Citrus Sinensis ID: 037018

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660---
MTSSVNLRKPLTHSSSTSCSSKTVKVKVKAVLVWLFMLDSMWLQFLTAVAYKTAFVADIYNNNVDLSAMNPKLRVPKRFINKAFPVAFPVDVNCACNAQLNHILDDIIKSVMPPSRVNVIISEDYKLKTIILRDYLTNKKDFIVLDDVFDDREIWNDLEKFLPDNQNGSRVLILVTDPFLLTSFELEHGEKIRLNSALVGGPLIRIKYEGWQFFILHYGSMPLGSYFQGEAMPTIWRHIYSVMELPFHLKVCCLYLCVFRPSIEISTRQLYQLWVAEVSKRRAGGTIKACYVPGFVYTSLFFMAGMMEFVWMPHMQLETLANVKRCFILEDLIDEFISLEHSDMYLQSFLNHTLESDRLALIDCENFCKKFKHLRVLNLGSAILYQYPPGLENLFHLKYLKLNIPSLNCLPSLLCTLLNLQTLEMPASYIDHSPEGIWMMQKLMHLNFGSINLPAPPKNYSSSLKNLIFISSLNPSSCTPDILGRLPNVQTLRISGDLSHYHSGVSKSLCELHKLECLQLVHEGRMWQLSRMVLSEYQFPPCLTQLSLSNTQLMEDPMPALEKLPHLEVLKLKQNSYSERKLACVGSGSFPQLKILHLKSMLWLEEWTMGAGAMPKLESLIVNPCAYLRKLPEELWCIKSLCKLELHWPQPELRKRLRAFEDM
cccccccccccccccccccccHHHHHHHHHHHHHHHHccccccEEEEEEccHHHHHHHHHccccccccccccccccccccEEEEEccccccEEEcccccHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHccccEEEEEEEcccccccHHHHHHccccccccccEEEEccccccccccccHHHHHHHHHccccccccccHHccccHHHHHHHHcccccccHHcccccHHHHHHHcccccccccHHHHHHHcccccccccccHHHHHHHHHHccccccccccHHcccHHHHHHHHHHHHHccccEEEEcccccccccccEEEEEEEcccccEEEEEccccEEEEEEccccccccccccccccccccccEEEEEEEccccccccccccccccccccccccccccccccHHHcccccccEEEccccccccccHHHcccccccEEEEccccccccccccccccccccEEcccccccccHHHHcccccccEEEEEEEccccHHHHHHHcccccccEEEccccccccccccccccccccccccccEEEEEcccccccccccccccccccEEEEEEEEEEccEEEEEcccccccccEEEEEccccccEEEEcccccccccccEEEcccccccccccccccccccEEEEEcccHHHHHHHHHcccc
ccccHHHHHHHHcccccccHHHcccccccEEEEEEEccccEEEEEEcccccHHHHHHHHHccHHHHHHccccccHHEcccEEEEEEcccEEEEEcccccHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHccccEEEEEEcccccHHHHHHHHHHccccccccEEEEEEccccccccccHHHHHHHHHHHHcccccccHHHHHHHHHHHHHcccccHHHHHcccccHHHHHHHHcHHcccHHHHHHEEEEEEccccccEcHHHHHHHHHHHccccccHHHHHHHHHHHHHHccEEEEEcccccccEcEcHHHHHHHHHHHHccccccccEEEcccccccHHHHHccccccccccHHHHHHHHHHccEEEEEEccccccccccccccccHHcEEEEccccccccccccHHccccccEEEEcccccccccHHHHcHHcccEEEEccccccccccccccccHHHHEEEEEcccccccHHHcccHHccEEEEEccccccHHHHHHHHcccccccEEEEEccccccccccHcccccccccccEEEEEEcccccccccHHHHccccccEEEEEccccccccccccccccccccEEEEEcccHcHccccccccccccccEEEEcccHHHHcccccccccccccEEEEcccHHHHHHHHcccccc
mtssvnlrkplthssstscssktVKVKVKAVLVWLFMLDSMWLQFLTAVAYKTAFVADIynnnvdlsamnpklrvpkrfinkafpvafpvdvncACNAQLNHILDDiiksvmppsrvnviisedykLKTIILRDYLtnkkdfivlddvfddREIWNDLEkflpdnqngsrVLILVtdpflltsfeLEHGEkirlnsalvggplirikYEGWQFFILHygsmplgsyfqgeampTIWRHIYSVMELPFHLKVCCLYLcvfrpsieisTRQLYQLWVAEVSKrraggtikacyvpgfvyTSLFFMAGMMEFVWMPHMQLETLANVKRCFILEDLIDEFISLEHSDMYLQSFLNHTLESDRLALIDCENFCKKFKHLRVLNLGSAilyqyppglenlfhlkylklnipslnclpsLLCTLLNlqtlempasyidhspeGIWMMQKLMHLnfgsinlpappknyssslKNLIFisslnpssctpdilgrlpnvqtlrisgdlshyhsgvskslcelHKLECLQLVHEGRMWQLSRMVlseyqfppcltqlslsntqlmedpmpaleklphleVLKLKqnsyserklacvgsgsfpqlkILHLKSMLWLEewtmgagampkleslivnpcaylrKLPEELWCIKSLCklelhwpqpeLRKRLRAFEDM
