| 2v9t_B | 220 | SLIT homolog 2 protein N-product; structural prote | 98.73 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 98.73 | |
| 3zyj_A | 440 | Leucine-rich repeat-containing protein 4C; cell ad | 98.72 | |
| 2o6s_A | 208 | Variable lymphocyte receptor B; leucine-rich repea | 98.72 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 98.72 | |
| 2xwt_C | 239 | Thyrotropin receptor; signaling protein-immune sys | 98.71 | |
| 1p9a_G | 290 | Platelet glycoprotein IB alpha chain precursor; pl | 98.71 | |
| 1xku_A | 330 | Decorin; proteoglycan, leucine-rich repeat, struct | 98.71 | |
| 3m19_A | 251 | Variable lymphocyte receptor A diversity region; a | 98.7 | |
| 1wwl_A | 312 | Monocyte differentiation antigen CD14; LPS, immune | 98.7 | |
| 1ozn_A | 285 | Reticulon 4 receptor; NOGO receptor, MAD, myelinat | 98.7 | |
| 2chq_A | 319 | Replication factor C small subunit; DNA-binding pr | 98.7 | |
| 2ell_A | 168 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 98.69 | |
| 2ell_A | 168 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 98.67 | |
| 2v9t_B | 220 | SLIT homolog 2 protein N-product; structural prote | 98.67 | |
| 1xku_A | 330 | Decorin; proteoglycan, leucine-rich repeat, struct | 98.66 | |
| 2v70_A | 220 | SLIT-2, SLIT homolog 2 protein N-product; neurogen | 98.65 | |
| 2o6s_A | 208 | Variable lymphocyte receptor B; leucine-rich repea | 98.65 | |
| 1h6u_A | 308 | Internalin H; cell adhesion, leucine rich repeat, | 98.65 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 98.65 | |
| 1jr3_A | 373 | DNA polymerase III subunit gamma; processivity, pr | 98.63 | |
| 3g06_A | 622 | SSPH2 (leucine-rich repeat protein); E3 ubiquitin | 98.63 | |
| 3rfs_A | 272 | Internalin B, repeat modules, variable lymphocyte | 98.63 | |
| 2ast_B | 336 | S-phase kinase-associated protein 2; SCF-substrate | 98.63 | |
| 1jbk_A | 195 | CLPB protein; beta barrel, chaperone; 1.80A {Esche | 98.62 | |
| 3e6j_A | 229 | Variable lymphocyte receptor diversity region; var | 98.61 | |
| 2z62_A | 276 | TOLL-like receptor 4, variable lymphocyte recepto; | 98.6 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 98.6 | |
| 2z80_A | 353 | TOLL-like receptor 2, variable lymphocyte recepto; | 98.6 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 98.6 | |
| 3g06_A | 622 | SSPH2 (leucine-rich repeat protein); E3 ubiquitin | 98.6 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 98.59 | |
| 2xot_A | 361 | Amphoterin-induced protein 1; cell adhesion, neuro | 98.59 | |
| 2je0_A | 149 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 98.59 | |
| 4glp_A | 310 | Monocyte differentiation antigen CD14; alpha beta | 98.58 | |
| 2ast_B | 336 | S-phase kinase-associated protein 2; SCF-substrate | 98.57 | |
| 2v70_A | 220 | SLIT-2, SLIT homolog 2 protein N-product; neurogen | 98.57 | |
| 2z66_A | 306 | Variable lymphocyte receptor B, TOLL-like recepto; | 98.57 | |
| 3te6_A | 318 | Regulatory protein SIR3; heterochromatin, gene sil | 98.57 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 98.56 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 98.55 | |
| 1xeu_A | 263 | Internalin C; cellular invasion, leucine-rich repe | 98.55 | |
| 3cvr_A | 571 | Invasion plasmid antigen; leucine rich repeat and | 98.55 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 98.54 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 98.54 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 98.53 | |
| 2z62_A | 276 | TOLL-like receptor 4, variable lymphocyte recepto; | 98.53 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 98.53 | |
| 2xot_A | 361 | Amphoterin-induced protein 1; cell adhesion, neuro | 98.52 | |
| 2z80_A | 353 | TOLL-like receptor 2, variable lymphocyte recepto; | 98.52 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 98.51 | |
| 2z66_A | 306 | Variable lymphocyte receptor B, TOLL-like recepto; | 98.51 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 98.51 | |
| 4g8a_A | 635 | TOLL-like receptor 4; leucine rich repeat MD-2 rel | 98.51 | |
| 2wfh_A | 193 | SLIT homolog 2 protein C-product; developmental pr | 98.51 | |
| 2o6r_A | 177 | Variable lymphocyte receptor B; leucine-rich repea | 98.5 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 98.5 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 98.49 | |
| 1m9s_A | 605 | Internalin B; cell invasion, GW domains, SH3 domai | 98.49 | |
| 1wwl_A | 312 | Monocyte differentiation antigen CD14; LPS, immune | 98.49 | |
| 4glp_A | 310 | Monocyte differentiation antigen CD14; alpha beta | 98.48 | |
| 1w8a_A | 192 | SLIT protein; signaling protein, secreted protein, | 98.48 | |
| 1ogq_A | 313 | PGIP-2, polygalacturonase inhibiting protein; inhi | 98.47 | |
| 1ogq_A | 313 | PGIP-2, polygalacturonase inhibiting protein; inhi | 98.47 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 98.47 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 98.47 | |
| 2je0_A | 149 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 98.47 | |
| 4g8a_A | 635 | TOLL-like receptor 4; leucine rich repeat MD-2 rel | 98.46 | |
| 2z7x_B | 520 | TOLL-like receptor 1, variable lymphocyte recepto; | 98.46 | |
| 1h6t_A | 291 | Internalin B; cell adhesion, leucine rich repeat, | 98.45 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 98.45 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 98.45 | |
| 1xeu_A | 263 | Internalin C; cellular invasion, leucine-rich repe | 98.45 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 98.45 | |
| 3a79_B | 562 | TLR6, VLRB.59, TOLL-like receptor 6, variable lymp | 98.43 | |
| 3v47_A | 455 | TOLL-like receptor 5B and variable lymphocyte REC | 98.42 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 98.42 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 98.42 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 98.41 | |
| 4ay9_X | 350 | Follicle-stimulating hormone receptor; hormone-rec | 98.41 | |
| 4b8c_D | 727 | Glucose-repressible alcohol dehydrogenase transcr | 98.41 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 98.39 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 98.39 | |
| 2z7x_B | 520 | TOLL-like receptor 1, variable lymphocyte recepto; | 98.37 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 98.36 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 98.36 | |
| 3v47_A | 455 | TOLL-like receptor 5B and variable lymphocyte REC | 98.36 | |
| 1a9n_A | 176 | U2A', U2A'; complex (nuclear protein/RNA), RNA, sn | 98.36 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 98.36 | |
| 3h4m_A | 285 | Proteasome-activating nucleotidase; ATPase, PAN, A | 98.35 | |
| 2ft3_A | 332 | Biglycan; proteoglycan, dimer interface, structura | 98.35 | |
| 2qz4_A | 262 | Paraplegin; AAA+, SPG7, protease, ADP, structural | 98.35 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 98.34 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 98.33 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 98.33 | |
| 1hqc_A | 324 | RUVB; extended AAA-ATPase domain, complex with nuc | 98.33 | |
| 1sxj_D | 353 | Activator 1 41 kDa subunit; clamp loader, processi | 98.32 | |
| 3pvs_A | 447 | Replication-associated recombination protein A; ma | 98.31 | |
| 1sxj_E | 354 | Activator 1 40 kDa subunit; clamp loader, processi | 98.31 | |
| 3a79_B | 562 | TLR6, VLRB.59, TOLL-like receptor 6, variable lymp | 98.3 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 98.29 | |
| 1sxj_A | 516 | Activator 1 95 kDa subunit; clamp loader, processi | 98.29 | |
| 3cvr_A | 571 | Invasion plasmid antigen; leucine rich repeat and | 98.29 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 98.28 | |
| 1sxj_C | 340 | Activator 1 40 kDa subunit; clamp loader, processi | 98.27 | |
| 3bos_A | 242 | Putative DNA replication factor; P-loop containing | 98.26 | |
| 4b8c_D | 727 | Glucose-repressible alcohol dehydrogenase transcr | 98.26 | |
| 3d8b_A | 357 | Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s | 98.25 | |
| 3b9p_A | 297 | CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc | 98.25 | |
| 1xwi_A | 322 | SKD1 protein; VPS4B, AAA ATPase, protein transport | 98.24 | |
| 3eie_A | 322 | Vacuolar protein sorting-associated protein 4; AAA | 98.23 | |
| 2wfh_A | 193 | SLIT homolog 2 protein C-product; developmental pr | 98.23 | |
| 1a9n_A | 176 | U2A', U2A'; complex (nuclear protein/RNA), RNA, sn | 98.22 | |
| 2z4s_A | 440 | Chromosomal replication initiator protein DNAA; AA | 98.22 | |
| 3vfd_A | 389 | Spastin; ATPase, microtubule severing, hydrolase; | 98.22 | |
| 3pfi_A | 338 | Holliday junction ATP-dependent DNA helicase RUVB; | 98.16 | |
| 4ay9_X | 350 | Follicle-stimulating hormone receptor; hormone-rec | 98.16 | |
| 2p65_A | 187 | Hypothetical protein PF08_0063; CLPB, malaria, str | 98.15 | |
| 2r9u_A | 174 | Variable lymphocyte receptor; adaptive immunity, V | 98.15 | |
| 1dce_A | 567 | Protein (RAB geranylgeranyltransferase alpha subun | 98.14 | |
| 3u61_B | 324 | DNA polymerase accessory protein 44; AAA+, ATP hyd | 98.12 | |
| 2o6r_A | 177 | Variable lymphocyte receptor B; leucine-rich repea | 98.11 | |
| 1w8a_A | 192 | SLIT protein; signaling protein, secreted protein, | 98.09 | |
| 2zan_A | 444 | Vacuolar protein sorting-associating protein 4B; S | 98.07 | |
| 1d2n_A | 272 | N-ethylmaleimide-sensitive fusion protein; hexamer | 98.05 | |
| 3cf0_A | 301 | Transitional endoplasmic reticulum ATPase; AAA, P9 | 98.04 | |
| 3syl_A | 309 | Protein CBBX; photosynthesis, rubisco activase, AA | 98.03 | |
| 3pxg_A | 468 | Negative regulator of genetic competence CLPC/MEC; | 98.02 | |
| 3g39_A | 170 | Variable lymphocyte receptor VLRB.2D; antibody, X- | 98.01 | |
| 3uk6_A | 368 | RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding | 98.01 | |
| 2ca6_A | 386 | RAN GTPase-activating protein 1; GAP, GTPase activ | 98.0 | |
| 1l8q_A | 324 | Chromosomal replication initiator protein DNAA; AA | 98.0 | |
| 2qp9_X | 355 | Vacuolar protein sorting-associated protein 4; ATP | 97.98 | |
| 1a5t_A | 334 | Delta prime, HOLB; zinc finger, DNA replication; 2 | 97.96 | |
| 1qvr_A | 854 | CLPB protein; coiled coil, AAA ATPase, chaperone; | 97.96 | |
| 4b4t_J | 405 | 26S protease regulatory subunit 8 homolog; hydrola | 97.94 | |
| 3ec2_A | 180 | DNA replication protein DNAC; helicase loader, rep | 97.93 | |
| 2w58_A | 202 | DNAI, primosome component (helicase loader); ATP-b | 97.92 | |
| 1dce_A | 567 | Protein (RAB geranylgeranyltransferase alpha subun | 97.9 | |
| 4b4t_L | 437 | 26S protease subunit RPT4; hydrolase, AAA-atpases, | 97.9 | |
| 2ca6_A | 386 | RAN GTPase-activating protein 1; GAP, GTPase activ | 97.86 | |
| 2ifg_A | 347 | High affinity nerve growth factor receptor; TRK, T | 97.83 | |
| 4b4t_H | 467 | 26S protease regulatory subunit 7 homolog; hydrola | 97.82 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 97.8 | |
| 4b4t_M | 434 | 26S protease regulatory subunit 6A; hydrolase, AAA | 97.79 | |
| 3e4g_A | 176 | ATP synthase subunit S, mitochondrial; leucine-ric | 97.78 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 97.78 | |
| 4b4t_I | 437 | 26S protease regulatory subunit 4 homolog; hydrola | 97.76 | |
| 2gno_A | 305 | DNA polymerase III, gamma subunit-related protein; | 97.75 | |
| 2r9u_A | 174 | Variable lymphocyte receptor; adaptive immunity, V | 97.74 | |
| 1ds9_A | 198 | Outer arm dynein; leucine-rich repeat, beta-BETA-a | 97.73 | |
| 4b4t_K | 428 | 26S protease regulatory subunit 6B homolog; hydrol | 97.71 | |
| 1r6b_X | 758 | CLPA protein; AAA+, N-terminal domain, CLPS, cryst | 97.7 | |
| 3pxi_A | 758 | Negative regulator of genetic competence CLPC/MEC; | 97.66 | |
| 1lv7_A | 257 | FTSH; alpha/beta domain, four helix bundle, hydrol | 97.65 | |
| 3n70_A | 145 | Transport activator; sigma-54, ntpase, PSI, MCSG, | 97.64 | |
| 1ds9_A | 198 | Outer arm dynein; leucine-rich repeat, beta-BETA-a | 97.61 | |
| 3goz_A | 362 | Leucine-rich repeat-containing protein; LEGL7, NES | 97.61 | |
| 3hu3_A | 489 | Transitional endoplasmic reticulum ATPase; VCP, tr | 97.55 | |
| 4fcw_A | 311 | Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 | 97.55 | |
| 3g39_A | 170 | Variable lymphocyte receptor VLRB.2D; antibody, X- | 97.54 | |
| 2ce7_A | 476 | Cell division protein FTSH; metalloprotease; HET: | 97.51 | |
| 2kjq_A | 149 | DNAA-related protein; solution structure, NESG, st | 97.48 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 97.47 | |
| 2r62_A | 268 | Cell division protease FTSH homolog; ATPase domain | 97.34 | |
| 1in4_A | 334 | RUVB, holliday junction DNA helicase RUVB; AAA+-cl | 97.29 | |
| 3sb4_A | 329 | Hypothetical leucine rich repeat protein; LRR, rig | 97.28 | |
| 3goz_A | 362 | Leucine-rich repeat-containing protein; LEGL7, NES | 97.23 | |
| 2x8a_A | 274 | Nuclear valosin-containing protein-like; nuclear p | 97.15 | |
| 3hr8_A | 356 | Protein RECA; alpha and beta proteins (A/B, A+B), | 97.13 | |
| 2ifg_A | 347 | High affinity nerve growth factor receptor; TRK, T | 97.13 | |
| 2ra8_A | 362 | Uncharacterized protein Q64V53_bacfr; WGR domain, | 97.12 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 97.11 | |
| 3e4g_A | 176 | ATP synthase subunit S, mitochondrial; leucine-ric | 97.1 | |
| 3m6a_A | 543 | ATP-dependent protease LA 1; alpha, beta, ATP-bind | 97.09 | |
| 3cf2_A | 806 | TER ATPase, transitional endoplasmic reticulum ATP | 97.07 | |
| 1z7x_W | 461 | Ribonuclease inhibitor; leucine-rich repeat, enzym | 97.05 | |
| 1ixz_A | 254 | ATP-dependent metalloprotease FTSH; AAA domain fol | 97.01 | |
| 2qgz_A | 308 | Helicase loader, putative primosome component; str | 97.0 | |
| 3io5_A | 333 | Recombination and repair protein; storage dimer, i | 96.99 | |
| 2w0m_A | 235 | SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus | 96.99 | |
| 1z7x_W | 461 | Ribonuclease inhibitor; leucine-rich repeat, enzym | 96.95 | |
| 2cvh_A | 220 | DNA repair and recombination protein RADB; filamen | 96.91 | |
| 2zr9_A | 349 | Protein RECA, recombinase A; recombination, RECA m | 96.9 | |
| 1n0w_A | 243 | DNA repair protein RAD51 homolog 1; DNA repair, ho | 96.89 | |
| 3pxi_A | 758 | Negative regulator of genetic competence CLPC/MEC; | 96.88 | |
| 3co5_A | 143 | Putative two-component system transcriptional RES | 96.86 | |
| 1iy2_A | 278 | ATP-dependent metalloprotease FTSH; AAA domain fol | 96.84 | |
| 3un9_A | 372 | NLR family member X1; leucine rich repeat (LRR), a | 96.83 | |
| 2vhj_A | 331 | Ntpase P4, P4; non- hydrolysable ATP analogue, hyd | 96.82 | |
| 2ra8_A | 362 | Uncharacterized protein Q64V53_bacfr; WGR domain, | 96.76 | |
| 1xp8_A | 366 | RECA protein, recombinase A; recombination, radior | 96.73 | |
| 3un9_A | 372 | NLR family member X1; leucine rich repeat (LRR), a | 96.68 | |
| 1v5w_A | 343 | DMC1, meiotic recombination protein DMC1/LIM15 hom | 96.68 | |
| 1u94_A | 356 | RECA protein, recombinase A; homologous recombinat | 96.66 | |
| 3t15_A | 293 | Ribulose bisphosphate carboxylase/oxygenase activ | 96.62 | |
| 2dhr_A | 499 | FTSH; AAA+ protein, hexameric Zn metalloprotease, | 96.61 | |
| 1r6b_X | 758 | CLPA protein; AAA+, N-terminal domain, CLPS, cryst | 96.6 | |
| 2z43_A | 324 | DNA repair and recombination protein RADA; archaea | 96.6 | |
| 2i1q_A | 322 | DNA repair and recombination protein RADA; ATPase, | 96.52 | |
| 3kl4_A | 433 | SRP54, signal recognition 54 kDa protein; signal r | 96.52 | |
| 1ypw_A | 806 | Transitional endoplasmic reticulum ATPase; AAA, P9 | 96.49 | |
| 3dm5_A | 443 | SRP54, signal recognition 54 kDa protein; protein- | 96.39 | |
| 4a74_A | 231 | DNA repair and recombination protein RADA; hydrola | 96.37 | |
| 1rz3_A | 201 | Hypothetical protein rbstp0775; MCSG, structural g | 96.29 | |
| 2px0_A | 296 | Flagellar biosynthesis protein FLHF; SRP GTPase, f | 96.29 | |
| 3lda_A | 400 | DNA repair protein RAD51; DNA binding protein, ATP | 96.2 | |
| 2c9o_A | 456 | RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP- | 96.18 | |
| 3sb4_A | 329 | Hypothetical leucine rich repeat protein; LRR, rig | 96.16 | |
| 1j8m_F | 297 | SRP54, signal recognition 54 kDa protein; signalin | 96.05 | |
| 1io0_A | 185 | Tropomodulin; LRR protein, right-handed super-heli | 96.0 | |
| 3c8u_A | 208 | Fructokinase; YP_612366.1, putative fructose trans | 96.0 | |
| 2dr3_A | 247 | UPF0273 protein PH0284; RECA superfamily ATPase, h | 95.99 | |
| 1qvr_A | 854 | CLPB protein; coiled coil, AAA ATPase, chaperone; | 95.99 | |