mtssvnlrkplthssstscssktvkVKVKAVLVWLFMLDSMWLQFLTAVAYKTAFVADIYNNNVDLSAMNPKLRVPKRFINKAFPVAFPVDVNCACNAQLNHILDDIIKSVMPPSRVNVIISEDYKLKTIILRDyltnkkdfivLDDVFDDREIWNDLEkflpdnqngsrVLILVTDPFLLTSFELEHGEKIRLNSALVGGPLIRIKYEGWQFFILHYGSMPLGSYFQGEAMPTIWRHIYSVMELPFHLKVCCLYLCVFRPSIEISTRQLYQLWVAEVSKrraggtikacYVPGFVYTSLFFMAGMMEFVWMPHMQLETLANVKRCFILEDLIDEFISLEHSDMYLQSFLNHTLESDRLALIDCENFCKKFKHLRVLNLGSAILYQYPPGLENLFHLKYLKLNIPSLNCLPSLLCTLLNLQTLEMPASYIDHSPEGIWMMQKLMHLNFGSINLPAPPKNYSSSLKNLIFISSLNPSSCTPDILGRLPNVQTLRISGDLSHYHSGVSKSLCELHKLECLQLVHEGRMWQLSRMVLSEYQFPPCLTQLSLSNTQLMEDPMPALEKLPHLEVLKLKQNSYSERKLACVGSGSFPQLKILHLKSMLWLEEWTMGAGAMPKLESLIVNPCAYLRKLPEELWCIKSLCklelhwpqpelrkrlrafedm
MTSSVNLRKPLTHssstscssktvkvkvkavLVWLFMLDSMWLQFLTAVAYKTAFVADIYNNNVDLSAMNPKLRVPKRFINKAFPVAFPVDVNCACNAQLNHILDDIIKSVMPPSRVNVIISEDYKLKTIILRDYLTNKKDFIVLDDVFDDREIWNDLEKFLPDNQNGSRVLILVTDPFLLTSFELEHGEKIRLNSALVGGPLIRIKYEGWQFFILHYGSMPLGSYFQGEAMPTIWRHIYSVMELPFHLKVCCLYLCVFRPSIEISTRQLYQLWVAEVSKRRAGGTIKACYVPGFVYTSLFFMAGMMEFVWMPHMQLETLANVKRCFILEDLIDEFISLEHSDMYLQSFLNHTLESDRLALIDCENFCKKFKHLRVLNLGSAILYQYPPGLENLFHLKYLKLNIpslnclpsllctllnlqtlEMPASYIDHSPEGIWMMQKLMHLNFGSINLPAPPKNYSSSLKNLIFISSLNPSSCTPDILGRLPNVQTLRISGDLSHYHSGVSKSLCELHKLECLQLVHEGRMWQLSRMVLSEYQFPPCLTQLSLSNTQLMEDPMPALEKLPHLEVLKLKQNSYSERKLACVGSGSFPQLKILHLKSMLWLEEWTMGAGAMPKLESLIVNPCAYLRKLPEELWCIKSLCKLELHWPQPELRKRLRAFEDM
**********************TVKVKVKAVLVWLFMLDSMWLQFLTAVAYKTAFVADIYNNNVDLSAMNPKLRVPKRFINKAFPVAFPVDVNCACNAQLNHILDDIIKSVMPPSRVNVIISEDYKLKTIILRDYLTNKKDFIVLDDVFDDREIWNDLEKFLPDNQNGSRVLILVTDPFLLTSFELEHGEKIRLNSALVGGPLIRIKYEGWQFFILHYGSMPLGSYFQGEAMPTIWRHIYSVMELPFHLKVCCLYLCVFRPSIEISTRQLYQLWVAEVSKRRAGGTIKACYVPGFVYTSLFFMAGMMEFVWMPHMQLETLANVKRCFILEDLIDEFISLEHSDMYLQSFLNHTLESDRLALIDCENFCKKFKHLRVLNLGSAILYQYPPGLENLFHLKYLKLNIPSLNCLPSLLCTLLNLQTLEMPASYIDHSPEGIWMMQKLMHLNFGSINLPAPPKNYSSSLKNLIFISSLNPSSCTPDILGRLPNVQTLRISGDLSHYHSGVSKSLCELHKLECLQLVHEGRMWQLSRMVLSEYQFPPCLTQLSLSNT***********KLPHLEVLKLKQNSYSERKLACVGSGSFPQLKILHLKSMLWLEEWTMGAGAMPKLESLIVNPCAYLRKLPEELWCIKSLCKLELHWPQ*************
****************************KAVLVWLFMLDSMWLQFLTAVAYKTAFVADIYNNNVDLSAMNPKLRVPKRFINKAFPVAFPVDVNCACNAQLNHILDDIIKSV****************KTIILRDYLTNKKDFIVLDDVFDDREIWNDLEKFLPDNQNGSRVLILVTDPFLLTSFELEHGEKIRLNSALVGGPLIRIKYEGWQFFILHYGSMPLGSYFQGEAMPTIWRHIYSVMELPFHLKVCCLYLCVFRPSIEISTRQLYQLWVAEVSKRRAGGTIKACYVPGFVYTSLFFMAGMMEFVWMPHMQLETLANVKRCFILEDLI***IS***SDMYLQSFLNHTLESDRLALIDCENFCKKFKHLRVLNLGSAILYQYPPGLENLFHLKYLKLNIPSLNCLPSLLCTLLNLQTLEMPASYIDHSPEGIWMMQKLMHLNFGSIN***********L**LIFISSLNPSSCTPDILGRLPNVQTLRISGDLSHYHSGVSKSLCELHKLECLQLVHEGRMWQLSRMVLSEYQFPPCLTQLSLSNTQLMEDPMPALEKLPHLEVLKLKQNSYSERKLACVGSGSFPQLKILHLKSMLWLEEWTMGAGAMPKLESLIVNPCAYLRKLPEELWCIKSLCKLELHWPQPELR**LRA****
**********************TVKVKVKAVLVWLFMLDSMWLQFLTAVAYKTAFVADIYNNNVDLSAMNPKLRVPKRFINKAFPVAFPVDVNCACNAQLNHILDDIIKSVMPPSRVNVIISEDYKLKTIILRDYLTNKKDFIVLDDVFDDREIWNDLEKFLPDNQNGSRVLILVTDPFLLTSFELEHGEKIRLNSALVGGPLIRIKYEGWQFFILHYGSMPLGSYFQGEAMPTIWRHIYSVMELPFHLKVCCLYLCVFRPSIEISTRQLYQLWVAEVSKRRAGGTIKACYVPGFVYTSLFFMAGMMEFVWMPHMQLETLANVKRCFILEDLIDEFISLEHSDMYLQSFLNHTLESDRLALIDCENFCKKFKHLRVLNLGSAILYQYPPGLENLFHLKYLKLNIPSLNCLPSLLCTLLNLQTLEMPASYIDHSPEGIWMMQKLMHLNFGSINLPAPPKNYSSSLKNLIFISSLNPSSCTPDILGRLPNVQTLRISGDLSHYHSGVSKSLCELHKLECLQLVHEGRMWQLSRMVLSEYQFPPCLTQLSLSNTQLMEDPMPALEKLPHLEVLKLKQNSYSERKLACVGSGSFPQLKILHLKSMLWLEEWTMGAGAMPKLESLIVNPCAYLRKLPEELWCIKSLCKLELHWPQPELRKRLRAFEDM
****************TSCSSKTVKVKVKAVLVWLFMLDSMWLQFLTAVAYKTAFVADIYNNNVDLSAMNPKLRVPKRFINKAFPVAFPVDVNCACNAQLNHILDDIIKSVMPPSRVNVIISEDYKLKTIILRDYLTNKKDFIVLDDVFDDREIWNDLEKFLPDNQNGSRVLILVTDPFLLTSFELEHGEKIRLNSALVGGPLIRIKYEGWQFFILHYGSMPLGSYFQGEAMPTIWRHIYSVMELPFHLKVCCLYLCVFRPSIEISTRQLYQLWVAEVSKRRAGGTIKACYVPGFVYTSLFFMAGMMEFVWMPHMQLETLANVKRCFILEDLIDEFISLEHSDMYLQSFLNHTLESDRLALIDCENFCKKFKHLRVLNLGSAILYQYPPGLENLFHLKYLKLNIPSLNCLPSLLCTLLNLQTLEMPASYIDHSPEGIWMMQKLMHLNFGSINLPAPPKNYSSSLKNLIFISSLNPSSCTPDILGRLPNVQTLRISGDLSHYHSGVSKSLCELHKLECLQLVHEGRMWQLSRMVLSEYQFPPCLTQLSLSNTQLMEDPMPALEKLPHLEVLKLKQNSYSERKLACVGSGSFPQLKILHLKSMLWLEEWTMGAGAMPKLESLIVNPCAYLRKLPEELWCIKSLCKLELHWPQPELRKRLR*****
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTSSVNLRKPLTHSSSTSCSSKTVKVKVKAVLVWLFMLDSMWLQFLTAVAYKTAFVADIYNNNVDLSAMNPKLRVPKRFINKAFPVAFPVDVNCACNAQLNHILDDIIKSVMPPSRVNVIISEDYKLKTIILRDYLTNKKDFIVLDDVFDDREIWNDLEKFLPDNQNGSRVLILVTDPFLLTSFELEHGEKIRLNSALVGGPLIRIKYEGWQFFILHYGSMPLGSYFQGEAMPTIWRHIYSVMELPFHLKVCCLYLCVFRPSIEISTRQLYQLWVAEVSKRRAGGTIKACYVPGFVYTSLFFMAGMMEFVWMPHMQLETLANVKRCFILEDLIDEFISLEHSDMYLQSFLNHTLESDRLALIDCENFCKKFKHLRVLNLGSAILYQYPPGLENLFHLKYLKLNIPSLNCLPSLLCTLLNLQTLEMPASYIDHSPEGIWMMQKLMHLNFGSINLPAPPKNYSSSLKNLIFISSLNPSSCTPDILGRLPNVQTLRISGDLSHYHSGVSKSLCELHKLECLQLVHEGRMWQLSRMVLSEYQFPPCLTQLSLSNTQLMEDPMPALEKLPHLEVLKLKQNSYSERKLACVGSGSFPQLKILHLKSMLWLEEWTMGAGAMPKLESLIVNPCAYLRKLPEELWCIKSLCKLELHWPQPELRKRLRAFEDM
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query663 2.2.26 [Sep-21-2011]
Q9FJB5901 Disease resistance RPP8-l yes no 0.660 0.486 0.255 3e-22
Q8W4J9908 Disease resistance protei no no 0.659 0.481 0.263 7e-21
Q8W474907 Probable disease resistan no no 0.398 0.291 0.336 1e-20
Q9XIF0906 Putative disease resistan no no 0.405 0.296 0.320 7e-20
Q6L3Z71317 Putative late blight resi N/A no 0.757 0.381 0.263 2e-19
P59584910 Disease resistance protei no no 0.423 0.308 0.276 2e-18
Q9FJK8908 Probable disease resistan no no 0.615 0.449 0.264 4e-18
P0C8S1906 Probable disease resistan no no 0.621 0.454 0.265 5e-18
Q6L4031312 Putative late blight resi N/A no 0.757 0.382 0.264 7e-18
Q39214926 Disease resistance protei no no 0.781 0.559 0.244 3e-17
>sp|Q9FJB5|RP8L3_ARATH Disease resistance RPP8-like protein 3 OS=Arabidopsis thaliana GN=RPP8L3 PE=2 SV=1 Back     alignment and function desciption
 Score =  107 bits (266), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 130/509 (25%), Positives = 223/509 (43%), Gaps = 71/509 (13%)