| 2ehv_A | 251 | Hypothetical protein PH0186; KAIC, RECA ATPase, un | 95.97 | |
| 1ofh_A | 310 | ATP-dependent HSL protease ATP-binding subunit HSL | 95.95 | |
| 3jvv_A | 356 | Twitching mobility protein; hexameric P-loop ATPas | 95.91 | |
| 1pzn_A | 349 | RAD51, DNA repair and recombination protein RAD51, | 95.85 | |
| 3cmu_A | 2050 | Protein RECA, recombinase A; homologous recombinat | 95.68 | |
| 3bh0_A | 315 | DNAB-like replicative helicase; ATPase, replicatio | 95.62 | |
| 2bjv_A | 265 | PSP operon transcriptional activator; AAA, transcr | 95.57 | |
| 1vma_A | 306 | Cell division protein FTSY; TM0570, structural gen | 95.47 | |
| 2xxa_A | 433 | Signal recognition particle protein; protein trans | 95.35 | |
| 1qhx_A | 178 | CPT, protein (chloramphenicol phosphotransferase); | 95.35 | |
| 3kb2_A | 173 | SPBC2 prophage-derived uncharacterized protein YOR | 95.33 | |
| 1g8p_A | 350 | Magnesium-chelatase 38 kDa subunit; parallel beta | 95.33 | |
| 4eun_A | 200 | Thermoresistant glucokinase; putative sugar kinase | 95.3 | |
| 1zp6_A | 191 | Hypothetical protein ATU3015; alpha-beta protein., | 95.29 | |
| 3uie_A | 200 | Adenylyl-sulfate kinase 1, chloroplastic; rossmann | 95.28 | |
| 3ice_A | 422 | Transcription termination factor RHO; transcriptio | 95.28 | |
| 3vaa_A | 199 | Shikimate kinase, SK; structural genomics, center | 95.28 | |
| 1kgd_A | 180 | CASK, peripheral plasma membrane CASK; maguk, guan | 95.28 | |
| 3lw7_A | 179 | Adenylate kinase related protein (ADKA-like); AMP, | 95.27 | |
| 1ls1_A | 295 | Signal recognition particle protein; FFH, SRP54, S | 95.27 | |
| 2hf9_A | 226 | Probable hydrogenase nickel incorporation protein | 95.22 | |
| 3e70_C | 328 | DPA, signal recognition particle receptor; FTSY, S | 95.21 | |
| 2ck3_D | 482 | ATP synthase subunit beta\, mitochondrial; hydrola | 95.13 | |
| 1kag_A | 173 | SKI, shikimate kinase I; transferase, structural g | 95.12 | |
| 4a1f_A | 338 | DNAB helicase, replicative DNA helicase; hydrolase | 95.11 | |
| 1ly1_A | 181 | Polynucleotide kinase; PNK, phosphatase, transfera | 95.1 | |
| 1odf_A | 290 | YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser | 95.07 | |
| 2b8t_A | 223 | Thymidine kinase; deoxyribonucleoside kinase, zinc | 95.02 | |
| 2r44_A | 331 | Uncharacterized protein; putative ATPase, structur | 95.02 | |
| 3tr0_A | 205 | Guanylate kinase, GMP kinase; purines, pyrimidines | 94.99 | |
| 2wsm_A | 221 | Hydrogenase expression/formation protein (HYPB); m | 94.96 | |
| 1sky_E | 473 | F1-ATPase, F1-ATP synthase; F1FO ATP synthase, alp | 94.96 | |
| 3trf_A | 185 | Shikimate kinase, SK; amino acid biosynthesis, tra | 94.94 | |
| 2ga8_A | 359 | Hypothetical 39.9 kDa protein; YFR007W, YFH7, unkn | 94.91 | |
| 1nks_A | 194 | Adenylate kinase; thermophilic, transferase; HET: | 94.87 | |
| 3asz_A | 211 | Uridine kinase; cytidine phosphorylation, transfer | 94.87 | |
| 1knq_A | 175 | Gluconate kinase; ALFA/beta structure, transferase | 94.86 | |
| 3a00_A | 186 | Guanylate kinase, GMP kinase; domain movement, dim | 94.86 | |
| 3tau_A | 208 | Guanylate kinase, GMP kinase; structural genomics, | 94.85 | |
| 1xjc_A | 169 | MOBB protein homolog; structural genomics, midwest | 94.85 | |
| 3t61_A | 202 | Gluconokinase; PSI-biology, structural genomics, p | 94.85 | |
| 3tqc_A | 321 | Pantothenate kinase; biosynthesis of cofactors, pr | 94.84 | |
| 3nbx_X | 500 | ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structu | 94.83 | |
| 2rhm_A | 193 | Putative kinase; P-loop containing nucleoside trip | 94.83 | |
| 1ye8_A | 178 | Protein THEP1, hypothetical UPF0334 kinase-like pr | 94.81 | |
| 1ojl_A | 304 | Transcriptional regulatory protein ZRAR; response | 94.78 | |
| 2qor_A | 204 | Guanylate kinase; phosphotransferase, purine metab | 94.77 | |
| 2bdt_A | 189 | BH3686; alpha-beta protein, structural genomics, P | 94.72 | |
| 1kht_A | 192 | Adenylate kinase; phosphotransferase, signaling pr | 94.69 | |
| 2j41_A | 207 | Guanylate kinase; GMP, GMK, transferase, ATP-bindi | 94.69 | |
| 2ze6_A | 253 | Isopentenyl transferase; crown GALL tumor, cytokin | 94.69 | |
| 3iij_A | 180 | Coilin-interacting nuclear ATPase protein; alpha a | 94.69 | |
| 1gvn_B | 287 | Zeta; postsegregational killing system, plasmid; 1 | 94.67 | |
| 1io0_A | 185 | Tropomodulin; LRR protein, right-handed super-heli | 94.63 | |
| 1jr3_D | 343 | DNA polymerase III, delta subunit; processivity, p | 94.62 | |
| 1zuh_A | 168 | Shikimate kinase; alpha-beta protein, transferase; | 94.61 | |
| 1lvg_A | 198 | Guanylate kinase, GMP kinase; transferase; HET: AD | 94.59 | |
| 2bbw_A | 246 | Adenylate kinase 4, AK4; nucleotide kinase, nucleo | 94.57 | |
| 2c95_A | 196 | Adenylate kinase 1; transferase, AP4A, nucleotide | 94.57 | |
| 3hws_A | 363 | ATP-dependent CLP protease ATP-binding subunit CL; | 94.55 | |
| 1fx0_B | 498 | ATP synthase beta chain; latent ATPase, thermal st | 94.55 | |
| 1uf9_A | 203 | TT1252 protein; P-loop, nucleotide binding domain, | 94.53 | |
| 1y63_A | 184 | LMAJ004144AAA protein; structural genomics, protei | 94.51 | |
| 2jaq_A | 205 | Deoxyguanosine kinase; transferase, deoxyribonucle | 94.51 | |
| 1tev_A | 196 | UMP-CMP kinase; ploop, NMP binding region, LID reg | 94.5 | |
| 1via_A | 175 | Shikimate kinase; structural genomics, transferase | 94.5 | |
| 2if2_A | 204 | Dephospho-COA kinase; alpha-beta protein, structur | 94.5 | |
| 1htw_A | 158 | HI0065; nucleotide-binding fold, structural genomi | 94.48 | |
| 3ney_A | 197 | 55 kDa erythrocyte membrane protein; structural ge | 94.48 | |
| 3rw6_A | 267 | Nuclear RNA export factor 1; retroviral constituti | 94.45 | |
| 4gp7_A | 171 | Metallophosphoesterase; polynucleotide kinase phos | 94.43 | |
| 2f1r_A | 171 | Molybdopterin-guanine dinucleotide biosynthesis pr | 94.42 | |
| 1uj2_A | 252 | Uridine-cytidine kinase 2; alpha/beta mononucleoti | 94.41 | |
| 3cmw_A | 1706 | Protein RECA, recombinase A; homologous recombinat | 94.41 | |
| 1cke_A | 227 | CK, MSSA, protein (cytidine monophosphate kinase); | 94.41 | |
| 1znw_A | 207 | Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans | 94.4 | |
| 3cmw_A | 1706 | Protein RECA, recombinase A; homologous recombinat | 94.39 | |
| 2j37_W | 504 | Signal recognition particle 54 kDa protein (SRP54) | 94.38 | |
| 1um8_A | 376 | ATP-dependent CLP protease ATP-binding subunit CL; | 94.38 | |
| 2yvu_A | 186 | Probable adenylyl-sulfate kinase; transferase, str | 94.38 | |
| 1ex7_A | 186 | Guanylate kinase; substrate-induced FIT, domain mo | 94.37 | |
| 2ffh_A | 425 | Protein (FFH); SRP54, signal recognition particle, | 94.36 | |
| 1ukz_A | 203 | Uridylate kinase; transferase; HET: ADP AMP; 1.90A | 94.35 | |
| 2qt1_A | 207 | Nicotinamide riboside kinase 1; non-protein kinase | 94.34 | |
| 2bwj_A | 199 | Adenylate kinase 5; phosphoryl transfer reaction, | 94.33 | |
| 2plr_A | 213 | DTMP kinase, probable thymidylate kinase; TMP-bind | 94.32 | |
| 1rj9_A | 304 | FTSY, signal recognition protein; SRP-GTPase domai | 94.3 | |
| 3aez_A | 312 | Pantothenate kinase; transferase, homodimer, COA b | 94.3 | |
| 3cm0_A | 186 | Adenylate kinase; ATP-binding, cytoplasm, nucleoti | 94.3 | |
| 3cmu_A | 2050 | Protein RECA, recombinase A; homologous recombinat | 94.3 | |
| 2iyv_A | 184 | Shikimate kinase, SK; transferase, aromatic amino | 94.27 | |
| 2jeo_A | 245 | Uridine-cytidine kinase 1; UCK, transferase, ATP-b | 94.24 | |
| 2vli_A | 183 | Antibiotic resistance protein; transferase, tunica | 94.2 | |
| 3a4m_A | 260 | L-seryl-tRNA(SEC) kinase; P-loop motif, walker A m | 94.19 | |
| 3umf_A | 217 | Adenylate kinase; rossmann fold, transferase; 2.05 | 94.17 | |
| 2r6a_A | 454 | DNAB helicase, replicative helicase; replication, | 94.15 | |
| 1z6g_A | 218 | Guanylate kinase; structural genomics, SGC, struct | 94.14 | |
| 2p5t_B | 253 | PEZT; postsegregational killing system, phosphoryl | 94.13 | |
| 1qf9_A | 194 | UMP/CMP kinase, protein (uridylmonophosphate/cytid | 94.1 | |
| 1e6c_A | 173 | Shikimate kinase; phosphoryl transfer, ADP, shikim | 94.09 | |
| 3tlx_A | 243 | Adenylate kinase 2; structural genomics, structura | 94.07 | |
| 2wwf_A | 212 | Thymidilate kinase, putative; transferase, malaria | 94.07 | |
| 4fdw_A | 401 | Leucine rich hypothetical protein; putative cell s | 94.06 | |
| 1jjv_A | 206 | Dephospho-COA kinase; P-loop nucleotide-binding fo | 94.05 | |
| 1nn5_A | 215 | Similar to deoxythymidylate kinase (thymidylate K; | 94.02 | |
| 1s96_A | 219 | Guanylate kinase, GMP kinase; E.coli, dimer, SAD, | 94.01 | |
| 2cdn_A | 201 | Adenylate kinase; phosphoryl transfer, associative | 94.0 | |
| 2grj_A | 192 | Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosp | 94.0 | |
| 4e22_A | 252 | Cytidylate kinase; P-loop, CMP/ATP binding, transf | 93.95 | |
| 1aky_A | 220 | Adenylate kinase; ATP:AMP phosphotransferase, myok | 93.94 | |
| 2pt5_A | 168 | Shikimate kinase, SK; aromatic amino acid biosynth | 93.93 | |
| 3fwy_A | 314 | Light-independent protochlorophyllide reductase I | 93.92 | |
| 2i3b_A | 189 | HCR-ntpase, human cancer-related ntpase; AAA, ross | 93.87 | |
| 2pbr_A | 195 | DTMP kinase, thymidylate kinase; transferase, nucl | 93.86 | |
| 2q6t_A | 444 | DNAB replication FORK helicase; hydrolase; 2.90A { | 93.86 | |
| 3b9q_A | 302 | Chloroplast SRP receptor homolog, alpha subunit CP | 93.81 | |
| 1zd8_A | 227 | GTP:AMP phosphotransferase mitochondrial; ATP:AMP | 93.81 | |
| 2eyu_A | 261 | Twitching motility protein PILT; pilus retraction | 93.79 | |
| 2onk_A | 240 | Molybdate/tungstate ABC transporter, ATP-binding p | 93.78 | |
| 1gtv_A | 214 | TMK, thymidylate kinase; transferase, transferase | 93.76 | |
| 2z0h_A | 197 | DTMP kinase, thymidylate kinase; ATP-binding, nucl | 93.74 | |
| 1g5t_A | 196 | COB(I)alamin adenosyltransferase; P-loop protein, | 93.67 | |
| 3rw6_A | 267 | Nuclear RNA export factor 1; retroviral constituti | 93.66 | |
| 1sq5_A | 308 | Pantothenate kinase; P-loop, transferase; HET: PAU | 93.66 | |
| 1np6_A | 174 | Molybdopterin-guanine dinucleotide biosynthesis pr | 93.6 | |
| 1cr0_A | 296 | DNA primase/helicase; RECA-type protein fold, tran | 93.59 | |
| 3fb4_A | 216 | Adenylate kinase; psychrophIle, phosphotransferase | 93.58 | |
| 3bgw_A | 444 | DNAB-like replicative helicase; ATPase, replicatio | 93.57 | |
| 1zak_A | 222 | Adenylate kinase; ATP:AMP-phosphotransferase, tran | 93.57 | |
| 2pcj_A | 224 | ABC transporter, lipoprotein-releasing system ATP- | 93.57 | |
| 3end_A | 307 | Light-independent protochlorophyllide reductase ir | 93.55 | |
| 3tif_A | 235 | Uncharacterized ABC transporter ATP-binding prote; | 93.52 | |
| 2pez_A | 179 | Bifunctional 3'-phosphoadenosine 5'- phosphosulfat | 93.52 | |
| 2v54_A | 204 | DTMP kinase, thymidylate kinase; nucleotide biosyn | 93.49 | |
| 2yhs_A | 503 | FTSY, cell division protein FTSY; cell cycle, prot | 93.47 | |
| 2zts_A | 251 | Putative uncharacterized protein PH0186; KAIC like | 93.45 | |
| 1zu4_A | 320 | FTSY; GTPase, signal recognition particle, SRP, re | 93.44 | |
| 1g41_A | 444 | Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dep | 93.41 | |
| 1m7g_A | 211 | Adenylylsulfate kinase; APS kinase, transferase, s | 93.4 | |
| 3b85_A | 208 | Phosphate starvation-inducible protein; PHOH2, ATP | 93.39 | |
| 3dl0_A | 216 | Adenylate kinase; phosphotransferase, zinc coordin | 93.37 | |
| 3lnc_A | 231 | Guanylate kinase, GMP kinase; ALS collaborative cr | 93.36 | |
| 1q57_A | 503 | DNA primase/helicase; dntpase, DNA replication, tr | 93.34 | |
| 2og2_A | 359 | Putative signal recognition particle receptor; nuc | 93.3 | |
| 3k1j_A | 604 | LON protease, ATP-dependent protease LON; ATP-bind | 93.29 | |
| 1vht_A | 218 | Dephospho-COA kinase; structural genomics, transfe | 93.23 | |
| 3nwj_A | 250 | ATSK2; P loop, shikimate, nucleoside monophosphate | 93.2 | |
| 2cbz_A | 237 | Multidrug resistance-associated protein 1; ABC pro | 93.15 | |
| 1tue_A | 212 | Replication protein E1; helicase, replication, E1E | 93.14 | |
| 1b0u_A | 262 | Histidine permease; ABC transporter, transport pro | 93.13 | |
| 2d2e_A | 250 | SUFC protein; ABC-ATPase, SUF protein, 310-helix, | 93.08 | |
| 3gfo_A | 275 | Cobalt import ATP-binding protein CBIO 1; structur | 93.08 | |
| 3p32_A | 355 | Probable GTPase RV1496/MT1543; structural genomics | 93.07 | |
| 2f6r_A | 281 | COA synthase, bifunctional coenzyme A synthase; 18 | 93.04 | |
| 3r20_A | 233 | Cytidylate kinase; structural genomics, seattle st | 92.99 | |
| 3ake_A | 208 | Cytidylate kinase; CMP kinase, CMP complex, open c | 92.99 | |
| 1ji0_A | 240 | ABC transporter; ATP binding protein, structural g | 92.97 | |
| 2olj_A | 263 | Amino acid ABC transporter; ABC domain, ATPase, hy | 92.96 | |
| 1sgw_A | 214 | Putative ABC transporter; structural genomics, P p | 92.96 | |
| 1g6h_A | 257 | High-affinity branched-chain amino acid transport | 92.95 | |
| 2zu0_C | 267 | Probable ATP-dependent transporter SUFC; iron-sulf | 92.93 | |
| 3d3q_A | 340 | TRNA delta(2)-isopentenylpyrophosphate transferase | 92.93 | |
| 4g1u_C | 266 | Hemin import ATP-binding protein HMUV; membrane tr | 92.92 | |
| 2pze_A | 229 | Cystic fibrosis transmembrane conductance regulat; | 92.89 | |
| 1mv5_A | 243 | LMRA, multidrug resistance ABC transporter ATP-bin | 92.79 | |
| 1vpl_A | 256 | ABC transporter, ATP-binding protein; TM0544, stru | 92.78 | |
| 3upu_A | 459 | ATP-dependent DNA helicase DDA; RECA-like domain, | 92.78 | |
| 2ff7_A | 247 | Alpha-hemolysin translocation ATP-binding protein | 92.78 | |
| 1e4v_A | 214 | Adenylate kinase; transferase(phosphotransferase); | 92.7 | |
| 3be4_A | 217 | Adenylate kinase; malaria, cryptosporidium parvum | 92.7 | |
| 2ghi_A | 260 | Transport protein; multidrug resistance protein, M | 92.6 | |
| 2xb4_A | 223 | Adenylate kinase; ATP-binding, nucleotide-binding, | 92.6 | |
| 2qi9_C | 249 | Vitamin B12 import ATP-binding protein BTUD; inner | 92.6 | |
| 3sr0_A | 206 | Adenylate kinase; phosphoryl transfer analogue, AL | 92.57 | |
| 1ak2_A | 233 | Adenylate kinase isoenzyme-2; nucleoside monophosp | 92.57 | |
| 3crm_A | 323 | TRNA delta(2)-isopentenylpyrophosphate transferase | 92.55 | |
| 3exa_A | 322 | TRNA delta(2)-isopentenylpyrophosphate transferase | 92.55 | |
| 2ixe_A | 271 | Antigen peptide transporter 1; ABC ATPase, hydrola | 92.55 | |
| 1oix_A | 191 | RAS-related protein RAB-11A; small G protein, intr | 92.55 | |
| 2yz2_A | 266 | Putative ABC transporter ATP-binding protein TM_0; | 92.49 | |
| 2ihy_A | 279 | ABC transporter, ATP-binding protein; ATPase, ABC | 92.46 | |
| 3vr4_D | 465 | V-type sodium ATPase subunit D; V-ATPase, rotary m | 92.45 | |
| 2nq2_C | 253 | Hypothetical ABC transporter ATP-binding protein H | 92.43 | |
| 1a7j_A | 290 | Phosphoribulokinase; transferase, calvin cycle; 2. | 92.43 | |
| 2v9p_A | 305 | Replication protein E1; AAA+ molecular motor, DNA | 92.4 | |
| 3cf2_A | 806 | TER ATPase, transitional endoplasmic reticulum ATP | 92.36 | |
| 3a8t_A | 339 | Adenylate isopentenyltransferase; rossmann fold pr | 92.24 | |
| 3sop_A | 270 | Neuronal-specific septin-3; hydrolase; HET: GDP; 2 | 92.24 | |
| 3foz_A | 316 | TRNA delta(2)-isopentenylpyrophosphate transferas; | 92.21 | |
| 1yrb_A | 262 | ATP(GTP)binding protein; GTPase, P-loop, rossman f | 92.06 | |
| 4eaq_A | 229 | DTMP kinase, thymidylate kinase; structural genomi | 92.02 | |
| 3cr8_A | 552 | Sulfate adenylyltranferase, adenylylsulfate kinase | 92.02 | |
| 2f9l_A | 199 | RAB11B, member RAS oncogene family; RAB11B GTPase, | 92.0 | |
| 1g8f_A | 511 | Sulfate adenylyltransferase; alpha-beta protein, b | 91.97 | |
| 2pjz_A | 263 | Hypothetical protein ST1066; ATP binding protein, | 91.85 | |
| 3kta_A | 182 | Chromosome segregation protein SMC; structural mai | 91.83 | |
| 1ltq_A | 301 | Polynucleotide kinase; phosphatase, alpha/beta, P- | 91.79 | |
| 1q3t_A | 236 | Cytidylate kinase; nucleotide monophosphate kinase | 91.67 | |
| 3lv8_A | 236 | DTMP kinase, thymidylate kinase; structural genomi | 91.67 | |
| 2wji_A | 165 | Ferrous iron transport protein B homolog; membrane | 91.67 | |
| 2bbs_A | 290 | Cystic fibrosis transmembrane conductance regulato | 91.63 | |
| 1nlf_A | 279 | Regulatory protein REPA; replicative DNA helicase | 91.6 | |
| 4f4c_A | 1321 | Multidrug resistance protein PGP-1; ABC transporte | 91.58 | |