Query: 211 WQFFILHYGSMPLG-SYFQGEAMPTIWRHI-YSVMELPFHLKVCCLYLCVFRPSIEISTR 268
           W+    + G+  +G S     ++ +++R +  S  +LP  LK C LYL  F    +I TR
Sbjct: 377 WKRVSENIGAQIVGKSCLDDNSLNSVYRILSLSYEDLPTDLKHCFLYLAHFPEDYKIKTR 436

Query: 269 QLYQLWVAEVSKRRAGGTI---KACYVPGFVYTSLFFMAGMMEFVWMPHMQLETLANVKR 325
            LY  W AE      G TI      Y+   V  +L  +A      W   ++L  + ++ R
Sbjct: 437 TLYSYWAAE--GIYDGLTILDSGEDYLEELVRRNLV-IAEKSNLSW--RLKLCQMHDMMR 491

Query: 326 -CFILEDLIDEFISLEHSDMYLQSFLNHT-LESDRLALIDCENF-----CKKFKHLRVLN 378
              I +  ++ F+ +        + +  +   S RL +   + F      KK + L VL 
Sbjct: 492 EVCISKAKVENFLQIIKVPTSTSTIIAQSPSRSRRLTVHSGKAFHILGHKKKVRSLLVLG 551

Query: 379 LGSAILYQYPPGLENLFHLKYLKLNIPSLNC--LPSLLCTLLNLQTLEMPASYIDHSPEG 436
           L   +  Q     ++L  L+ L L+        LPS +  L++L+ L +  + + H P  
Sbjct: 552 LKEDLWIQSASRFQSLPLLRVLDLSSVKFEGGKLPSSIGGLIHLRFLSLHQAVVSHLPST 611

Query: 437 IWMMQKLMHLNFG-SINLPAPPKNYSSSLKNLIFIS-SLNPSSCTPDILGRLPNVQTLRI 494
           I  ++ +++LN   +I +P    N    +  L ++S  L+    T   LG L N++ L  
Sbjct: 612 IRNLKLMLYLNLHVAIGVPVHVPNVLKEMLELRYLSLPLDMHDKTKLELGDLVNLEYLWC 671

Query: 495 SGDLSHYHSGV-------------------------SKSLCELHKLECLQLVHEGRMW-- 527
               S  HS V                         S SL +  KLE L  ++  + +  
Sbjct: 672 ---FSTQHSSVTDLLRMTKLRFFGVSFSERCTFENLSSSLRQFRKLETLSFIYSRKTYMV 728

Query: 528 -----------QLSRMVLS--------EYQFPPCLTQLSLSNTQLMEDPMPALEKLPHLE 568
                       L ++ L         ++Q PP +  + L    + EDPMP LEKL HL+
Sbjct: 729 DYVGEFVLDFIHLKKLSLGVHLSKIPDQHQLPPHIAHIYLLFCHMEEDPMPILEKLLHLK 788

Query: 569 VLKLKQNSYSERKLACVGSGSFPQLKILHLKSMLWLEEWTMGAGAMPKLESLIVNPCAYL 628
            ++L++ ++  R++ C   G FPQL+ L +     LEEW +  G+MP L  LI++ C  L
Sbjct: 789 SVELRRKAFIGRRMVC-SKGGFPQLRALQISEQSELEEWIVEEGSMPCLRDLIIHSCEKL 847

Query: 629 RKLPEELWCIKSLCKLELHWPQPELRKRL 657
            +LP+ L  + SL +L++   + E +++L
Sbjct: 848 EELPDGLKYVTSLKELKIEGMKREWKEKL 876
Disease resistance protein.
Arabidopsis thaliana (taxid: 3702)
>sp|Q8W4J9|RPP8_ARATH Disease resistance protein RPP8 OS=Arabidopsis thaliana GN=RPP8 PE=1 SV=2 Back     alignment and function description
>sp|Q8W474|DRL7_ARATH Probable disease resistance protein At1g58390 OS=Arabidopsis thaliana GN=At1g58390 PE=2 SV=4 Back     alignment and function description
>sp|Q9XIF0|DRL13_ARATH Putative disease resistance protein At1g59780 OS=Arabidopsis thaliana GN=At1g59780 PE=2 SV=1 Back     alignment and function description
>sp|Q6L3Z7|R1B14_SOLDE Putative late blight resistance protein homolog R1B-14 OS=Solanum demissum GN=R1B-14 PE=3 SV=1 Back     alignment and function description
>sp|P59584|RP8HA_ARATH Disease resistance protein RPH8A OS=Arabidopsis thaliana GN=RPH8A PE=3 SV=1 Back     alignment and function description
>sp|Q9FJK8|RP8L4_ARATH Probable disease resistance RPP8-like protein 4 OS=Arabidopsis thaliana GN=RPP8L4 PE=2 SV=1 Back     alignment and function description
>sp|P0C8S1|RP8L2_ARATH Probable disease resistance RPP8-like protein 2 OS=Arabidopsis thaliana GN=RPP8L2 PE=1 SV=1 Back     alignment and function description
>sp|Q6L403|R1B17_SOLDE Putative late blight resistance protein homolog R1B-17 OS=Solanum demissum GN=R1B-17 PE=3 SV=1 Back     alignment and function description
>sp|Q39214|RPM1_ARATH Disease resistance protein RPM1 OS=Arabidopsis thaliana GN=RPM1 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query663
147766035 902 hypothetical protein VITISV_038742 [Viti 0.757 0.556 0.261 2e-39
359496848 856 PREDICTED: disease resistance RPP8-like 0.630 0.488 0.274 3e-36
359491404 922 PREDICTED: probable disease resistance R 0.594 0.427 0.292 3e-33
359489148 897 PREDICTED: probable disease resistance R 0.788 0.583 0.280 1e-31
224096480 910 nbs-lrr resistance protein [Populus tric 0.819 0.596 0.250 6e-31
359489156 899 PREDICTED: probable disease resistance p 0.794 0.586 0.277 1e-30
356538242 912 PREDICTED: disease resistance RPP8-like 0.782 0.569 0.260 3e-30
224075299 896 nbs-lrr resistance protein [Populus tric 0.769 0.569 0.263 6e-30
356496703 910 PREDICTED: disease resistance RPP8-like 0.782 0.570 0.258 2e-29
413951446 929 hypothetical protein ZEAMMB73_561272 [Ze 0.776 0.554 0.253 2e-29
>gi|147766035|emb|CAN70214.1| hypothetical protein VITISV_038742 [Vitis vinifera] Back     alignment and taxonomy information
 Score =  171 bits (432), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 159/607 (26%), Positives = 263/607 (43%), Gaps = 105/607 (17%)

Query: 136 LTNKKDFIVLDDVFDDREIWNDLEKFLPDNQNGSRVLILV--------TDP--------- 178
           L  K+  IVLDD+++  E+W+DL+   PD  N SRVL            DP         
Sbjct: 273 LRKKRYLIVLDDIWET-EVWDDLKTLFPDVMNASRVLFTTRIRDVAIHADPRSATHELHF 331

Query: 179 ---------FLLTSFELEHGEKIRLNSALVG-GPLIRIKYEGWQFFILHYGSMPLGSYFQ 228
                    FL  +F +E G+ +     L   G  I  K  G    I+  G    G   +
Sbjct: 332 LNQAQSWELFLKKAFPME-GDSVTCPPELERLGTQIVAKCGGLPLAIVIIG----GLLSR 386