| 2dyk_A | 161 | GTP-binding protein; GTPase, ribosome-binding prot | 91.55 | |
| 2ocp_A | 241 | DGK, deoxyguanosine kinase; protein-nucleotide com | 91.54 | |
| 3io3_A | 348 | DEHA2D07832P; chaperone, membrane traffic, ATPase; | 91.53 | |
| 3hjn_A | 197 | DTMP kinase, thymidylate kinase; ATP-binding, nucl | 91.51 | |
| 1tq4_A | 413 | IIGP1, interferon-inducible GTPase; interferon gam | 91.51 | |
| 1cp2_A | 269 | CP2, nitrogenase iron protein; oxidoreductase; 1.9 | 91.5 | |
| 2afh_E | 289 | Nitrogenase iron protein 1; nitrogen fixation, iro | 91.46 | |
| 3fvq_A | 359 | Fe(3+) IONS import ATP-binding protein FBPC; nucle | 91.42 | |
| 2vp4_A | 230 | Deoxynucleoside kinase; ATP-binding, DNA synthesis | 91.41 | |
| 3ux8_A | 670 | Excinuclease ABC, A subunit; UVRA, nucleotide exci | 91.4 | |
| 4tmk_A | 213 | Protein (thymidylate kinase); ATP:DTMP phosphotran | 91.38 | |
| 2zej_A | 184 | Dardarin, leucine-rich repeat kinase 2; parkinson' | 91.35 | |
| 1nij_A | 318 | Hypothetical protein YJIA; structural genomics, P- | 91.33 | |
| 1tf7_A | 525 | KAIC; homohexamer, hexamer, circadian clock protei | 91.32 | |
| 1svm_A | 377 | Large T antigen; AAA+ fold, viral protein; HET: AT | 91.27 | |
| 3tui_C | 366 | Methionine import ATP-binding protein METN; ABC-tr | 91.26 | |
| 2r8r_A | 228 | Sensor protein; KDPD, PFAM02702, MCSG, structural | 91.24 | |
| 1p9r_A | 418 | General secretion pathway protein E; bacterial typ | 91.21 | |
| 2v3c_C | 432 | SRP54, signal recognition 54 kDa protein; nucleoti | 91.18 | |
| 3iqw_A | 334 | Tail-anchored protein targeting factor GET3; ATPas | 91.14 | |
| 3nh6_A | 306 | ATP-binding cassette SUB-family B member 6, mitoc; | 91.11 | |
| 2ce2_X | 166 | GTPase HRAS; signaling protein, guanine nucleotide | 91.09 | |
| 3eph_A | 409 | TRNA isopentenyltransferase; transferase, alternat | 91.09 | |
| 3zvl_A | 416 | Bifunctional polynucleotide phosphatase/kinase; hy | 91.08 | |
| 3gqb_B | 464 | V-type ATP synthase beta chain; A3B3, V-ATPase, AT | 91.08 | |
| 3mfy_A | 588 | V-type ATP synthase alpha chain; A-type ATP syntha | 91.05 | |
| 1z47_A | 355 | CYSA, putative ABC-transporter ATP-binding protein | 90.98 | |
| 3ld9_A | 223 | DTMP kinase, thymidylate kinase; ssgcid, NIH, niai | 90.97 | |
| 3fkq_A | 373 | NTRC-like two-domain protein; RER070207001320, str | 90.97 | |
| 2c61_A | 469 | A-type ATP synthase non-catalytic subunit B; hydro | 90.93 | |
| 4edh_A | 213 | DTMP kinase, thymidylate kinase; structural genomi | 90.92 | |
| 1z2a_A | 168 | RAS-related protein RAB-23; RAB GTPase, vesicular | 90.85 | |
| 2www_A | 349 | Methylmalonic aciduria type A protein, mitochondri | 90.84 | |
| 2qm8_A | 337 | GTPase/ATPase; G protein, G3E, metallochaperone, c | 90.8 | |
| 2qmh_A | 205 | HPR kinase/phosphorylase; V267F mutation, ATP-bind | 90.79 | |
| 2yyz_A | 359 | Sugar ABC transporter, ATP-binding protein; sugar | 90.73 | |
| 2wjg_A | 188 | FEOB, ferrous iron transport protein B homolog; me | 90.71 | |
| 3rlf_A | 381 | Maltose/maltodextrin import ATP-binding protein M; | 90.69 | |
| 2it1_A | 362 | 362AA long hypothetical maltose/maltodextrin trans | 90.66 | |
| 4gzl_A | 204 | RAS-related C3 botulinum toxin substrate 1; rossma | 90.63 | |
| 2ewv_A | 372 | Twitching motility protein PILT; pilus retraction | 90.62 | |
| 1zj6_A | 187 | ADP-ribosylation factor-like protein 5; ARL, GTP-b | 90.59 | |
| 3con_A | 190 | GTPase NRAS; structural genomics consortium, SGC, | 90.52 | |
| 2gj8_A | 172 | MNME, tRNA modification GTPase TRME; G-domain dime | 90.49 | |
| 2ged_A | 193 | SR-beta, signal recognition particle receptor beta | 90.48 | |
| 1g29_1 | 372 | MALK, maltose transport protein MALK; ATPase, acti | 90.46 |
| >2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* | Back alignment and structure |
|---|
Probab=100.00 E-value=1.1e-39 Score=364.37 Aligned_cols=290 Identities=11% Similarity=0.082 Sum_probs=227.7
Q ss_pred cchHHHHHHHHHHHhcC---CceEEEEEecCCCcHHHHHHHHHH--HhhccCCCCEEEEEEecCCC--ChHHHHHHHHHH
Q 036977 161 DSRMKVFQDVMEALKDD---KLNIIGVYGMGGVGKTTLVKQVAK--KVMEDKLIDKVVMAEVTQNP--DPQKIQDKLASD 233 (693)
Q Consensus 161 ~gR~~~~~~l~~~L~~~---~~~vi~I~G~gGiGKTtLa~~v~~--~~~~~~~F~~~~wv~vs~~~--~~~~~~~~i~~~ 233 (693)
+||++++++|.++|..+ ..++|+|+||||+||||||+++|+ +.+.+.+|+.++||++++.+ +...++..|+.+
T Consensus 131 ~GR~~~~~~l~~~L~~~~~~~~~vv~I~G~gGvGKTtLA~~v~~~~~~~~~~~F~~~~wv~vs~~~~~~~~~~~~~il~~ 210 (549)
T 2a5y_B 131 YIREYHVDRVIKKLDEMCDLDSFFLFLHGRAGSGKSVIASQALSKSDQLIGINYDSIVWLKDSGTAPKSTFDLFTDILLM 210 (549)
T ss_dssp CCCHHHHHHHHHHHHHHTTSSSEEEEEECSTTSSHHHHHHHHHHHCSSTBTTTBSEEEEEECCCCSTTHHHHHHHHHHHH
T ss_pred CCchHHHHHHHHHHhcccCCCceEEEEEcCCCCCHHHHHHHHHHhhhHHHhccCCcEEEEEECCCCCCCHHHHHHHHHHH
Confidence 49999999999999644 679999999999999999999998 56777889999999999885 789999999999
Q ss_pred hCCCCC-------CCCCHHHHHHHHHHHHhcCCcEEEEEeCCCCccCccccCCCCCCcccccccccCCCeEEEEecCChh
Q 036977 234 LGMKFD-------LNDSIHHRASRLRERLKQEKRVLIILDNIWTKLELDAVGIPSGDVDEKDREDDQRRCTIILTSRSRD 306 (693)
Q Consensus 234 l~~~~~-------~~~~~~~~~~~l~~~L~~~k~~LlVlDdv~~~~~~~~l~~~~~~~~~~~~~~~~~~~~IivTtR~~~ 306 (693)
++.... ...+...+...+++.|++.|||||||||||+..++ .+ + ..+||+||||||++.
T Consensus 211 l~~~~~~~~~~~~~~~~~~~l~~~l~~~L~~~kr~LlVLDdv~~~~~~-~~----~---------~~~gs~ilvTTR~~~ 276 (549)
T 2a5y_B 211 LKSEDDLLNFPSVEHVTSVVLKRMICNALIDRPNTLFVFDDVVQEETI-RW----A---------QELRLRCLVTTRDVE 276 (549)
T ss_dssp HTTTSCCTTCCCCTTCCHHHHHHHHHHHHTTSTTEEEEEEEECCHHHH-HH----H---------HHTTCEEEEEESBGG
T ss_pred HhcCcccccccccccccHHHHHHHHHHHHcCCCcEEEEEECCCCchhh-cc----c---------ccCCCEEEEEcCCHH
Confidence 986532 12345667889999998833999999999998765 21 1 226999999999999
Q ss_pred hhhhhcC-CCcEEEcCCCCHHHHHHHHHHhhhhhhhccccccccccCCCCCCCchhhHHHHHhhhcCCCccc--------
Q 036977 307 LLCIDMN-SQKIFWIDALSKEEALHLAKLQHLEISYCESMEGVVDTTGWSERDEGKLIELKVFPKLHSLKLE-------- 377 (693)
Q Consensus 307 v~~~~~~-~~~~~~l~~L~~~ea~~Lf~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~I~~~c~glPLa-------- 377 (693)
++.. ++ ....|++++|+.++||+||.+.++.. ..++.+.+++.+|+++|+|+|||
T Consensus 277 v~~~-~~~~~~~~~l~~L~~~ea~~Lf~~~a~~~---------------~~~~~~~~~~~~I~~~c~GlPLAl~~~g~~l 340 (549)
T 2a5y_B 277 ISNA-ASQTCEFIEVTSLEIDECYDFLEAYGMPM---------------PVGEKEEDVLNKTIELSSGNPATLMMFFKSC 340 (549)
T ss_dssp GGGG-CCSCEEEEECCCCCHHHHHHHHHHTSCCC---------------C--CHHHHHHHHHHHHHTTCHHHHHHHHTTC
T ss_pred HHHH-cCCCCeEEECCCCCHHHHHHHHHHHhcCC---------------CCchhHHHHHHHHHHHhCCChHHHHHHHHHh
Confidence 9753 43 44689999999999999999998754 12467888999999999999999
Q ss_pred ----c--cccccc---cccccccccchhccccCchhHhhhhhhh-----------cccccCCC-Ccchhhhccc-C--CC
Q 036977 378 ----W--LPELTS---FANTGQIHSDLVVEFPSLLNLEIHGCNN-----------MLRFISTS-SPADTLHSEM-Q--SP 433 (693)
Q Consensus 378 ----w--l~~~~~---~~~~~~i~~~l~~sy~~L~~~~lk~cfl-----------~~~~fp~~-~~~~Li~lw~-~--g~ 433 (693)
| +..+.. ......+..++.+||+.||+ ++|.||+ |||+||++ ... +++|+ + |+
T Consensus 341 ~~~~w~~~~~l~~~l~~~~~~~i~~~l~~Sy~~L~~-~lk~~f~~Ls~~er~l~~~ls~fp~~~~i~--i~~w~a~~~G~ 417 (549)
T 2a5y_B 341 EPKTFEKMAQLNNKLESRGLVGVECITPYSYKSLAM-ALQRCVEVLSDEDRSALAFAVVMPPGVDIP--VKLWSCVIPVD 417 (549)
T ss_dssp CSSSHHHHHHHHHHHHHHCSSTTCCCSSSSSSSHHH-HHHHHHHTSCHHHHHHTTGGGSSCTTCCEE--HHHHHHHSCC-
T ss_pred ccchHHHHHHhHHHhhcccHHHHHHHHhcccccccH-HHHHHHhccchhhhhHhhheeeeCCCCeee--eeeeeeeccce
Confidence 3 211111 11345788999999999997 9999999 99999998 555 88999 7 77
Q ss_pred ccccc-----ccCcchhhhhhhhcCCCCchhhhccccccccccccccCCccEEEEcCCcccccccccccCCCCC
Q 036977 434 PLFDE-----KVGIPSSLVNLKVSGCPKLEEIVGHVGQEVKENRIAFSKLKVLILDDLPRLTSFLSKKEEGEPH 502 (693)
Q Consensus 434 ~~~~~-----~~~~~~~l~~L~~~~l~~~~~~~~~~~~~~~~~~~~~~~l~~~~~hdli~~~~~~~~~~~~~~~ 502 (693)
+.... ++.+ .+|++|+++|+++..... ....|+|||++|+++ ..++..++
T Consensus 418 i~~~~~~~~~~~~~-~~l~~L~~rsLl~~~~~~---------------~~~~~~mHdlv~~~a---~~~~~~~~ 472 (549)
T 2a5y_B 418 ICSNEEEQLDDEVA-DRLKRLSKRGALLSGKRM---------------PVLTFKIDHIIHMFL---KHVVDAQT 472 (549)
T ss_dssp ------CCCTHHHH-HHHHHTTTBSSCSEEECS---------------SSCEEECCHHHHHHH---HTTSCTHH
T ss_pred eccCCCCCCHHHHH-HHHHHHHHcCCeeEecCC---------------CceEEEeChHHHHHH---HHHHHHHH
Confidence 74322 3333 499999999999654311 223899999999999 77776544
|
| >3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* | Back alignment and structure |
|---|
| >1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} | Back alignment and structure |
|---|
| >2qen_A Walker-type ATPase; unknown function; HET: ADP; 2.25A {Pyrococcus abyssi} | Back alignment and structure |
|---|
| >1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* | Back alignment and structure |
|---|
| >2fna_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE ADP; 2.00A {Sulfolobus solfataricus} SCOP: a.4.5.11 c.37.1.20 | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >3qfl_A MLA10; coiled-coil, (CC) domain, NLRS, nucleotide-binding domain, L rich repeat containing receptors, protein binding; 2.00A {Hordeum vulgare} | Back alignment and structure |
|---|
| >2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 | Back alignment and structure |
|---|
| >1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} | Back alignment and structure |
|---|
| >2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A | Back alignment and structure |
|---|
| >3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A | Back alignment and structure |
|---|
| >2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* | Back alignment and structure |
|---|
| >2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} | Back alignment and structure |
|---|
| >1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* | Back alignment and structure |
|---|
| >1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A | Back alignment and structure |
|---|
| >2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} | Back alignment and structure |
|---|
| >2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* | Back alignment and structure |
|---|
| >1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* | Back alignment and structure |
|---|
| >3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A | Back alignment and structure |
|---|
| >1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} | Back alignment and structure |
|---|
| >1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* | Back alignment and structure |
|---|
| >2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A | Back alignment and structure |
|---|
| >2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A | Back alignment and structure |
|---|
| >2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A | Back alignment and structure |
|---|
| >2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* | Back alignment and structure |
|---|
| >2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} | Back alignment and structure |
|---|
| >2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} | Back alignment and structure |
|---|
| >1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A | Back alignment and structure |
|---|
| >2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A | Back alignment and structure |
|---|
| >1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} | Back alignment and structure |
|---|
| >2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} | Back alignment and structure |
|---|
| >2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A | Back alignment and structure |
|---|
| >4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A | Back alignment and structure |
|---|
| >2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} | Back alignment and structure |
|---|
| >1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} | Back alignment and structure |
|---|
| >4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* | Back alignment and structure |
|---|
| >2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A | Back alignment and structure |
|---|
| >1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} | Back alignment and structure |
|---|
| >4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 | Back alignment and structure |
|---|
| >1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 | Back alignment and structure |
|---|
| >1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A | Back alignment and structure |
|---|
| >2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A | Back alignment and structure |
|---|
| >4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* | Back alignment and structure |
|---|
| >1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* | Back alignment and structure |
|---|
| >3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* | Back alignment and structure |
|---|
| >4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* | Back alignment and structure |
|---|
| >4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* | Back alignment and structure |
|---|
| >1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* | Back alignment and structure |
|---|
| >3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} | Back alignment and structure |
|---|
| >2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* | Back alignment and structure |
|---|
| >1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* | Back alignment and structure |
|---|
| >1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} | Back alignment and structure |
|---|
| >1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A | Back alignment and structure |
|---|
| >1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A | Back alignment and structure |
|---|
| >4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} | Back alignment and structure |
|---|
| >3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C | Back alignment and structure |
|---|
| >2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 | Back alignment and structure |
|---|
| >2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* | Back alignment and structure |
|---|
| >3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} | Back alignment and structure |
|---|
| >3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} | Back alignment and structure |
|---|
| >4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* | Back alignment and structure |
|---|
| >2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* | Back alignment and structure |
|---|
| >3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* | Back alignment and structure |
|---|
| >2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 | Back alignment and structure |
|---|
| >2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A | Back alignment and structure |
|---|
| >1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* | Back alignment and structure |
|---|
| >3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} | Back alignment and structure |
|---|
| >3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* | Back alignment and structure |
|---|
| >3pxg_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 3.65A {Bacillus subtilis} | Back alignment and structure |
|---|
| >3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D | Back alignment and structure |
|---|
| >3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* | Back alignment and structure |
|---|
| >2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A | Back alignment and structure |
|---|
| >1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* | Back alignment and structure |
|---|
| >2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* | Back alignment and structure |
|---|
| >1a5t_A Delta prime, HOLB; zinc finger, DNA replication; 2.20A {Escherichia coli K12} SCOP: a.80.1.1 c.37.1.20 PDB: 1jr3_E* 1xxh_E* 1xxi_E* 3glf_E* 3glg_E* 3glh_E* 3gli_E* | Back alignment and structure |
|---|
| >1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 | Back alignment and structure |
|---|
| >4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* | Back alignment and structure |
|---|
| >2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* | Back alignment and structure |
|---|
| >4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A | Back alignment and structure |
|---|
| >2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 | Back alignment and structure |
|---|
| >4b4t_H 26S protease regulatory subunit 7 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* | Back alignment and structure |
|---|
| >4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* | Back alignment and structure |