Query: 229 GEAMPTIW---------------RHIYSVM-----ELPFHLKVCCLYLCVFRPSIEISTR 268
            E  P++W               R +  ++     +LP++LK C LY  +F   +EI   
Sbjct: 387 KEKXPSVWLRVLQSISWQLNNDSRQLMEILALSYNDLPYYLKPCFLYFGLFPEDLEIPVG 446

Query: 269 QLYQLWVAE-----------------------------VSKRRAGGTIKACYVPGFVYTS 299
           +L  LW+AE                             V+++R  G IK C +   +   
Sbjct: 447 KLVLLWIAEGFVQQRGEESMEDVAEDFLEELVDRSMIQVAEKRYNGKIKMCRIHDLLRDL 506

Query: 300 LFFMAGMMEFV-WMPHMQLETLANVK-RCFILEDLIDEFISLEHSDMYLQSFLNHTLESD 357
               A   +F+  +    ++T    + R   +   ++E++ L H + + +S L+ +   +
Sbjct: 507 AMSEAKECKFLEILDSTNIDTSVTTRARRISVHSSLEEYMKLRHPNPHFRSMLHFSRCEE 566

Query: 358 RLALIDCENFCKKFKHLRVLNLGSAILYQYPPGLENLFHLKYLKLNIPSLNCLPSLLCTL 417
            L     ++  +  K LRVL+L     +  P  +  L HL+YL L    L  LPS +   
Sbjct: 567 SLRREQWKSLFESLKLLRVLDLERVQTHALPKEIRELVHLRYLGLRRTGLQRLPSSVQNF 626

Query: 418 LNLQTLEMPASYIDHSPEGIWMMQKLMHLNFGSINLPA-PPKNYSSSLKNLIFISSLNPS 476
            NLQTL++ A+ +   P  +W M  L HL     ++   PP + S      +   S+  +
Sbjct: 627 CNLQTLDIRATKVSRLPIQLWNMPGLRHLYLEKTSIAGHPPVHVSVMHLQTLSTVSIYGN 686

Query: 477 SCTPDILGRLPNVQTLRISGDLSHYHSGVSKSLCELHKLECLQL---------------- 520
              PD+LG+L N++ L I G  +     +S+ L +L  L+ LQL                
Sbjct: 687 QWIPDLLGKLTNLRKLGIHGYFASQTEALSRCLVKLSNLQNLQLRGTELILEPTIKLLLN 746

Query: 521 ---VHEGRMWQLSRMVLSEYQFPPCLTQLSLSNTQLMEDPMPALEKLPHLEVLKLKQNSY 577
              +H+  +      +    +  P LT++ L  + L++D    L KLP+L++LKL  NS+
Sbjct: 747 QPNIHKLHLSGPIEKLPDPQEIQPNLTKIILEKSLLVQDIFVILGKLPNLQMLKLLINSF 806

Query: 578 SERKLACVGSGSFPQLKILHLKSMLWLEEWTMGAGAMPKLESLIVNPCAYLRKLPEELWC 637
             +++ C  SG FP+L  L L  ++ LEEW +  GAMP L  L+++ C  L+K+PE    
Sbjct: 807 FGKEITCSASG-FPKLHGLELSELVNLEEWRVDDGAMPSLRHLVIDHCDQLKKIPEGFQY 865

Query: 638 IKSLCKL 644
           + +L +L
Sbjct: 866 LTALREL 872

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|359496848|ref|XP_002269653.2| PREDICTED: disease resistance RPP8-like protein 3-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|359491404|ref|XP_002274414.2| PREDICTED: probable disease resistance RPP8-like protein 2-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|359489148|ref|XP_003633887.1| PREDICTED: probable disease resistance RPP8-like protein 4-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|224096480|ref|XP_002334697.1| nbs-lrr resistance protein [Populus trichocarpa] gi|222874531|gb|EEF11662.1| nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|359489156|ref|XP_003633889.1| PREDICTED: probable disease resistance protein RDL6/RF9-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|356538242|ref|XP_003537613.1| PREDICTED: disease resistance RPP8-like protein 3-like [Glycine max] Back     alignment and taxonomy information
>gi|224075299|ref|XP_002304589.1| nbs-lrr resistance protein [Populus trichocarpa] gi|222842021|gb|EEE79568.1| nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356496703|ref|XP_003517205.1| PREDICTED: disease resistance RPP8-like protein 3-like [Glycine max] Back     alignment and taxonomy information
>gi|413951446|gb|AFW84095.1| hypothetical protein ZEAMMB73_561272 [Zea mays] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query663
TAIR|locus:2037639907 AT1G58390 "AT1G58390" [Arabido 0.374 0.273 0.301 3.5e-20
TAIR|locus:2169523901 AT5G35450 [Arabidopsis thalian 0.191 0.140 0.356 3.7e-20
TAIR|locus:2176486908 RPP8 "RECOGNITION OF PERONOSPO 0.256 0.187 0.325 4.5e-20
TAIR|locus:2025916906 AT1G59780 "AT1G59780" [Arabido 0.425 0.311 0.296 9.9e-20
TAIR|locus:5049561821049 AT1G58848 [Arabidopsis thalian 0.236 0.149 0.370 1.5e-17
TAIR|locus:28269781049 AT1G59218 [Arabidopsis thalian 0.236 0.149 0.370 1.5e-17
TAIR|locus:2152536908 AT5G48620 [Arabidopsis thalian 0.205 0.149 0.352 4e-17
TAIR|locus:2037623899 AT1G58410 [Arabidopsis thalian 0.401 0.295 0.293 4.2e-17
TAIR|locus:504956184 1017 AT1G58807 "AT1G58807" [Arabido 0.384 0.250 0.313 2.1e-16
TAIR|locus:2827038 1017 AT1G59124 "AT1G59124" [Arabido 0.384 0.250 0.313 2.1e-16
TAIR|locus:2037639 AT1G58390 "AT1G58390" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 227 (85.0 bits), Expect = 3.5e-20, Sum P(2) = 3.5e-20
 Identities = 83/275 (30%), Positives = 126/275 (45%)

Query:   388 PPGLENLFHLKYLKLNIXXXXX--XXXXXXXXXXXXXXEMPASYIDHSPEGIWMMQKLMH 445
             P G+ NL HL+YL L                       ++   +I   P+    M +L +
Sbjct:   602 PFGIGNLIHLRYLSLQDAKVSHLPSSLGNLMLLIYLNLDVDTEFI-FVPDVFMRMHELRY 660

Query:   446 LNFGSINLPAPPK---NYSSSLKNLIFISSLNPSSCTPDILGRLPNVQTLRISGDLSHYH 502
             L    +++    +        L+ L++ S+ + SS   D+ G +  + TL I        
Sbjct:   661 LKL-PLHMHKKTRLSLRNLVKLETLVYFSTWHSSS--KDLCG-MTRLMTLAIRLTRVTST 716

Query:   503 SGVSKSLCELHKLECLQLV--HEGRMWQ---------LSRMVLSEYQ-----FPPCLTQL 546
               +S S+  L  LE L +V  H  +M +         L  ++L  Y      FP  LT +
Sbjct:   717 ETLSASISGLRNLEYLYIVGTHSKKMREEGIVLDFIHLKHLLLDLYMPRQQHFPSRLTFV 776

Query:   547 SLSNTQLMEDPMPALEKLPHLEVLKLKQNSYSERKLACVGSGSFPQLKILHLKSMLWLEE 606
              LS   L EDPMP LEKL HL+ + L + SY  R++ C G G FPQLK L +  +   EE
Sbjct:   777 KLSECGLEEDPMPILEKLLHLKGVILLKGSYCGRRMVCSGGG-FPQLKKLEIVGLNKWEE 835

Query:   607 WTMGAGAMPKLESLIVNPCAYLRKLPEELWCIKSL 641
             W +  G+MP LE+L +  C  L+++P+ L  I SL
Sbjct:   836 WLVEEGSMPLLETLSILDCEELKEIPDGLRFIYSL 870
GO:0005575 "cellular_component" evidence=ND
GO:0006952 "defense response" evidence=IEA;ISS
GO:0043531 "ADP binding" evidence=IEA
TAIR|locus:2169523 AT5G35450 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2176486 RPP8 "RECOGNITION OF PERONOSPORA PARASITICA 8" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2025916 AT1G59780 "AT1G59780" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:504956182 AT1G58848 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2826978 AT1G59218 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2152536 AT5G48620 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2037623 AT1G58410 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:504956184 AT1G58807 "AT1G58807" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2827038 AT1G59124 "AT1G59124" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query663
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 8e-06
pfam00931285 pfam00931, NB-ARC, NB-ARC domain 9e-06
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information 
 Score = 48.4 bits (115), Expect = 8e-06
 Identities = 67/343 (19%), Positives = 113/343 (32%), Gaps = 45/343 (13%)

Query: 315 MQLETLANVKRCFILEDLIDEFISLEHSDMYLQS-FLNHTLESDRLALIDCENFCKKFKH 373
             L   +++ R   L+ L    IS       L +     +L+ +   L    +   +  +
Sbjct: 58  TLLLLPSSLSRLLSLDLLSPSGISSLDGSENLLNLLPLPSLDLNLNRLRSNISELLELTN 117

Query: 374 LRVLNLGSAILYQYPPGLENL-FHLKYLKLNIPSLNCLPSLLCTLLNLQTLEMPASYIDH 432
           L  L+L +  +   PP +  L  +LK L L+   +  LPS L  L NL+ L++  + +  
Sbjct: 118 LTSLDLDNNNITDIPPLIGLLKSNLKELDLSDNKIESLPSPLRNLPNLKNLDLSFNDLSD 177