|---|
| >4b4t_I 26S protease regulatory subunit 4 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2gno_A DNA polymerase III, gamma subunit-related protein; structural genomics, joint center for structural genomics, J protein structure initiative; HET: DNA; 2.00A {Thermotoga maritima} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} | Back alignment and structure |
|---|
| >1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A | Back alignment and structure |
|---|
| >4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* | Back alignment and structure |
|---|
| >3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} | Back alignment and structure |
|---|
| >1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} | Back alignment and structure |
|---|
| >1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A | Back alignment and structure |
|---|
| >3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* | Back alignment and structure |
|---|
| >4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* | Back alignment and structure |
|---|
| >3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D | Back alignment and structure |
|---|
| >2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* | Back alignment and structure |
|---|
| >2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* | Back alignment and structure |
|---|
| >2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* | Back alignment and structure |
|---|
| >1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* | Back alignment and structure |
|---|
| >3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >3hr8_A Protein RECA; alpha and beta proteins (A/B, A+B), ATP-binding, cytoplasm, damage, DNA recombination, DNA repair, DNA-binding; 1.95A {Thermotoga maritima} | Back alignment and structure |
|---|
| >2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 | Back alignment and structure |
|---|
| >2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* | Back alignment and structure |
|---|
| >3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A | Back alignment and structure |
|---|
| >3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A | Back alignment and structure |
|---|
| >3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* | Back alignment and structure |
|---|
| >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I | Back alignment and structure |
|---|
| >1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* | Back alignment and structure |
|---|
| >2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} | Back alignment and structure |
|---|
| >3io5_A Recombination and repair protein; storage dimer, inactive conformation, RECA like core domain, binding, DNA damage, DNA recombination; 2.40A {Enterobacteria phage T4} | Back alignment and structure |
|---|
| >2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} | Back alignment and structure |
|---|
| >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I | Back alignment and structure |
|---|
| >2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* | Back alignment and structure |
|---|
| >2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ... | Back alignment and structure |
|---|
| >1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 | Back alignment and structure |
|---|
| >3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} | Back alignment and structure |
|---|
| >3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} | Back alignment and structure |
|---|
| >1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >2vhj_A Ntpase P4, P4; non- hydrolysable ATP analogue, hydrolase, virus dsRNA, molecular motor, packaging ATPase, hexameric helicase; HET: ADP; 1.80A {Pseudomonas phage PHI12} PDB: 2vhq_A* 1w44_A* 1w46_A* 1w47_A* 1w48_A* 1w49_A* 1w4a_A* 1w4b_A* 1w4c_A 2vht_A* 2vhu_A* 2vhc_A* | Back alignment and structure |
|---|
| >2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >1xp8_A RECA protein, recombinase A; recombination, radioresistance, DNA-repair, ATPase, DNA-BIND protein, DNA binding protein; HET: AGS; 2.50A {Deinococcus radiodurans} SCOP: c.37.1.11 d.48.1.1 | Back alignment and structure |
|---|
| >3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >1v5w_A DMC1, meiotic recombination protein DMC1/LIM15 homolog; DNA-binding protein, ring protein, octamer, AAA ATPase; 3.20A {Homo sapiens} SCOP: c.37.1.11 PDB: 2zjb_A | Back alignment and structure |
|---|
| >1u94_A RECA protein, recombinase A; homologous recombination, ATPase, DNA repair, DNA binding protein; 1.90A {Escherichia coli} SCOP: c.37.1.11 d.48.1.1 PDB: 1u98_A 1u99_A 1xms_A* 1xmv_A* 2rec_A 2reb_A 1n03_A* 1rea_A 1aa3_A | Back alignment and structure |
|---|
| >3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A | Back alignment and structure |
|---|
| >2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} | Back alignment and structure |
|---|
| >1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* | Back alignment and structure |
|---|
| >2z43_A DNA repair and recombination protein RADA; archaea, filament, DNA binding, molecular SWI RECA, DMC1; HET: DNA; 1.93A {Sulfolobus solfataricus} PDB: 2bke_A* 2dfl_A* 2zub_A* 2zuc_A* 2zud_A* | Back alignment and structure |
|---|
| >2i1q_A DNA repair and recombination protein RADA; ATPase, recombinase, ATP complex, calcium stimulation, RECA, DMC1; HET: DNA ANP; 1.90A {Methanococcus voltae} SCOP: a.60.4.1 c.37.1.11 PDB: 1xu4_A* 2b21_A* 2fpk_A* 2fpl_A* 2fpm_A* 1t4g_A* 3fyh_A* 2f1j_A* 2f1i_A* 2f1h_A* 3ntu_A* 3ewa_A* 3ew9_A* 3etl_A* 4dc9_A* 2gdj_A* | Back alignment and structure |
|---|
| >3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A | Back alignment and structure |
|---|
| >3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* | Back alignment and structure |
|---|
| >1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6 | Back alignment and structure |
|---|
| >2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* | Back alignment and structure |
|---|
| >3lda_A DNA repair protein RAD51; DNA binding protein, ATP-binding, DNA damage, DNA recombinat repair, nucleotide-binding; HET: DNA; 2.50A {Saccharomyces cerevisiae} PDB: 1szp_A* | Back alignment and structure |
|---|
| >2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A* | Back alignment and structure |
|---|
| >3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >1j8m_F SRP54, signal recognition 54 kDa protein; signaling protein; 2.00A {Acidianus ambivalens} SCOP: a.24.13.1 c.37.1.10 PDB: 1j8y_F | Back alignment and structure |
|---|
| >1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 | Back alignment and structure |
|---|
| >3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} | Back alignment and structure |
|---|
| >2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 | Back alignment and structure |
|---|
| >1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* | Back alignment and structure |
|---|
| >3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* | Back alignment and structure |
|---|
| >1pzn_A RAD51, DNA repair and recombination protein RAD51, RADA; heptameric ring, heptamer, ring, oligomer, RAD51 polymerizat motif; HET: DNA; 2.85A {Pyrococcus furiosus} SCOP: a.60.4.1 c.37.1.11 | Back alignment and structure |
|---|
| >3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} | Back alignment and structure |
|---|
| >3bh0_A DNAB-like replicative helicase; ATPase, replication; 2.35A {Bacillus phage SPP1} | Back alignment and structure |
|---|
| >2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* | Back alignment and structure |
|---|
| >1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 | Back alignment and structure |
|---|
| >2xxa_A Signal recognition particle protein; protein transport, RNA/RNA binding protein, hydrolase, gtpas; HET: GCP; 3.94A {Escherichia coli} PDB: 2j28_9 | Back alignment and structure |
|---|
| >1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* | Back alignment and structure |
|---|
| >3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* | Back alignment and structure |
|---|
| >1g8p_A Magnesium-chelatase 38 kDa subunit; parallel beta sheet, P-loop, rossman fold, AAA+, photosynthesis, metal transport; 2.10A {Rhodobacter capsulatus} SCOP: c.37.1.20 PDB: 2x31_G | Back alignment and structure |
|---|
| >4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} | Back alignment and structure |
|---|
| >1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 | Back alignment and structure |
|---|
| >3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A* | Back alignment and structure |
|---|
| >3ice_A Transcription termination factor RHO; transcription, ATPase, hexamer, helicase, RNA, RECA, OB fold ATP-binding, hydrolase; HET: MSE ADP SPD; 2.80A {Escherichia coli k-12} PDB: 1pv4_A 1pvo_A* 1xpo_A* 1xpr_A* 1xpu_A* 2ht1_A | Back alignment and structure |
|---|
| >3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A | Back alignment and structure |
|---|
| >1ls1_A Signal recognition particle protein; FFH, SRP54, SRP, GTPase, ultrahigh resolution, protein transport; 1.10A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 1jpn_B* 1jpj_A* 1ry1_U* 2j45_A* 1o87_A* 2c04_A* 2j46_A* 1rj9_B* 2c03_A* 2j7p_A* 1okk_A* 2cnw_A* 1ng1_A* 2xkv_A 3ng1_A 1ffh_A 2ng1_A* | Back alignment and structure |
|---|
| >2hf9_A Probable hydrogenase nickel incorporation protein HYPB; alpha and beta protein; HET: GSP; 1.90A {Methanocaldococcus jannaschii} PDB: 2hf8_A* | Back alignment and structure |
|---|
| >3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* | Back alignment and structure |
|---|
| >2ck3_D ATP synthase subunit beta\, mitochondrial; hydrolase; HET: ANP ADP; 1.9A {Bos taurus} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1cow_D* 1bmf_D* 1e1q_D* 1e1r_D* 1efr_D* 1e79_D* 1h8h_D* 1ohh_D* 1qo1_D 1w0j_D* 1w0k_D* 1h8e_D* 2jdi_D* 2jiz_D* 2jj1_D* 2jj2_D* 2v7q_D* 2wss_D* 2w6j_D 2w6e_D ... | Back alignment and structure |
|---|
| >1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 | Back alignment and structure |
|---|
| >4a1f_A DNAB helicase, replicative DNA helicase; hydrolase, DNA replication, ATPase; HET: FLC; 2.50A {Helicobacter pylori} | Back alignment and structure |
|---|
| >1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >1odf_A YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser2 intergenic region; yeast protein, ATP binding protein; 2.25A {Saccharomyces cerevisiae} SCOP: c.37.1.6 | Back alignment and structure |
|---|
| >2b8t_A Thymidine kinase; deoxyribonucleoside kinase, zinc-binding domain, TK1, UU-TK, transferase; HET: THM; 2.00A {Ureaplasma parvum} SCOP: c.37.1.24 g.39.1.14 PDB: 2uz3_A* | Back alignment and structure |
|---|
| >2r44_A Uncharacterized protein; putative ATPase, structural genomics, joint center for struc genomics, JCSG; HET: MSE PG4; 2.00A {Cytophaga hutchinsonii atcc 33406} | Back alignment and structure |
|---|
| >3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} | Back alignment and structure |
|---|
| >2wsm_A Hydrogenase expression/formation protein (HYPB); metal binding protein; 2.30A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >1sky_E F1-ATPase, F1-ATP synthase; F1FO ATP synthase, alpha3BETA3 SUBC F1-ATPase, hydrolase; 3.20A {Bacillus SP} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 | Back alignment and structure |
|---|
| >3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} | Back alignment and structure |
|---|
| >2ga8_A Hypothetical 39.9 kDa protein; YFR007W, YFH7, unknown function; HET: CME; 1.77A {Saccharomyces cerevisiae} PDB: 2gaa_A* | Back alignment and structure |
|---|
| >1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A* | Back alignment and structure |
|---|
| >1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* | Back alignment and structure |
|---|
| >3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >1xjc_A MOBB protein homolog; structural genomics, midwest center for structural GEN PSI, protein structure initiative, MCSG; 2.10A {Geobacillus stearothermophilus} SCOP: c.37.1.10 | Back alignment and structure |
|---|
| >3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >3tqc_A Pantothenate kinase; biosynthesis of cofactors, prosthetic groups, carriers, TRAN; HET: ADP; 2.30A {Coxiella burnetii} | Back alignment and structure |
|---|
| >3nbx_X ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structure, rossman fold, hydro; HET: ADP; 2.91A {Escherichia coli} | Back alignment and structure |
|---|
| >2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} | Back alignment and structure |
|---|
| >1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11 | Back alignment and structure |
|---|
| >1ojl_A Transcriptional regulatory protein ZRAR; response regulator, two component system, AAA domain, NTRC family, DNA-binding; HET: ATP; 3.0A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} | Back alignment and structure |
|---|
| >2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 | Back alignment and structure |
|---|
| >1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A | Back alignment and structure |
|---|
| >2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >2ze6_A Isopentenyl transferase; crown GALL tumor, cytokinin biosynthesis; HET: DST AMP; 2.10A {Agrobacterium tumefaciens} PDB: 2ze5_A* 2ze7_A* 2ze8_A | Back alignment and structure |
|---|
| >3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A | Back alignment and structure |
|---|
| >1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* | Back alignment and structure |
|---|
| >1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 | Back alignment and structure |
|---|
| >1jr3_D DNA polymerase III, delta subunit; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1jqj_C* 1xxh_A* 1xxi_A* 3glf_A* 3glg_A* 3glh_A* 3gli_A* | Back alignment and structure |
|---|
| >1zuh_A Shikimate kinase; alpha-beta protein, transferase; 1.80A {Helicobacter pylori} PDB: 1zui_A* 3hr7_A 3muf_A* 3mrs_A 3n2e_A* | Back alignment and structure |
|---|
| >1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A | Back alignment and structure |
|---|
| >2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A | Back alignment and structure |
|---|
| >3hws_A ATP-dependent CLP protease ATP-binding subunit CL; CLPXP, AAA+ molecular machine, hexamer, asymmetric,, ATP-BIN chaperone, metal-binding; HET: ADP; 3.25A {Escherichia coli} PDB: 3hte_A | Back alignment and structure |
|---|
| >1fx0_B ATP synthase beta chain; latent ATPase, thermal stability, potential tentoxin binding hydrolase; 3.20A {Spinacia oleracea} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1kmh_B* | Back alignment and structure |
|---|
| >1uf9_A TT1252 protein; P-loop, nucleotide binding domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: ATP; 2.80A {Thermus thermophilus} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >2jaq_A Deoxyguanosine kinase; transferase, deoxyribonucleoside kinase; HET: DCP; 2.3A {Mycoplasma mycoides subsp} PDB: 2jat_A* 2jas_A* | Back alignment and structure |
|---|
| >1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >1via_A Shikimate kinase; structural genomics, transferase; HET: MSE; 1.57A {Campylobacter jejuni} SCOP: c.37.1.2 | Back alignment and structure |
|---|
| >2if2_A Dephospho-COA kinase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 3.00A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >1htw_A HI0065; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; HET: ADP; 1.70A {Haemophilus influenzae} SCOP: c.37.1.18 PDB: 1fl9_A | Back alignment and structure |
|---|
| >3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0 | Back alignment and structure |
|---|
| >3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A | Back alignment and structure |
|---|
| >4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A* | Back alignment and structure |
|---|
| >2f1r_A Molybdopterin-guanine dinucleotide biosynthesis protein B (MOBB); structural genomics, PSI, protein structure initiative; 2.10A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >1uj2_A Uridine-cytidine kinase 2; alpha/beta mononucleotide-binding HOLD, transferase; HET: C5P ADP; 1.80A {Homo sapiens} SCOP: c.37.1.6 PDB: 1uei_A* 1uej_A* 1udw_A 1ufq_A* 1xrj_A* | Back alignment and structure |
|---|
| >3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* | Back alignment and structure |
|---|
| >1cke_A CK, MSSA, protein (cytidine monophosphate kinase); nucleotide monophosphate kinase,, transferase; 1.75A {Escherichia coli} SCOP: c.37.1.1 PDB: 1kdo_A* 1kdp_A* 1kdr_A* 1kdt_A* 2cmk_A* 2fem_A 2feo_A* | Back alignment and structure |
|---|
| >1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A | Back alignment and structure |
|---|
| >3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* | Back alignment and structure |
|---|
| >2j37_W Signal recognition particle 54 kDa protein (SRP54); ribosome, SRP, translation/RNA; 8.00A {Canis SP} PDB: 1wgw_A | Back alignment and structure |
|---|
| >1um8_A ATP-dependent CLP protease ATP-binding subunit CL; CLPP binding loop, chaperone; HET: ADP; 2.60A {Helicobacter pylori} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national P protein structural and functional analyses; 2.10A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >1ex7_A Guanylate kinase; substrate-induced FIT, domain movement, GMP, ATP, substrate specificity, X-RAY diffraction, transferase; HET: 5GP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1ex6_A* 1gky_A* 3sqk_A 4f4j_A | Back alignment and structure |
|---|
| >2ffh_A Protein (FFH); SRP54, signal recognition particle, GTPase, M domain, RNA-binding, signal sequence-binding, helix-turn-helix, protein targeting; 3.20A {Thermus aquaticus} SCOP: a.24.13.1 a.36.1.1 c.37.1.10 PDB: 2iy3_A | Back alignment and structure |
|---|
| >1ukz_A Uridylate kinase; transferase; HET: ADP AMP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1uky_A* | Back alignment and structure |
|---|
| >2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A* | Back alignment and structure |
|---|
| >2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens} | Back alignment and structure |
|---|
| >2plr_A DTMP kinase, probable thymidylate kinase; TMP-binding, ATP-binding, structural GEN NPPSFA; HET: 1PE PGE EPE PG4; 1.60A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D* | Back alignment and structure |
|---|
| >3aez_A Pantothenate kinase; transferase, homodimer, COA biosynthesis, nucleotide binding binding, cytoplasm, nucleotide-binding; HET: GDP PAZ; 2.20A {Mycobacterium tuberculosis} PDB: 2ges_A* 2geu_A* 2gev_A* 2zs7_A* 2zs8_A* 2zs9_A* 2zsa_A* 2zsb_A* 2zsd_A* 2zse_A* 2zsf_A* 2get_A* 3af0_A* 3af1_A* 3af2_A* 3af3_A* 3af4_A* 3avp_A* 3avo_A* 3avq_A* | Back alignment and structure |
|---|
| >3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} | Back alignment and structure |
|---|
| >2iyv_A Shikimate kinase, SK; transferase, aromatic amino acid biosynthesis, P-loop kinase, metal- binding, shikimate pathway; HET: ADP; 1.35A {Mycobacterium tuberculosis} SCOP: c.37.1.2 PDB: 2iyr_A* 2iyq_A* 2iyt_A 2iyu_A* 2iys_A* 2iyw_A* 2iyx_A* 2iyy_A* 2iyz_A* 2g1k_A* 1l4y_A* 1u8a_A* 1we2_A* 1zyu_A* 2dfn_A* 2dft_A* 2g1j_A 1l4u_A* 3baf_A* | Back alignment and structure |
|---|
| >2jeo_A Uridine-cytidine kinase 1; UCK, transferase, ATP-binding, nucleoside kinase, nucleotide-binding; 2.50A {Homo sapiens} PDB: 2uvq_A* | Back alignment and structure |
|---|
| >2vli_A Antibiotic resistance protein; transferase, tunicamycin, phosphotransferase; 1.95A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >3a4m_A L-seryl-tRNA(SEC) kinase; P-loop motif, walker A motif, ATP binding motif, ATP- binding, nucleotide-binding, transferase; HET: ADP; 1.79A {Methanocaldococcus jannaschii} PDB: 3a4l_A* 3a4n_A 3am1_A* 3add_A* 3adc_A* 3adb_A* | Back alignment and structure |
|---|
| >3umf_A Adenylate kinase; rossmann fold, transferase; 2.05A {Schistosoma mansoni} | Back alignment and structure |
|---|
| >2r6a_A DNAB helicase, replicative helicase; replication, DNAB; 2.90A {Geobacillus stearothermophilus} PDB: 2r6c_A 2r6d_A 2r6e_A 2vyf_A 2vye_A | Back alignment and structure |
|---|
| >1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >1qf9_A UMP/CMP kinase, protein (uridylmonophosphate/cytidylmonophosphate kinase); nucleoside monophosphate kinase, NMP kinase; HET: ADP C5P; 1.70A {Dictyostelium discoideum} SCOP: c.37.1.1 PDB: 1uke_A* 2ukd_A* 3ukd_A* 4ukd_A* 5ukd_A* | Back alignment and structure |
|---|
| >1e6c_A Shikimate kinase; phosphoryl transfer, ADP, shikimate pathway, P-loop protein, transferase; 1.8A {Erwinia chrysanthemi} SCOP: c.37.1.2 PDB: 1shk_A 2shk_A* | Back alignment and structure |
|---|
| >3tlx_A Adenylate kinase 2; structural genomics, structural genomics consortium, SGC, RO fold, transferase, ATP binding, phosphorylation; HET: ADP ATP AMP; 2.75A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >2wwf_A Thymidilate kinase, putative; transferase, malaria; HET: TMP ADP; 1.89A {Plasmodium falciparum} PDB: 2wwg_A* 2wwh_A* 2wwi_A* | Back alignment and structure |
|---|
| >4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A | Back alignment and structure |
|---|
| >1jjv_A Dephospho-COA kinase; P-loop nucleotide-binding fold, structure 2 function project, S2F, structural genomics, transferase; HET: ATP; 2.00A {Haemophilus influenzae} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >1nn5_A Similar to deoxythymidylate kinase (thymidylate K; P-loop, D4TMP, transferase; HET: 2DT ANP; 1.50A {Homo sapiens} SCOP: c.37.1.1 PDB: 1e2e_A* 1e2d_A* 1e2g_A* 1e2q_A* 1e99_A* 1e9a_A* 1e9b_A* 1nmx_A* 1nmz_A* 1nn0_A* 1nn1_A* 1e2f_A* 1nn3_A* 2xx3_A* 1e9c_A* 1e9d_A* 1e9e_A* 1e98_A* 1nmy_A* 1e9f_A* | Back alignment and structure |
|---|
| >1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A* | Back alignment and structure |
|---|
| >2cdn_A Adenylate kinase; phosphoryl transfer, associative mechanism, ATP-binding, nucleotide biosynthesis, nucleotide-binding, transferase; HET: ADP; 1.9A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1p4s_A | Back alignment and structure |
|---|
| >2grj_A Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosphocoenzyme kinase, structural genomics, joint center for structural GE JCSG; HET: ADP COD; 2.60A {Thermotoga maritima} | Back alignment and structure |
|---|
| >4e22_A Cytidylate kinase; P-loop, CMP/ATP binding, transferase; 2.32A {Yersinia pseudotuberculosis} | Back alignment and structure |
|---|
| >1aky_A Adenylate kinase; ATP:AMP phosphotransferase, myokinase, transferase (phosphotransferase); HET: AP5; 1.63A {Saccharomyces cerevisiae} SCOP: c.37.1.1 g.41.2.1 PDB: 2aky_A* 3aky_A* 1dvr_A* | Back alignment and structure |
|---|
| >2pt5_A Shikimate kinase, SK; aromatic amino acid biosynthesis, P-loop kinase, SHI kinase, shikimate pathway; 2.10A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >3fwy_A Light-independent protochlorophyllide reductase I ATP-binding protein; BCHL, electron donor, DPOR, Fe protein, nitrogenase; HET: ADP; 1.63A {Rhodobacter sphaeroides 2} | Back alignment and structure |
|---|
| >2i3b_A HCR-ntpase, human cancer-related ntpase; AAA, rossmann, hydrolase; NMR {Homo sapiens} SCOP: c.37.1.11 | Back alignment and structure |
|---|
| >2pbr_A DTMP kinase, thymidylate kinase; transferase, nucleotide biosynthesis, TMP-binding, A binding, structural genomics, NPPSFA; 1.96A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >2q6t_A DNAB replication FORK helicase; hydrolase; 2.90A {Thermus aquaticus} | Back alignment and structure |
|---|
| >3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1zd8_A GTP:AMP phosphotransferase mitochondrial; ATP:AMP phosphotransferase, myokinase, structural genomics, structural genomics consortium, SGC; 1.48A {Homo sapiens} PDB: 2ak3_A* | Back alignment and structure |
|---|
| >2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >2onk_A Molybdate/tungstate ABC transporter, ATP-binding protein; membrane protein; 3.10A {Archaeoglobus fulgidus} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >1gtv_A TMK, thymidylate kinase; transferase, transferase (ATP:TMP phosphotransferase); HET: TYD TMP; 1.55A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1g3u_A* 1gsi_A* 1mrn_A* 1mrs_A* 1n5i_A* 1n5j_A* 1n5k_A* 1n5l_A* 1w2g_A* 1w2h_A* | Back alignment and structure |
|---|
| >1g5t_A COB(I)alamin adenosyltransferase; P-loop protein, cobalamin biosynthesis, RECA fold; HET: ATP; 1.80A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1g5r_A* 1g64_A* | Back alignment and structure |
|---|
| >3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A | Back alignment and structure |
|---|
| >1sq5_A Pantothenate kinase; P-loop, transferase; HET: PAU ADP; 2.20A {Escherichia coli} SCOP: c.37.1.6 PDB: 1esm_A* 1esn_A* | Back alignment and structure |
|---|
| >1np6_A Molybdopterin-guanine dinucleotide biosynthesis protein B; mixed alpha-beta fold, elongated beta-sheet, walker A motif, P-loop structural motif; 1.90A {Escherichia coli} SCOP: c.37.1.10 PDB: 1p9n_A | Back alignment and structure |
|---|
| >1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A* | Back alignment and structure |
|---|
| >3fb4_A Adenylate kinase; psychrophIle, phosphotransferase, ATP-binding, nucleotide-binding, transferase; HET: AP5; 2.00A {Marinibacillus marinus} | Back alignment and structure |
|---|
| >3bgw_A DNAB-like replicative helicase; ATPase, replication; 3.91A {Bacillus phage SPP1} | Back alignment and structure |
|---|
| >1zak_A Adenylate kinase; ATP:AMP-phosphotransferase, transferase; HET: AP5; 3.50A {Zea mays} SCOP: c.37.1.1 g.41.2.1 | Back alignment and structure |
|---|
| >2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A | Back alignment and structure |
|---|
| >3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* | Back alignment and structure |
|---|
| >2pez_A Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthetase 1 (PAPS synthetase...; NMP-kinase fold, protein in complex with nucleic acid; HET: GGZ DAT; 1.40A {Homo sapiens} PDB: 2pey_A* 2ax4_A* | Back alignment and structure |
|---|
| >2v54_A DTMP kinase, thymidylate kinase; nucleotide biosynthesis, ATP-binding, nucleotide-binding, poxvirus, transferase; HET: TYD POP; 2.4A {Vaccinia virus copenhagen} PDB: 2w0s_A* | Back alignment and structure |
|---|
| >2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A | Back alignment and structure |
|---|
| >2zts_A Putative uncharacterized protein PH0186; KAIC like protein, ATP-binding, nucleotide-binding, ATP- binding protein; HET: ADP; 2.07A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >1zu4_A FTSY; GTPase, signal recognition particle, SRP, receptor, protein transport; 1.95A {Mycoplasma mycoides} PDB: 1zu5_A | Back alignment and structure |
|---|
| >1g41_A Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dependent proteolysis, chaperone; HET: ADP; 2.30A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1g3i_A* 1im2_A* 1kyi_A* 1g4a_E* 1g4b_E 1yyf_A* 1do0_A* 1do2_A* 1e94_E* 1hqy_E* 1ht1_E* 1ht2_E* | Back alignment and structure |
|---|
| >1m7g_A Adenylylsulfate kinase; APS kinase, transferase, sulfate Met nucleotide 2 kinase; HET: AV2 ADX ADP; 1.43A {Penicillium chrysogenum} SCOP: c.37.1.4 PDB: 1d6j_A* 1m7h_A* 3cr7_A* | Back alignment and structure |
|---|
| >3b85_A Phosphate starvation-inducible protein; PHOH2, ATPase, PFAM: PF02562, ST genomics, PSI-2, protein structure initiative; 2.35A {Corynebacterium glutamicum atcc 13032} | Back alignment and structure |
|---|
| >3dl0_A Adenylate kinase; phosphotransferase, zinc coordination, ATP-binding, binding, nucleotide biosynthesis, nucleotide-binding, trans; HET: AP5; 1.58A {Bacillus subtilis} PDB: 1p3j_A* 2ori_A* 2eu8_A* 2oo7_A* 2p3s_A* 2qaj_A* 2osb_A* 3dkv_A* 1zin_A* 1zio_A* 1zip_A* 1s3g_A* | Back alignment and structure |
|---|
| >3lnc_A Guanylate kinase, GMP kinase; ALS collaborative crystallography, emerald biostructures, ATP-binding, cytoplasm, nucleotide-binding; HET: 5GP; 1.95A {Anaplasma phagocytophilum} | Back alignment and structure |
|---|
| >1q57_A DNA primase/helicase; dntpase, DNA replication, transferase; HET: DNA; 3.45A {Enterobacteria phage T7} SCOP: c.37.1.11 e.13.1.2 | Back alignment and structure |
|---|
| >2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3k1j_A LON protease, ATP-dependent protease LON; ATP-binding, nucleotide-binding, Pro hydrolase; HET: ADP PE8; 2.00A {Thermococcus onnurineus} | Back alignment and structure |
|---|
| >1vht_A Dephospho-COA kinase; structural genomics, transferase; HET: BA3; 1.59A {Escherichia coli} SCOP: c.37.1.1 PDB: 1vhl_A* 1viy_A 1t3h_A 1n3b_A | Back alignment and structure |
|---|
| >3nwj_A ATSK2; P loop, shikimate, nucleoside monophosphate kinase, shikimat ATP binding, chloroplast, transferase; 2.35A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} | Back alignment and structure |
|---|
| >1tue_A Replication protein E1; helicase, replication, E1E2 complex, AAA+ protein; 2.10A {Human papillomavirus type 18} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >2d2e_A SUFC protein; ABC-ATPase, SUF protein, 310-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics, binding; 1.70A {Thermus thermophilus} PDB: 2d2f_A* | Back alignment and structure |
|---|
| >3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} | Back alignment and structure |
|---|
| >3p32_A Probable GTPase RV1496/MT1543; structural genomics, seattle structural genomics center for infectious disease, ssgcid, MEAB, MMAA; HET: GDP PGE; 1.90A {Mycobacterium tuberculosis} PDB: 3md0_A* 4gt1_A* 3nxs_A* 3tk1_A* | Back alignment and structure |
|---|
| >2f6r_A COA synthase, bifunctional coenzyme A synthase; 18044849, bifunctional coenzyme A synthase (COA synthase), S genomics; HET: ACO UNL; 1.70A {Mus musculus} | Back alignment and structure |
|---|
| >3r20_A Cytidylate kinase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, ADP, DCMP, D transferase; 2.00A {Mycobacterium smegmatis} SCOP: c.37.1.0 PDB: 3r8c_A 4die_A* | Back alignment and structure |
|---|
| >3ake_A Cytidylate kinase; CMP kinase, CMP complex, open conformation, nucleotide metab transferase; HET: C5P; 1.50A {Thermus thermophilus} PDB: 3akc_A* 3akd_A* | Back alignment and structure |
|---|
| >1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J* | Back alignment and structure |
|---|
| >1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A* | Back alignment and structure |
|---|
| >2zu0_C Probable ATP-dependent transporter SUFC; iron-sulfur cluster, ABC-ATPase, ATP-binding, cytoplasm, nucleotide-binding; HET: MES; 2.20A {Escherichia coli} PDB: 2d3w_A | Back alignment and structure |
|---|
| >3d3q_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2; 2.70A {Staphylococcus epidermidis atcc 12228} | Back alignment and structure |
|---|
| >4g1u_C Hemin import ATP-binding protein HMUV; membrane transporter, type II ABC importer, HMUT, plasma MEM transport protein-hydrolase complex; 3.01A {Yersinia pestis} | Back alignment and structure |
|---|
| >2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A | Back alignment and structure |
|---|
| >1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >3upu_A ATP-dependent DNA helicase DDA; RECA-like domain, SH3 domain, PIN-tower interface, coupling hydrolysis to DNA unwinding, ssDNA; 3.30A {Enterobacteria phage T4} | Back alignment and structure |
|---|
| >2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* | Back alignment and structure |
|---|
| >1e4v_A Adenylate kinase; transferase(phosphotransferase); HET: AP5; 1.85A {Escherichia coli} SCOP: c.37.1.1 g.41.2.1 PDB: 1e4y_A* 1ake_A* 1ank_A* 2eck_A* 3hpq_A* 4ake_A 3hpr_A* | Back alignment and structure |
|---|
| >3be4_A Adenylate kinase; malaria, cryptosporidium parvum nonprotein inhibitors, nucleotide-binding, transferase; HET: AP5; 1.60A {Cryptosporidium parvum iowa II} | Back alignment and structure |
|---|
| >2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} | Back alignment and structure |
|---|
| >2xb4_A Adenylate kinase; ATP-binding, nucleotide-binding, transferase; HET: SRT; 1.80A {Desulfovibrio gigas} PDB: 3l0s_A* 3l0p_A* | Back alignment and structure |
|---|
| >2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C | Back alignment and structure |
|---|
| >3sr0_A Adenylate kinase; phosphoryl transfer analogue, ALF4, transferase (phosphotran phosphoryl transfer, nucleotide-binding; HET: ADP AMP; 1.56A {Aquifex aeolicus} PDB: 2rh5_A 2rgx_A* | Back alignment and structure |
|---|
| >1ak2_A Adenylate kinase isoenzyme-2; nucleoside monophosphate kinase, phosphotransferase; 1.92A {Bos taurus} SCOP: c.37.1.1 g.41.2.1 PDB: 2ak2_A 2c9y_A* | Back alignment and structure |
|---|
| >3crm_A TRNA delta(2)-isopentenylpyrophosphate transferase; ATP-binding, nucleotide-binding, nucleotidyltransferase, tRNA processing; 1.90A {Pseudomonas aeruginosa} PDB: 3crq_A 3crr_A | Back alignment and structure |
|---|
| >3exa_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.30A {Bacillus halodurans} PDB: 2qgn_A | Back alignment and structure |
|---|
| >2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* | Back alignment and structure |
|---|
| >1oix_A RAS-related protein RAB-11A; small G protein, intracellular trafficking, GTP-binding, lipoprotein, prenylation, protein transport; HET: GDP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1oiw_A* 1oiv_A* 3rwo_B* 3rwm_B* | Back alignment and structure |
|---|
| >2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima} | Back alignment and structure |
|---|
| >2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >3vr4_D V-type sodium ATPase subunit D; V-ATPase, rotary motor, P-loop, hydrolas ATPase, ATP binding; HET: MSE B3P; 2.17A {Enterococcus hirae} PDB: 3vr3_D* 3vr2_D* 3vr5_D 3vr6_D* | Back alignment and structure |
|---|
| >2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} | Back alignment and structure |
|---|
| >1a7j_A Phosphoribulokinase; transferase, calvin cycle; 2.50A {Rhodobacter sphaeroides} SCOP: c.37.1.6 | Back alignment and structure |
|---|
| >2v9p_A Replication protein E1; AAA+ molecular motor, DNA replication, DNA translocation, nucleotide-binding, DNA-binding; 3.00A {Bovine papillomavirus type 1} PDB: 2gxa_A* | Back alignment and structure |
|---|
| >3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* | Back alignment and structure |
|---|
| >3a8t_A Adenylate isopentenyltransferase; rossmann fold protein; HET: ATP; 2.37A {Humulus lupulus} | Back alignment and structure |
|---|
| >3sop_A Neuronal-specific septin-3; hydrolase; HET: GDP; 2.88A {Homo sapiens} | Back alignment and structure |
|---|
| >3foz_A TRNA delta(2)-isopentenylpyrophosphate transferas; nucleoside modification, isopentenyl-tRNA transferase, transferase-RNA complex; 2.50A {Escherichia coli k-12} PDB: 2zxu_A* 2zm5_A | Back alignment and structure |
|---|
| >1yrb_A ATP(GTP)binding protein; GTPase, P-loop, rossman fold, GDP, HYDR; HET: GDP; 1.75A {Pyrococcus abyssi} SCOP: c.37.1.10 PDB: 1yr6_A* 1yr8_A* 1yr9_A* 1yra_A* 1yr7_A* 2oxr_A* | Back alignment and structure |
|---|
| >4eaq_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, MTBI, transferase; HET: ATM; 1.85A {Staphylococcus aureus subsp} PDB: 4dwj_A* 4f4i_A | Back alignment and structure |
|---|
| >3cr8_A Sulfate adenylyltranferase, adenylylsulfate kinase; APS kinase, transferase, sulfate metabolism, nucleotide 2 kinase; 2.95A {Thiobacillus denitrificans} | Back alignment and structure |
|---|
| >2f9l_A RAB11B, member RAS oncogene family; RAB11B GTPase, vesicle transport, hydrolase; HET: GDP; 1.55A {Homo sapiens} SCOP: c.37.1.8 PDB: 2f9m_A* 1yzk_A* 2hv8_A* 2gzd_A* 2gzh_A* 2d7c_A* 3bfk_A* | Back alignment and structure |
|---|
| >1g8f_A Sulfate adenylyltransferase; alpha-beta protein, beta-barrel, rossmann-fold, kinase fold; 1.95A {Saccharomyces cerevisiae} SCOP: b.122.1.3 c.26.1.5 c.37.1.15 PDB: 1g8g_A* 1g8h_A* 1j70_A 1jec_A 1jed_A* 1jee_A* | Back alignment and structure |
|---|
| >2pjz_A Hypothetical protein ST1066; ATP binding protein, structural genomics, NPPSFA; 1.90A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >3kta_A Chromosome segregation protein SMC; structural maintenance of chromosomes, ABC ATPase, CFTR adenylate kinase, AP5A, transferase; HET: AP5; 1.63A {Pyrococcus furiosus} PDB: 1xex_A* 1xew_X* | Back alignment and structure |
|---|
| >1ltq_A Polynucleotide kinase; phosphatase, alpha/beta, P-loop, transferase; HET: ADP; 2.33A {Enterobacteria phage T4} SCOP: c.108.1.9 c.37.1.1 PDB: 1rc8_A* 1rpz_A* 1rrc_A* 2ia5_A | Back alignment and structure |
|---|
| >1q3t_A Cytidylate kinase; nucleotide monophosphate kinase, CMP kinase, transferase; NMR {Streptococcus pneumoniae} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >3lv8_A DTMP kinase, thymidylate kinase; structural genomics, in diseases, center for structural genomics of infectious DISE ATP-binding; HET: ADP TMP TYD; 1.80A {Vibrio cholerae o1 biovar eltor} PDB: 3n2i_A* | Back alignment and structure |
|---|
| >2wji_A Ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GNP; 1.90A {Methanocaldococcus jannaschii} PDB: 2wjj_A* 2wjh_A* | Back alignment and structure |
|---|
| >2bbs_A Cystic fibrosis transmembrane conductance regulator; ATP binding cassette, transport protein; HET: ATP; 2.05A {Homo sapiens} PDB: 2bbt_A* 1xmi_A* 1xmj_A* 2bbo_A* 3si7_A* 1r0w_A 1q3h_A 1r0x_A* 1r0y_A* 1r0z_A* 1r10_A* 1xf9_A* 1xfa_A* | Back alignment and structure |
|---|
| >1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A | Back alignment and structure |
|---|
| >4f4c_A Multidrug resistance protein PGP-1; ABC transporter, ATPase, multi-drug transporter, exporter, A binding, hydrolase,protein transport; HET: NDG NAG BMA MAN 0SA; 3.40A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >2dyk_A GTP-binding protein; GTPase, ribosome-binding protein, structural genomics; HET: GDP; 1.96A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2ocp_A DGK, deoxyguanosine kinase; protein-nucleotide complex, transferase; HET: DTP; 2.80A {Homo sapiens} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >3io3_A DEHA2D07832P; chaperone, membrane traffic, ATPase; HET: ADP; 1.80A {Debaryomyces hansenii} | Back alignment and structure |
|---|
| >3hjn_A DTMP kinase, thymidylate kinase; ATP-binding, nucleotide biosynth nucleotide-binding, transferase, structural genomics; HET: ADP TYD; 2.10A {Thermotoga maritima} | Back alignment and structure |
|---|
| >1tq4_A IIGP1, interferon-inducible GTPase; interferon gamma, dimer, immunology, signaling protein; HET: GDP; 1.95A {Mus musculus} SCOP: c.37.1.8 PDB: 1tqd_A* 1tq6_A* 1tpz_A* 1tq2_A* | Back alignment and structure |
|---|
| >1cp2_A CP2, nitrogenase iron protein; oxidoreductase; 1.93A {Clostridium pasteurianum} SCOP: c.37.1.10 | Back alignment and structure |
|---|
| >2afh_E Nitrogenase iron protein 1; nitrogen fixation, iron-sulfur, metal-binding, molybdenum, oxidoreductase; HET: HCA CFN CLF PGE PG4 P6G 1PE; 2.10A {Azotobacter vinelandii} SCOP: c.37.1.10 PDB: 1g1m_A 1g5p_A 1m1y_E* 1m34_E* 1n2c_E* 1nip_A* 1fp6_A* 2afi_E* 2afk_E* 2nip_A 1de0_A 1xcp_A* 1xdb_A 1xd8_A 1xd9_A* 1g20_E* 1g21_E* 2c8v_A* 1rw4_A | Back alignment and structure |
|---|
| >3fvq_A Fe(3+) IONS import ATP-binding protein FBPC; nucleotide binding domain, ABC motor domain, ferric iron TRA ATP-binding, cell inner membrane; HET: ATP; 1.90A {Neisseria gonorrhoeae} | Back alignment and structure |
|---|
| >2vp4_A Deoxynucleoside kinase; ATP-binding, DNA synthesis, phosphoprotein, feedback inhibition, deoxyribonucleoside kinase, salvage pathway; HET: DCP; 2.20A {Drosophila melanogaster} SCOP: c.37.1.1 PDB: 1j90_A* 2jj8_A* 2vp2_A* 1oe0_A* 2vp5_A* 2vp6_A* 2vp9_A* 2vpp_A* 2vqs_A* 2vp0_A* 1ot3_A* 2jcs_A* 1zm7_A* 1zmx_A* | Back alignment and structure |
|---|
| >3ux8_A Excinuclease ABC, A subunit; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, DN binding protein; HET: ADP; 2.10A {Geobacillus} | Back alignment and structure |
|---|
| >4tmk_A Protein (thymidylate kinase); ATP:DTMP phosphotransferase, transferase; HET: T5A; 1.98A {Escherichia coli} SCOP: c.37.1.1 PDB: 5tmp_A* | Back alignment and structure |
|---|
| >2zej_A Dardarin, leucine-rich repeat kinase 2; parkinson'S disease, LRRK2, ROC, GTPase, ROCO, ATP-B disease mutation, GTP-binding, GTPase activation; HET: GDP; 2.00A {Homo sapiens} PDB: 3d6t_B* | Back alignment and structure |
|---|
| >1nij_A Hypothetical protein YJIA; structural genomics, P-loop protein, GTP binding, structure function project, S2F, unknown function; 2.00A {Escherichia coli} SCOP: c.37.1.10 d.237.1.1 | Back alignment and structure |
|---|
| >1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* | Back alignment and structure |
|---|
| >1svm_A Large T antigen; AAA+ fold, viral protein; HET: ATP; 1.94A {Simian virus 40} SCOP: c.37.1.20 PDB: 1svl_A* 1svo_A 1n25_A 2h1l_A | Back alignment and structure |
|---|
| >3tui_C Methionine import ATP-binding protein METN; ABC-transporter, type I ABC type importer, methionine uptake transporter, membrane protein; HET: ADP; 2.90A {Escherichia coli} PDB: 3tuj_C 3tuz_C* 3dhw_C | Back alignment and structure |
|---|
| >2r8r_A Sensor protein; KDPD, PFAM02702, MCSG, structural genomics, protein structure initiative, midwest center for structural genomics, kinase; 2.30A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >1p9r_A General secretion pathway protein E; bacterial type II secretion system cytoplasmic protein - GSPE, putative ATPase/ ATP binding protein; 2.50A {Vibrio cholerae} SCOP: c.37.1.11 PDB: 1p9w_A* | Back alignment and structure |
|---|
| >2v3c_C SRP54, signal recognition 54 kDa protein; nucleotide-binding, signal recognition particle, GTP-binding, RNA-binding; 2.50A {Methanocaldococcus jannaschii} PDB: 3ndb_B | Back alignment and structure |
|---|
| >3iqw_A Tail-anchored protein targeting factor GET3; ATPase, Zn binding, protein transport; HET: ANP; 3.00A {Chaetomium thermophilum} PDB: 3iqx_A* 3ibg_A* | Back alignment and structure |
|---|
| >3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A* | Back alignment and structure |
|---|
| >2ce2_X GTPase HRAS; signaling protein, guanine nucleotide binding protein, fluor membrane, lipoprotein, palmitate, prenylation; HET: GDP XY2; 1.0A {Homo sapiens} PDB: 2cl0_X* 2cl6_X* 2cl7_X* 2clc_X* 2evw_X* 2cld_X* 1aa9_A* 1ioz_A* 1q21_A* 6q21_A* 3k9l_A* 3k9n_A* 1ctq_A* 1bkd_R 1crp_A* 1crq_A* 1crr_A* 121p_A* 1gnp_A* 1gnq_A* ... | Back alignment and structure |
|---|
| >3eph_A TRNA isopentenyltransferase; transferase, alternative initiation, ATP-binding, cytoplasm, mitochondrion, nucleotide-binding, nucleus; 2.95A {Saccharomyces cerevisiae} PDB: 3epj_A 3epk_A* 3epl_A* | Back alignment and structure |
|---|
| >3zvl_A Bifunctional polynucleotide phosphatase/kinase; hydrolase-transferase complex, base excision repair, BER, non-homologous END-joining, NHEJ; 1.65A {Mus musculus} PDB: 3zvm_A* 3zvn_A* 1yj5_A 3u7e_B* 3u7f_B* 3u7h_B* 3u7g_A* | Back alignment and structure |
|---|
| >3gqb_B V-type ATP synthase beta chain; A3B3, V-ATPase, ATP synthesis, ATP-binding, hydrogen ION TRA hydrolase, ION transport; 2.80A {Thermus thermophilus HB8} PDB: 3a5c_D* 3a5d_D 3j0j_D* | Back alignment and structure |
|---|
| >3mfy_A V-type ATP synthase alpha chain; A-type ATP synthase, P loop, phenylalanine mutant, hydrolase; 2.35A {Pyrococcus horikoshii} PDB: 3i4l_A* 3i72_A 3i73_A* 3p20_A 3ikj_A 3qg1_A 3nd8_A 3nd9_A 1vdz_A 3qia_A 3qjy_A 3m4y_A 3se0_A 3sdz_A | Back alignment and structure |
|---|
| >1z47_A CYSA, putative ABC-transporter ATP-binding protein; alpha/beta motif, beta sandwich, ligand binding protein; 1.90A {Alicyclobacillus acidocaldarius} | Back alignment and structure |
|---|
| >3ld9_A DTMP kinase, thymidylate kinase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ehrlich chaffeensis; 2.15A {Ehrlichia chaffeensis} | Back alignment and structure |
|---|
| >3fkq_A NTRC-like two-domain protein; RER070207001320, structural GE joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: ATP 2PE; 2.10A {Eubacterium rectale} | Back alignment and structure |
|---|
| >2c61_A A-type ATP synthase non-catalytic subunit B; hydrolase, H+ ATPase, A1AO, ATP synthesis, hydrogen ION transport, ION transport; 1.5A {Methanosarcina mazei GO1} PDB: 3dsr_A* 3b2q_A* 2rkw_A* 3eiu_A* | Back alignment and structure |
|---|
| >4edh_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology; HET: TMP ADP; 1.32A {Pseudomonas aeruginosa PAO1} PDB: 4e5u_A* 4esh_A* 4gmd_A* 3uwk_A* 3uwo_A* 3uxm_A* | Back alignment and structure |
|---|
| >1z2a_A RAS-related protein RAB-23; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 1.90A {Mus musculus} SCOP: c.37.1.8 PDB: 1z22_A* | Back alignment and structure |
|---|
| >2www_A Methylmalonic aciduria type A protein, mitochondrial; transport protein, nucleotide-binding; HET: GDP 2PE; 2.64A {Homo sapiens} | Back alignment and structure |
|---|
| >2qm8_A GTPase/ATPase; G protein, G3E, metallochaperone, chaperone; HET: MSE; 1.70A {Methylobacterium extorquens} SCOP: c.37.1.10 PDB: 2qm7_A* | Back alignment and structure |
|---|
| >2qmh_A HPR kinase/phosphorylase; V267F mutation, ATP-binding, carbohydrate metabolism, magnesium, metal-binding, multifunctional enzyme; 2.60A {Lactobacillus casei} PDB: 1jb1_A 1kkl_A 1kkm_A* | Back alignment and structure |
|---|
| >2yyz_A Sugar ABC transporter, ATP-binding protein; sugar transport, alpha and beta proteins (A/B) TM0421, structural genomics, NPPSFA; 2.11A {Thermotoga maritima} | Back alignment and structure |
|---|
| >2wjg_A FEOB, ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GDP; 2.20A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >3rlf_A Maltose/maltodextrin import ATP-binding protein M; integral membrane protein, ATPase, ABC transporter, membrane transmembrane; HET: UMQ MAL PGV ANP; 2.20A {Escherichia coli} PDB: 1q1e_A 1q12_A* 2awo_A* 3fh6_A 3puv_A* 3puw_A* 3pux_A* 3puy_A* 3puz_A* 3pv0_A* 2awn_A* 2r6g_A* 1q1b_A | Back alignment and structure |
|---|
| >2it1_A 362AA long hypothetical maltose/maltodextrin transport ATP-binding protein; structural genomics, NPPSFA; 1.94A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >4gzl_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTP binding, membrane, hydrolase; HET: GNP; 2.00A {Homo sapiens} PDB: 3th5_A* 4gzm_A* | Back alignment and structure |
|---|
| >2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A* | Back alignment and structure |
|---|
| >1zj6_A ADP-ribosylation factor-like protein 5; ARL, GTP-binding, transport protein; HET: G3D; 2.00A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >3con_A GTPase NRAS; structural genomics consortium, SGC, GDP, oncogene, disease mutation, golgi apparatus, GTP-binding, lipoprotein membrane, methylation; HET: GDP; 1.65A {Homo sapiens} PDB: 2pmx_A* 3gft_A* 4q21_A* | Back alignment and structure |
|---|
| >2gj8_A MNME, tRNA modification GTPase TRME; G-domain dimer, alpha-beta-sandwich, hydrolase; HET: GDP; 1.70A {Escherichia coli BL21} SCOP: c.37.1.8 PDB: 2gj9_A* 2gja_A* 1rfl_A | Back alignment and structure |
|---|
| >2ged_A SR-beta, signal recognition particle receptor beta subunit; protein transport, G protein, proline isomerization, circular permutation; 2.20A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1g29_1 MALK, maltose transport protein MALK; ATPase, active transport, maltose uptake and regulation, sugar binding protein; 1.90A {Thermococcus litoralis} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 2d62_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 693 | ||||
| d2a5yb3 | 277 | c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenor | 4e-13 | |
| d1okkd2 | 207 | c.37.1.10 (D:97-303) GTPase domain of the signal r | 0.004 |
| >d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Length = 277 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: Extended AAA-ATPase domain domain: CED-4, NB-ARC domain species: Caenorhabditis elegans [TaxId: 6239]
Score = 67.9 bits (165), Expect = 4e-13
Identities = 19/182 (10%), Positives = 51/182 (28%), Gaps = 25/182 (13%)
Query: 161 DSRMKVFQDVMEALKDDKLNIIGVYGMGGVGKTTLVKQVA--KKVMEDKLIDKVVMAEVT 218
+ + ++ + D + ++G G GK+ + Q + D +V + +
Sbjct: 26 EYHVDRVIKKLDEMCDLDSFFLFLHGRAGSGKSVIASQALSKSDQLIGINYDSIVWLKDS 85
Query: 219 QNPDPQKIQDKLA---------SDLGMKFDLNDSIHHRASRLRERLKQEKRVLIILDNIW 269
L + + + L L + D++
Sbjct: 86 GTAPKSTFDLFTDILLMLKSEDDLLNFPSVEHVTSVVLKRMICNALIDRPNTLFVFDDVV 145
Query: 270 TKLELDAVGIPSGDVDEKDREDDQRRCTIILTSRSRDLLCIDMNSQKIFWIDALSKEEAL 329
+ E R + R ++T+R ++ + + + +L +E
Sbjct: 146 QE--------------ETIRWAQELRLRCLVTTRDVEISNAASQTCEFIEVTSLEIDECY 191
Query: 330 HL 331
Sbjct: 192 DF 193
|
| >d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Length = 207 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 693 | |||
| d2a5yb3 | 277 | CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI | 100.0 | |
| d2fnaa2 | 283 | Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ | 98.87 | |
| d1sxjb2 | 224 | Replication factor C4 {Baker's yeast (Saccharomyce | 98.83 | |
| d1sxjc2 | 227 | Replication factor C3 {Baker's yeast (Saccharomyce | 98.82 | |
| d1iqpa2 | 231 | Replication factor C {Archaeon Pyrococcus furiosus | 98.76 | |
| d2omxa2 | 199 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 98.76 | |
| d1h6ua2 | 227 | Internalin H {Listeria monocytogenes [TaxId: 1639] | 98.72 | |
| d1p9ag_ | 266 | von Willebrand factor binding domain of glycoprote | 98.71 | |
| d1njfa_ | 239 | delta prime subunit of DNA polymerase III, N-domai | 98.66 | |
| d1r6bx2 | 268 | ClpA, an Hsp100 chaperone, AAA+ modules {Escherich | 98.64 | |
| d1h6ta2 | 210 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 98.63 | |
| d1sxjd2 | 237 | Replication factor C2 {Baker's yeast (Saccharomyce | 98.62 | |
| d2astb2 | 284 | Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa | 98.61 | |
| d1p9ag_ | 266 | von Willebrand factor binding domain of glycoprote | 98.55 | |
| d1h6ta2 | 210 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 98.53 | |
| d1fnna2 | 276 | CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T | 98.52 | |
| d1w8aa_ | 192 | Slit {Fruit fly (Drosophila melanogaster) [TaxId: | 98.48 | |
| d2omxa2 | 199 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 98.46 | |
| d1xkua_ | 305 | Decorin {Cow (Bos taurus) [TaxId: 9913]} | 98.46 | |
| d1sxje2 | 252 | Replication factor C5 {Baker's yeast (Saccharomyce | 98.4 | |
| d1jbka_ | 195 | ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} | 98.39 | |
| d1ozna_ | 284 | Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma | 98.37 | |
| d2omza2 | 384 | Internalin A {Listeria monocytogenes [TaxId: 1639] | 98.37 | |
| d1w5sa2 | 287 | CDC6-like protein APE0152, N-terminal domain {Aero | 98.36 | |
| d1a9na_ | 162 | Splicesomal U2A' protein {Human (Homo sapiens) [Ta | 98.35 | |
| d1a9na_ | 162 | Splicesomal U2A' protein {Human (Homo sapiens) [Ta | 98.35 | |
| d1sxja2 | 253 | Replication factor C1 {Baker's yeast (Saccharomyce | 98.33 | |
| d2astb2 | 284 | Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa | 98.29 | |
| d1jl5a_ | 353 | Leucine rich effector protein YopM {Yersinia pesti | 98.29 | |
| d1a5ta2 | 207 | delta prime subunit of DNA polymerase III, N-domai | 98.28 | |
| d1xkua_ | 305 | Decorin {Cow (Bos taurus) [TaxId: 9913]} | 98.28 | |
| d1lv7a_ | 256 | AAA domain of cell division protein FtsH {Escheric | 98.27 | |
| d1h6ua2 | 227 | Internalin H {Listeria monocytogenes [TaxId: 1639] | 98.26 | |
| d1ixsb2 | 239 | Holliday junction helicase RuvB {Thermus thermophi | 98.25 | |
| d1in4a2 | 238 | Holliday junction helicase RuvB {Thermotoga mariti | 98.25 | |
| d1qvra2 | 387 | ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 | 98.24 | |
| d1ixza_ | 247 | AAA domain of cell division protein FtsH {Thermus | 98.22 | |
| d1ogqa_ | 313 | Polygalacturonase inhibiting protein PGIP {Kidney | 98.2 | |
| d1dcea3 | 124 | Rab geranylgeranyltransferase alpha-subunit, C-ter | 98.17 | |
| d2ifga3 | 156 | High affinity nerve growth factor receptor, N-term | 98.17 | |
| d1w8aa_ | 192 | Slit {Fruit fly (Drosophila melanogaster) [TaxId: | 98.15 | |
| d1ogqa_ | 313 | Polygalacturonase inhibiting protein PGIP {Kidney | 98.12 | |
| d1l8qa2 | 213 | Chromosomal replication initiation factor DnaA {Aq | 98.11 | |
| d1xwdc1 | 242 | Follicle-stimulating hormone receptor {Human (Homo | 98.1 | |
| d1e32a2 | 258 | Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu | 98.05 | |
| d1ozna_ | 284 | Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma | 98.05 | |
| d2omza2 | 384 | Internalin A {Listeria monocytogenes [TaxId: 1639] | 98.03 | |
| d1dcea3 | 124 | Rab geranylgeranyltransferase alpha-subunit, C-ter | 97.98 | |
| d1m9la_ | 198 | Outer arm dynein light chain 1 {Green algae (Chlam | 97.74 | |
| d1r7ra3 | 265 | Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu | 97.74 | |
| d1xwdc1 | 242 | Follicle-stimulating hormone receptor {Human (Homo | 97.68 | |
| d1m9la_ | 198 | Outer arm dynein light chain 1 {Green algae (Chlam | 97.59 | |
| d1d2na_ | 246 | Hexamerization domain of N-ethylmalemide-sensitive | 97.54 | |
| d1jl5a_ | 353 | Leucine rich effector protein YopM {Yersinia pesti | 97.37 | |
| d2ifga3 | 156 | High affinity nerve growth factor receptor, N-term | 97.36 | |
| d1mo6a1 | 269 | RecA protein, ATPase-domain {Mycobacterium tubercu | 97.14 | |
| d2gnoa2 | 198 | gamma subunit of DNA polymerase III, N-domain {The | 97.13 | |
| d1xp8a1 | 268 | RecA protein, ATPase-domain {Deinococcus radiodura | 97.08 | |
| d1u94a1 | 263 | RecA protein, ATPase-domain {Escherichia coli [Tax | 96.88 | |
| d1l2ta_ | 230 | MJ0796 {Archaeon Methanococcus jannaschii [TaxId: | 96.82 | |
| d1np6a_ | 170 | Molybdopterin-guanine dinucleotide biosynthesis pr | 96.79 | |
| d1m8pa3 | 183 | ATP sulfurylase C-terminal domain {Fungus (Penicil | 96.67 | |
| d2qy9a2 | 211 | GTPase domain of the signal recognition particle r | 96.66 | |
| d1okkd2 | 207 | GTPase domain of the signal recognition particle r | 96.61 | |
| d1lw7a2 | 192 | Transcriptional regulator NadR, ribosylnicotinamid | 96.59 | |
| d1ls1a2 | 207 | GTPase domain of the signal sequence recognition p | 96.57 | |
| d1qvra3 | 315 | ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 | 96.57 | |
| d1kaga_ | 169 | Shikimate kinase (AroK) {Escherichia coli [TaxId: | 96.55 | |
| d1ly1a_ | 152 | Polynucleotide kinase, kinase domain {Bacteriophag | 96.54 | |
| d2bdta1 | 176 | Hypothetical protein BH3686 {Bacillus halodurans [ | 96.43 | |
| d1z7xw1 | 460 | Ribonuclease inhibitor {Human (Homo sapiens) [TaxI | 96.42 | |
| d1vmaa2 | 213 | GTPase domain of the signal recognition particle r | 96.41 | |
| d1rz3a_ | 198 | Hypothetical protein rbstp0775 {Bacillus stearothe | 96.4 | |
| d1qf9a_ | 194 | UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 | 96.36 | |
| d2i3ba1 | 189 | Cancer-related NTPase, C1orf57 {Human (Homo sapien | 96.34 | |
| d1j8yf2 | 211 | GTPase domain of the signal sequence recognition p | 96.31 | |
| d1rkba_ | 173 | Adenylate kinase {Human (Homo sapiens), isoenzyme | 96.26 | |
| d1xjca_ | 165 | Molybdopterin-guanine dinucleotide biosynthesis pr | 96.26 | |
| d1tf7a2 | 242 | Circadian clock protein KaiC {Synechococcus sp. st | 96.25 | |
| d1x6va3 | 195 | Adenosine-5'phosphosulfate kinase (APS kinase) {Hu | 96.19 | |
| d1r6bx3 | 315 | ClpA, an Hsp100 chaperone, AAA+ modules {Escherich | 96.13 | |
| d1knqa_ | 171 | Gluconate kinase {Escherichia coli [TaxId: 562]} | 96.13 | |
| d1vpla_ | 238 | Putative ABC transporter TM0544 {Thermotoga mariti | 96.07 | |
| d1khta_ | 190 | Adenylate kinase {Archaeon Methanococcus voltae [T | 96.02 | |
| d1qhxa_ | 178 | Chloramphenicol phosphotransferase {Streptomyces v | 96.01 | |
| d1bifa1 | 213 | 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata | 95.97 | |
| d1ofha_ | 309 | HslU {Haemophilus influenzae [TaxId: 727]} | 95.96 | |
| d1ye8a1 | 178 | Hypothetical kinase-like protein Aq_1292 {Aquifex | 95.93 | |
| d1viaa_ | 161 | Shikimate kinase (AroK) {Campylobacter jejuni [Tax | 95.91 | |
| d1ukza_ | 196 | Uridylate kinase {Baker's yeast (Saccharomyces cer | 95.91 | |
| d2iyva1 | 165 | Shikimate kinase (AroK) {Mycobacterium tuberculosi | 95.86 | |
| d1w44a_ | 321 | NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} | 95.83 | |
| d1gvnb_ | 273 | Plasmid maintenance system epsilon/zeta, toxin zet | 95.83 | |
| d1y63a_ | 174 | Probable kinase LmjF30.1890 {Leishmania major [Tax | 95.82 | |
| d1e6ca_ | 170 | Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax | 95.76 | |
| d1zp6a1 | 176 | Hypothetical protein Atu3015 {Agrobacterium tumefa | 95.74 | |
| d1ihua2 | 279 | Arsenite-translocating ATPase ArsA {Escherichia co | 95.74 | |
| d1yj5a2 | 172 | 5' polynucleotide kinase-3' phosphatase, C-termina | 95.65 | |
| d2jdid3 | 276 | Central domain of beta subunit of F1 ATP synthase | 95.53 | |
| d1nksa_ | 194 | Adenylate kinase {Archaeon Sulfolobus acidocaldari | 95.52 | |
| d1ckea_ | 225 | CMP kinase {Escherichia coli [TaxId: 562]} | 95.52 | |
| d1teva_ | 194 | UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] | 95.51 | |
| d2qm8a1 | 323 | Metallochaperone MeaB {Methylobacterium extorquens | 95.42 | |
| d2p67a1 | 327 | LAO/AO transport system kinase ArgK {Escherichia c | 95.3 | |
| d1uj2a_ | 213 | Uridine-cytidine kinase 2 {Human (Homo sapiens) [T | 95.26 | |
| d1m7ga_ | 208 | Adenosine-5'phosphosulfate kinase (APS kinase) {Fu | 95.24 | |
| d1sq5a_ | 308 | Pantothenate kinase PanK {Escherichia coli [TaxId: | 95.14 | |
| d1xpua3 | 289 | Transcription termination factor Rho, ATPase domai | 95.11 | |
| d3adka_ | 194 | Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} | 95.06 | |
| d1szpa2 | 251 | DNA repair protein Rad51, catalytic domain {Baker' | 95.05 | |
| d1ihua1 | 296 | Arsenite-translocating ATPase ArsA {Escherichia co | 94.92 | |
| d1zina1 | 182 | Adenylate kinase {Bacillus stearothermophilus [Tax | 94.89 | |
| d1zaka1 | 189 | Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} | 94.86 | |
| d1znwa1 | 182 | Guanylate kinase {Mycobacterium tuberculosis [TaxI | 94.79 | |
| d1q3ta_ | 223 | CMP kinase {Streptococcus pneumoniae [TaxId: 1313] | 94.79 | |
| d1ak2a1 | 190 | Adenylate kinase {Cow (Bos taurus), mitochondrial | 94.77 | |
| d1cp2a_ | 269 | Nitrogenase iron protein {Clostridium pasteurianum | 94.68 | |
| d2ak3a1 | 189 | Adenylate kinase {Cow (Bos taurus), mitochondrial | 94.66 | |
| d2cdna1 | 181 | Adenylate kinase {Mycobacterium tuberculosis [TaxI | 94.66 | |
| d1lvga_ | 190 | Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 | 94.66 | |
| d1g8pa_ | 333 | ATPase subunit of magnesium chelatase, BchI {Rhodo | 94.63 | |
| d1s3ga1 | 182 | Adenylate kinase {Bacillus globisporus [TaxId: 145 | 94.62 | |
| d1gkya_ | 186 | Guanylate kinase {Baker's yeast (Saccharomyces cer | 94.53 | |
| d1kgda_ | 178 | Guanylate kinase-like domain of Cask {Human (Homo | 94.36 | |
| d1koha1 | 162 | mRNA export factor tap {Human (Homo sapiens) [TaxI | 94.31 | |
| d1akya1 | 180 | Adenylate kinase {Baker's yeast (Saccharomyces cer | 94.26 | |
| d1uf9a_ | 191 | Dephospho-CoA kinase {Thermus thermophilus [TaxId: | 94.2 | |
| d1e4va1 | 179 | Adenylate kinase {Escherichia coli [TaxId: 562]} | 94.19 | |
| d1pzna2 | 254 | DNA repair protein Rad51, catalytic domain {Archae | 94.0 | |
| d1sgwa_ | 200 | Putative ABC transporter PF0895 {Pyrococcus furios | 93.76 | |
| d2ca6a1 | 344 | Rna1p (RanGAP1), N-terminal domain {Fission yeast | 93.69 | |
| d1s96a_ | 205 | Guanylate kinase {Escherichia coli [TaxId: 562]} | 93.67 | |
| d2afhe1 | 289 | Nitrogenase iron protein {Azotobacter vinelandii [ | 93.65 | |
| d1odfa_ | 286 | Hypothetical protein Ygr205W {Baker's yeast (Sacch | 93.61 | |
| d1yrba1 | 244 | ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss | 93.59 | |
| d2vp4a1 | 197 | Deoxyribonucleoside kinase {Fruit fly (Drosophila | 93.57 | |
| d1g2912 | 240 | Maltose transport protein MalK, N-terminal domain | 93.53 | |
| d1a7ja_ | 288 | Phosphoribulokinase {Rhodobacter sphaeroides [TaxI | 93.51 | |
| d2awna2 | 232 | Maltose transport protein MalK, N-terminal domain | 93.47 | |
| d4tmka_ | 210 | Thymidylate kinase {Escherichia coli [TaxId: 562]} | 93.39 | |
| d3dhwc1 | 240 | Methionine import ATP-binding protein MetN {Escher | 93.35 | |
| d1v43a3 | 239 | Hypothetical protein PH0022, N-terminal domain {Py | 93.27 | |
| d1nn5a_ | 209 | Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 | 93.25 | |
| d2onka1 | 240 | Molybdate/tungstate import ATP-binding protein Wtp | 93.22 | |
| d1hyqa_ | 232 | Cell division regulator MinD {Archaeon Archaeoglob | 93.22 | |
| d1r8sa_ | 160 | ADP-ribosylation factor {Human (Homo sapiens), ARF | 93.05 | |
| d2ocpa1 | 241 | Deoxyguanosine kinase {Human (Homo sapiens) [TaxId | 93.05 | |
| d1tf7a1 | 242 | Circadian clock protein KaiC {Synechococcus sp. st | 93.0 | |
| d2pmka1 | 241 | Haemolysin B ATP-binding protein {Escherichia coli | 92.98 | |
| d1b0ua_ | 258 | ATP-binding subunit of the histidine permease {Sal | 92.98 | |
| d3b60a1 | 253 | Multidrug resistance ABC transporter MsbA, C-termi | 92.97 | |
| d1r0wa_ | 281 | Cystic fibrosis transmembrane conductance regulato | 92.91 | |
| d1pgva_ | 167 | Tropomodulin C-terminal domain {nematode (Caenorha | 92.9 | |
| d1mv5a_ | 242 | Multidrug resistance ABC transporter LmrA, C-termi | 92.85 | |
| d1jj7a_ | 251 | Peptide transporter Tap1, C-terminal ABC domain {H | 92.83 | |
| d1htwa_ | 158 | Hypothetical protein HI0065 {Haemophilus influenza | 92.82 | |
| d1v5wa_ | 258 | Meiotic recombination protein DMC1/LIM15 homolog { | 92.69 | |
| d1n0wa_ | 242 | DNA repair protein Rad51, catalytic domain {Human | 92.66 | |
| d1pgva_ | 167 | Tropomodulin C-terminal domain {nematode (Caenorha | 92.66 | |
| d1cr2a_ | 277 | Gene 4 protein (g4p, DNA primase), helicase domain | 92.64 | |
| d1svma_ | 362 | Papillomavirus large T antigen helicase domain {Si | 92.59 | |
| d3d31a2 | 229 | Sulfate/molybdate ABC transporter, ATP-binding pro | 92.55 | |
| d1svia_ | 195 | Probable GTPase EngB {Bacillus subtilis [TaxId: 14 | 92.54 | |
| d1fx0a3 | 276 | Central domain of alpha subunit of F1 ATP synthase | 92.39 | |
| d1upta_ | 169 | ADP-ribosylation factor {Human (Homo sapiens), ARL | 92.38 | |
| d1um8a_ | 364 | ClpX {Helicobacter pylori [TaxId: 210]} | 92.3 | |
| d1ny5a2 | 247 | Transcriptional activator sigm54 (NtrC1), C-termin | 92.26 | |
| d1ji0a_ | 240 | Branched chain aminoacid ABC transporter {Thermoto | 92.25 | |
| d1koha1 | 162 | mRNA export factor tap {Human (Homo sapiens) [TaxI | 92.25 | |
| d2i1qa2 | 258 | DNA repair protein Rad51, catalytic domain {Archae | 92.18 | |
| d1vhta_ | 208 | Dephospho-CoA kinase {Escherichia coli [TaxId: 562 | 92.14 | |
| d1gsia_ | 208 | Thymidylate kinase {Mycobacterium tuberculosis [Ta | 91.95 | |
| d1g6ha_ | 254 | MJ1267 {Archaeon Methanococcus jannaschii [TaxId: | 91.93 | |
| d1f6ba_ | 186 | SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: | 91.86 | |
| d1zj6a1 | 177 | ADP-ribosylation factor {Human (Homo sapiens), ARL | 91.8 | |
| d1oxxk2 | 242 | Glucose transport protein GlcV, N-terminal domain | 91.75 | |
| d1z0fa1 | 166 | Rab14 {Human (Homo sapiens) [TaxId: 9606]} | 91.67 | |
| d1g3qa_ | 237 | Cell division regulator MinD {Archaeon Pyrococcus | 91.67 | |
| d1z06a1 | 165 | Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} | 91.66 | |
| d1jjva_ | 205 | Dephospho-CoA kinase {Haemophilus influenzae [TaxI | 91.63 | |
| d1z2aa1 | 164 | Rab23 {Mouse (Mus musculus) [TaxId: 10090]} | 91.6 | |
| d2a5ja1 | 173 | Rab2b {Human (Homo sapiens) [TaxId: 9606]} | 91.56 | |
| d1p5zb_ | 241 | Deoxycytidine kinase {Human (Homo sapiens) [TaxId: | 91.42 | |
| d1yzqa1 | 164 | Rab6 {Human (Homo sapiens) [TaxId: 9606]} | 91.3 | |
| d1l7vc_ | 231 | ABC transporter involved in vitamin B12 uptake, Bt | 91.16 | |
| d1io0a_ | 166 | Tropomodulin C-terminal domain {Chicken (Gallus ga | 91.14 | |
| d2ew1a1 | 171 | Rab30 {Human (Homo sapiens) [TaxId: 9606]} | 91.14 | |
| d3raba_ | 169 | Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} | 91.09 | |
| d1z0ja1 | 167 | Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} | 91.09 | |
| d1io0a_ | 166 | Tropomodulin C-terminal domain {Chicken (Gallus ga | 91.07 | |
| d1nrjb_ | 209 | Signal recognition particle receptor beta-subunit | 91.04 | |
| d1nija1 | 222 | Hypothetical protein YjiA, N-terminal domain {Esch | 91.0 | |
| d1g16a_ | 166 | Rab-related protein Sec4 {Baker's yeast (Saccharom | 91.0 | |
| d1ksha_ | 165 | ADP-ribosylation factor {Mouse (Mus musculus), ARL | 90.94 | |
| d1kaoa_ | 167 | Rap2a {Human (Homo sapiens) [TaxId: 9606]} | 90.93 | |
| d1mkya1 | 171 | Probable GTPase Der, N-terminal and middle domains | 90.88 | |
| d1z08a1 | 167 | Rab21 {Human (Homo sapiens) [TaxId: 9606]} | 90.84 | |
| d2fn4a1 | 173 | r-Ras {Human (Homo sapiens) [TaxId: 9606]} | 90.8 | |
| d1ky3a_ | 175 | Rab-related protein ypt7p {Baker's yeast (Saccharo | 90.77 | |
| d2erya1 | 171 | r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} | 90.76 | |
| d2atva1 | 168 | Ras-like estrogen-regulated growth inhibitor, RERG | 90.73 | |
| d2erxa1 | 171 | di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} | 90.72 | |
| d2qtvb1 | 166 | SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta | 90.69 | |
| d2bmea1 | 174 | Rab4a {Human (Homo sapiens) [TaxId: 9606]} | 90.67 | |
| d1r2qa_ | 170 | Rab5a {Human (Homo sapiens) [TaxId: 9606]} | 90.64 | |
| d1wf3a1 | 178 | GTPase Era, N-terminal domain {Thermus thermophilu | 90.62 | |
| d1tmka_ | 214 | Thymidylate kinase {Baker's yeast (Saccharomyces c | 90.62 | |
| d2hyda1 | 255 | Putative multidrug export ATP-binding/permease pro | 90.53 | |
| d1egaa1 | 179 | GTPase Era, N-terminal domain {Escherichia coli [T | 90.51 | |
| d2gjsa1 | 168 | Rad {Human (Homo sapiens) [TaxId: 9606]} | 90.5 | |
| d2ca6a1 | 344 | Rna1p (RanGAP1), N-terminal domain {Fission yeast | 90.48 | |
| d1xtqa1 | 167 | GTP-binding protein RheB {Human (Homo sapiens) [Ta | 90.44 | |
| d1deka_ | 241 | Deoxynucleoside monophosphate kinase {Bacteriophag | 90.44 | |
| d1fzqa_ | 176 | ADP-ribosylation factor {Mouse (Mus musculus), ARL | 90.27 | |
| d1ctqa_ | 166 | cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 | 90.26 | |
| d1svsa1 | 195 | Transducin (alpha subunit) {Rat (Rattus norvegicus | 90.24 | |
| d1kmqa_ | 177 | RhoA {Human (Homo sapiens) [TaxId: 9606]} | 90.22 | |
| d1c1ya_ | 167 | Rap1A {Human (Homo sapiens) [TaxId: 9606]} | 90.21 | |
| d1ewqa2 | 224 | DNA repair protein MutS, the C-terminal domain {Th | 90.19 | |
| d2fh5b1 | 207 | Signal recognition particle receptor beta-subunit | 90.06 | |
| d2f9la1 | 175 | Rab11b {Human (Homo sapiens) [TaxId: 9606]} | 90.0 | |
| d2jdia3 | 285 | Central domain of alpha subunit of F1 ATP synthase | 90.0 | |
| d1ek0a_ | 170 | Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T | 89.87 | |
| d1mh1a_ | 183 | Rac {Human (Homo sapiens) [TaxId: 9606]} | 89.8 | |
| d2f7sa1 | 186 | Rab27b {Human (Homo sapiens) [TaxId: 9606]} | 89.79 | |
| d2bcgy1 | 194 | GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi | 89.75 | |
| d1udxa2 | 180 | Obg GTP-binding protein middle domain {Thermus the | 89.7 | |
| d1u0la2 | 225 | Probable GTPase EngC (YjeQ), C-terminal domain {Th | 89.7 | |
| d2atxa1 | 185 | RhoQ {Human (Homo sapiens) [TaxId: 9606]} | 89.67 | |
| d1zd9a1 | 164 | ADP-ribosylation factor {Human (Homo sapiens), ARL | 89.6 | |
| d2cxxa1 | 184 | GTP-binding protein engB {Pyrococcus horikoshii [T | 89.54 | |
| d2g6ba1 | 170 | Rab26 {Human (Homo sapiens) [TaxId: 9606]} | 89.44 | |
| d1vg8a_ | 184 | Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} | 89.31 | |
| d1e0sa_ | 173 | ADP-ribosylation factor {Human (Homo sapiens), ARF | 89.3 | |
| d1lnza2 | 185 | Obg GTP-binding protein middle domain {Bacillus su | 89.23 | |
| d1u8za_ | 168 | Ras-related protein RalA {Cotton-top tamarin (Sagu | 89.19 | |
| d1z7xw1 | 460 | Ribonuclease inhibitor {Human (Homo sapiens) [TaxI | 89.01 | |
| d1m7ba_ | 179 | RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} | 89.0 | |
| d2bcjq2 | 200 | Transducin (alpha subunit) {Mouse (Mus musculus) [ | 88.98 | |
| d2gj8a1 | 161 | Probable tRNA modification GTPase TrmE (MnmE), G d | 88.94 | |
| d2g3ya1 | 172 | GTP-binding protein GEM {Human (Homo sapiens) [Tax | 88.84 | |
| d1byia_ | 224 | Dethiobiotin synthetase {Escherichia coli [TaxId: | 88.77 | |
| d1x3sa1 | 177 | Rab18 {Human (Homo sapiens) [TaxId: 9606]} | 88.71 | |
| d1wmsa_ | 174 | Rab9a {Human (Homo sapiens) [TaxId: 9606]} | 88.66 | |
| d1zcba2 | 200 | Transducin (alpha subunit) {Mouse (Mus musculus) [ | 88.66 | |
| d2ngra_ | 191 | CDC42 {Human (Homo sapiens) [TaxId: 9606]} | 88.56 | |
| d1i2ma_ | 170 | Ran {Human (Homo sapiens) [TaxId: 9606]} | 88.48 | |
| d1x1ra1 | 169 | Ras-related protein M-Ras (XRas) {Mouse (Mus muscu | 88.47 | |
| d1nlfa_ | 274 | Hexameric replicative helicase repA {Escherichia c | 88.18 | |
| d2bmja1 | 175 | Centaurin gamma 1, G domain {Human (Homo sapiens) | 88.17 | |
| d1puia_ | 188 | Probable GTPase EngB {Escherichia coli [TaxId: 562 | 87.98 | |
| d1moza_ | 182 | ADP-ribosylation factor {Baker's yeast (Saccharomy | 87.91 | |
| d1mkya2 | 186 | Probable GTPase Der, N-terminal and middle domains | 87.59 | |
| d2fu5c1 | 173 | Rab8a {Mouse (Mus musculus) [TaxId: 10090]} | 87.12 | |
| d1g41a_ | 443 | HslU {Haemophilus influenzae [TaxId: 727]} | 87.02 | |
| d1kkma_ | 176 | HPr kinase HprK C-terminal domain {Lactobacillus c | 86.78 | |
| d1azta2 | 221 | Transducin (alpha subunit) {Cow (Bos taurus) [TaxI | 86.69 | |
| d1wb9a2 | 234 | DNA repair protein MutS, the C-terminal domain {Es | 86.49 | |
| g1f2t.1 | 292 | Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} | 86.47 | |
| d1xzpa2 | 160 | TrmE GTPase domain {Thermotoga maritima [TaxId: 23 | 86.1 | |
| d1w36d1 | 359 | Exodeoxyribonuclease V alpha chain (RecD) {Escheri | 85.86 | |
| d1ko7a2 | 169 | HPr kinase HprK C-terminal domain {Staphylococcus | 85.76 | |
| d1knxa2 | 177 | HPr kinase HprK C-terminal domain {Mycoplasma pneu | 85.32 | |
| d1g6oa_ | 323 | Hexameric traffic ATPase, HP0525 {Helicobacter pyl | 85.13 | |
| d1h65a_ | 257 | Chloroplast protein translocon GTPase Toc34 {Garde | 84.43 | |
| d1p9ra_ | 401 | Extracellular secretion NTPase EpsE {Vibrio choler | 83.41 | |
| d2eyqa3 | 233 | Transcription-repair coupling factor, TRCF {Escher | 82.68 | |
| d1g7sa4 | 227 | Initiation factor IF2/eIF5b, N-terminal (G) domain | 82.47 | |
| g1ii8.1 | 369 | Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} | 82.37 | |
| d2bv3a2 | 276 | Elongation factor G (EF-G), N-terminal (G) domain | 81.47 | |
| d1t9ha2 | 231 | Probable GTPase EngC (YjeQ), C-terminal domain {Ba | 81.35 | |
| g1xew.1 | 329 | Smc head domain {Pyrococcus furiosus [TaxId: 2261] | 80.46 | |
| d2dy1a2 | 267 | Elongation factor G (EF-G), N-terminal (G) domain | 80.45 | |
| d1uaaa1 | 306 | DEXX box DNA helicase {Escherichia coli, RepD [Tax | 80.37 | |
| d1p6xa_ | 333 | Thymidine kinase {Equine herpesvirus type 4 [TaxId | 80.13 |
| >d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: Extended AAA-ATPase domain domain: CED-4, NB-ARC domain species: Caenorhabditis elegans [TaxId: 6239]
Probab=100.00 E-value=1.6e-35 Score=297.59 Aligned_cols=227 Identities=12% Similarity=0.071 Sum_probs=175.6
Q ss_pred CCccccchHHHHHHHHHHHh---cCCceEEEEEecCCCcHHHHHHHHHHHhh--ccCCCCEEEEEEecCCCChHHHHHHH
Q 036977 156 DNEAFDSRMKVFQDVMEALK---DDKLNIIGVYGMGGVGKTTLVKQVAKKVM--EDKLIDKVVMAEVTQNPDPQKIQDKL 230 (693)
Q Consensus 156 ~~~~~~gR~~~~~~l~~~L~---~~~~~vi~I~G~gGiGKTtLa~~v~~~~~--~~~~F~~~~wv~vs~~~~~~~~~~~i 230 (693)
..+.++||+.++++|+++|. +...++|+|+||||+||||||+++|++.. .+.+|+.++|+++++.++...+...+
T Consensus 18 ~~~~~~gR~~~~~~i~~~L~~~~~~~~~~v~I~GmgGiGKTtLA~~v~~~~~~~~~~~f~~~~Wv~vs~~~~~~~l~~~~ 97 (277)
T d2a5yb3 18 KQMTCYIREYHVDRVIKKLDEMCDLDSFFLFLHGRAGSGKSVIASQALSKSDQLIGINYDSIVWLKDSGTAPKSTFDLFT 97 (277)
T ss_dssp CCCCSCCCHHHHHHHHHHHHHHTTSSSEEEEEECSTTSSHHHHHHHHHHHCSSTBTTTBSEEEEEECCCCSTTHHHHHHH
T ss_pred CCCceeCcHHHHHHHHHHHHhccCCCceEEEEECCCCCCHHHHHHHHHHhhhhhhhhcCceEEEEEecCCCCHHHHHHHH
Confidence 34557799999999999985 34578999999999999999999999855 56789999999999998877776665
Q ss_pred HHH---hCCCCC------C-CCCHHHHHHHHHHHHhcCCcEEEEEeCCCCccCccccCCCCCCcccccccccCCCeEEEE
Q 036977 231 ASD---LGMKFD------L-NDSIHHRASRLRERLKQEKRVLIILDNIWTKLELDAVGIPSGDVDEKDREDDQRRCTIIL 300 (693)
Q Consensus 231 ~~~---l~~~~~------~-~~~~~~~~~~l~~~L~~~k~~LlVlDdv~~~~~~~~l~~~~~~~~~~~~~~~~~~~~Iiv 300 (693)
... ++.... . ..........+.+.+.+ +++|+||||||+..+|+.+ ...||+|||
T Consensus 98 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~L~~-kr~LlVLDDv~~~~~~~~~--------------~~~~srilv 162 (277)
T d2a5yb3 98 DILLMLKSEDDLLNFPSVEHVTSVVLKRMICNALIDR-PNTLFVFDDVVQEETIRWA--------------QELRLRCLV 162 (277)
T ss_dssp HHHHHHTTTSCCTTCCCCTTCCHHHHHHHHHHHHTTS-TTEEEEEEEECCHHHHHHH--------------HHTTCEEEE
T ss_pred HHHHHHhcchhhcCCccchhhhhHHHHHHHHHHHhcc-CCeeEecchhhHHhhhhhh--------------cccCceEEE
Confidence 443 332211 1 12223334456666776 8999999999999888765 345899999
Q ss_pred ecCChhhhhhhcCCCcEEEcCCCCHHHHHHHHHHhhhhhhhccccccccccCCCCCCCchhhHHHHHhhhcCCCccc---
Q 036977 301 TSRSRDLLCIDMNSQKIFWIDALSKEEALHLAKLQHLEISYCESMEGVVDTTGWSERDEGKLIELKVFPKLHSLKLE--- 377 (693)
Q Consensus 301 TtR~~~v~~~~~~~~~~~~l~~L~~~ea~~Lf~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~I~~~c~glPLa--- 377 (693)
|||+..++.......+.|++++|+.+||++||.+.++.. ...+..++++.+|+++|+|+|||
T Consensus 163 TTR~~~v~~~~~~~~~~~~l~~L~~~ea~~Lf~~~~~~~---------------~~~~~~~~~~~~iv~~c~GlPLAl~~ 227 (277)
T d2a5yb3 163 TTRDVEISNAASQTCEFIEVTSLEIDECYDFLEAYGMPM---------------PVGEKEEDVLNKTIELSSGNPATLMM 227 (277)
T ss_dssp EESBGGGGGGCCSCEEEEECCCCCHHHHHHHHHHTSCCC---------------C--CHHHHHHHHHHHHHTTCHHHHHH
T ss_pred EeehHHHHHhcCCCCceEECCCCCHHHHHHHHHHHhCCc---------------cCchhhHHHHHHHHHHhCCCHHHHHH
Confidence 999999976534444789999999999999999998754 13456678899999999999999
Q ss_pred ------------c---cccccccccccccccchhccccCchhHhhhhhhhcc
Q 036977 378 ------------W---LPELTSFANTGQIHSDLVVEFPSLLNLEIHGCNNML 414 (693)
Q Consensus 378 ------------w---l~~~~~~~~~~~i~~~l~~sy~~L~~~~lk~cfl~~ 414 (693)
| ...+.. ....++..++.+||++||+ ++|.||.++
T Consensus 228 ig~~l~~k~~~~~~~~~~~L~~-~~~~~v~~il~~sY~~L~~-~lk~c~~~l 277 (277)
T d2a5yb3 228 FFKSCEPKTFEKMAQLNNKLES-RGLVGVECITPYSYKSLAM-ALQRCVEVL 277 (277)
T ss_dssp HHTTCCSSSHHHHHHHHHHHHH-HCSSTTCCCSSSSSSSHHH-HHHHHHHTS
T ss_pred HHHHhccCCHHHHHHHHHHHhc-CcHHHHHHHHHHHHhcccH-HHHHHHHhC
Confidence 2 222221 2356799999999999998 999999864
|
| >d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} | Back information, alignment and structure |
|---|
| >d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} | Back information, alignment and structure |
|---|
| >d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} | Back information, alignment and structure |
|---|
| >d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} | Back information, alignment and structure |
|---|
| >d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} | Back information, alignment and structure |
|---|
| >d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} | Back information, alignment and structure |
|---|
| >d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} | Back information, alignment and structure |
|---|
| >d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} | Back information, alignment and structure |
|---|
| >d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} | Back information, alignment and structure |
|---|
| >d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} | Back information, alignment and structure |
|---|
| >d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} | Back information, alignment and structure |
|---|
| >d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} | Back information, alignment and structure |
|---|
| >d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} | Back information, alignment and structure |
|---|
| >d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} | Back information, alignment and structure |
|---|
| >d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} | Back information, alignment and structure |
|---|
| >d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} | Back information, alignment and structure |
|---|
| >d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} | Back information, alignment and structure |
|---|
| >d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} | Back information, alignment and structure |
|---|
| >d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} | Back information, alignment and structure |
|---|
| >d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1ihua2 c.37.1.10 (A:308-586) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2jdid3 c.37.1.11 (D:82-357) Central domain of beta subunit of F1 ATP synthase {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} | Back information, alignment and structure |
|---|
| >d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} | Back information, alignment and structure |
|---|
| >d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} | Back information, alignment and structure |
|---|
| >d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1xpua3 c.37.1.11 (A:129-417) Transcription termination factor Rho, ATPase domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ihua1 c.37.1.10 (A:1-296) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} | Back information, alignment and structure |
|---|
| >d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1cp2a_ c.37.1.10 (A:) Nitrogenase iron protein {Clostridium pasteurianum [TaxId: 1501]} | Back information, alignment and structure |
|---|
| >d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} | Back information, alignment and structure |
|---|
| >d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} | Back information, alignment and structure |
|---|
| >d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2afhe1 c.37.1.10 (E:1-289) Nitrogenase iron protein {Azotobacter vinelandii [TaxId: 354]} | Back information, alignment and structure |
|---|
| >d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} | Back information, alignment and structure |
|---|
| >d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} | Back information, alignment and structure |
|---|
| >d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} | Back information, alignment and structure |
|---|
| >d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1hyqa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ocpa1 c.37.1.1 (A:37-277) Deoxyguanosine kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} | Back information, alignment and structure |
|---|
| >d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} | Back information, alignment and structure |
|---|
| >d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} | Back information, alignment and structure |
|---|
| >d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} | Back information, alignment and structure |
|---|
| >d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} | Back information, alignment and structure |
|---|
| >d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1fx0a3 c.37.1.11 (A:97-372) Central domain of alpha subunit of F1 ATP synthase {Spinach (Spinacia oleracea), chloroplast [TaxId: 3562]} | Back information, alignment and structure |
|---|
| >d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} | Back information, alignment and structure |
|---|
| >d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} | Back information, alignment and structure |
|---|
| >d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g3qa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1nija1 c.37.1.10 (A:2-223) Hypothetical protein YjiA, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1tmka_ c.37.1.1 (A:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1deka_ c.37.1.1 (A:) Deoxynucleoside monophosphate kinase {Bacteriophage T4 [TaxId: 10665]} | Back information, alignment and structure |
|---|
| >d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1svsa1 c.37.1.8 (A:32-60,A:182-347) Transducin (alpha subunit) {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ewqa2 c.37.1.12 (A:542-765) DNA repair protein MutS, the C-terminal domain {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2jdia3 c.37.1.11 (A:95-379) Central domain of alpha subunit of F1 ATP synthase {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2bcjq2 c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1byia_ c.37.1.10 (A:) Dethiobiotin synthetase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]} | Back information, alignment and structure |
|---|
| >d1azta2 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1wb9a2 c.37.1.12 (A:567-800) DNA repair protein MutS, the C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ko7a2 c.91.1.2 (A:130-298) HPr kinase HprK C-terminal domain {Staphylococcus xylosus [TaxId: 1288]} | Back information, alignment and structure |
|---|
| >d1knxa2 c.91.1.2 (A:133-309) HPr kinase HprK C-terminal domain {Mycoplasma pneumoniae [TaxId: 2104]} | Back information, alignment and structure |
|---|
| >d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} | Back information, alignment and structure |
|---|
| >d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1g7sa4 c.37.1.8 (A:1-227) Initiation factor IF2/eIF5b, N-terminal (G) domain {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d2bv3a2 c.37.1.8 (A:7-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2dy1a2 c.37.1.8 (A:8-274) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus, EF-G-2 [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1p6xa_ c.37.1.1 (A:) Thymidine kinase {Equine herpesvirus type 4 [TaxId: 10331]} | Back information, alignment and structure |
|---|