Query: 433 SPEGIWMMQKLMHLNFGSINLP--APPKNYSSSLKNLIFISSLNPSSCTPDILGRLPNVQ 490
            P+ +  +  L +L+     +    P     S+L+ L    S N        L  L N+ 
Sbjct: 178 LPKLLSNLSNLNNLDLSGNKISDLPPEIELLSALEELDL--SNNSIIELLSSLSNLKNLS 235

Query: 491 TLRISGDLSHYHSGVSKSLCELHKLECLQLVHEGRMWQLSRMVLSEYQFPPCLTQLSLSN 550
            L +S                 +KLE L                        L  L LSN
Sbjct: 236 GLELSN----------------NKLEDLPESIGN---------------LSNLETLDLSN 264

Query: 551 TQLMEDPMPALEKLPHLEVLKLKQNSYSERKLACVGSGSFPQLKILHLKSMLWLEEWTMG 610
            Q+    + +L  L +L  L L  NS S             +L +  L +          
Sbjct: 265 NQISS--ISSLGSLTNLRELDLSGNSLSNALPLIALLLLLLELLLNLLLT------LKAL 316

Query: 611 AGAMPKLESLIVNPCAYLRKLPEELWCIKSLCKLELHWPQPEL 653
              +  +              PE L  ++SL  L       + 
Sbjct: 317 ELKLNSILLNNNILSNGETSSPEALSILESLNNLWTLDNALDE 359

Length = 394
>gnl|CDD|216202 pfam00931, NB-ARC, NB-ARC domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 663
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 100.0
PLN03210 1153 Resistant to P. syringae 6; Provisional 100.0
PF00931287 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is 99.98
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.94
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.94
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.91
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.89
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.89
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.87
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.82
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.8
KOG0472 565 consensus Leucine-rich repeat protein [Function un 99.77
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.68
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.63
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.63
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.62
KOG0617264 consensus Ras suppressor protein (contains leucine 99.57
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.56
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.54
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.53
KOG0617264 consensus Ras suppressor protein (contains leucine 99.49
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.45
KOG4237 498 consensus Extracellular matrix protein slit, conta 99.41
KOG4237 498 consensus Extracellular matrix protein slit, conta 99.39
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 99.31
KOG4341483 consensus F-box protein containing LRR [General fu 99.05
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.03
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.03
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 99.0
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 98.95
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.95
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 98.94
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.93
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.9
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.89
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.89
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.87
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.82
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.75
KOG4341483 consensus F-box protein containing LRR [General fu 98.69
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.68
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.3
PLN03150623 hypothetical protein; Provisional 98.28
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.28
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.26
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.14
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.11
PLN03150623 hypothetical protein; Provisional 98.09
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.07
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 97.99
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.87
PRK00411394 cdc6 cell division control protein 6; Reviewed 97.86
cd01128249 rho_factor Transcription termination factor rho is 97.85
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.81
PRK15386 426 type III secretion protein GogB; Provisional 97.79
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.76
PRK15386426 type III secretion protein GogB; Provisional 97.74
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 97.72
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 97.71
TIGR03015269 pepcterm_ATPase putative secretion ATPase, PEP-CTE 97.71
TIGR02928365 orc1/cdc6 family replication initiation protein. M 97.69
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 97.66
PRK09376416 rho transcription termination factor Rho; Provisio 97.64
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.61
KOG1947482 consensus Leucine rich repeat proteins, some prote 97.59
cd00009151 AAA The AAA+ (ATPases Associated with a wide varie 97.55
PRK04841 903 transcriptional regulator MalT; Provisional 97.48
PF05729166 NACHT: NACHT domain 97.46
PF13191185 AAA_16: AAA ATPase domain; PDB: 2V1U_A. 97.44
TIGR00767415 rho transcription termination factor Rho. Members 97.4
KOG1947482 consensus Leucine rich repeat proteins, some prote 97.39
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.38
PF13173128 AAA_14: AAA domain 97.3
PF01637234 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 97.24
PF13401131 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S 97.22
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.18
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.17
PTZ00202550 tuzin; Provisional 97.03
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.0
COG1474366 CDC6 Cdc6-related protein, AAA superfamily ATPase 96.94
KOG2543438 consensus Origin recognition complex, subunit 5 [R 96.93
PTZ001121164 origin recognition complex 1 protein; Provisional 96.92
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.76
PRK11331459 5-methylcytosine-specific restriction enzyme subun 96.45
PF04665241 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 96.41
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.4
TIGR02903615 spore_lon_C ATP-dependent protease, Lon family. Me 96.34
KOG2123388 consensus Uncharacterized conserved protein [Funct 96.29
PRK13342413 recombination factor protein RarA; Reviewed 96.29
PRK00440319 rfc replication factor C small subunit; Reviewed 96.16
PF00308219 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 96.13
KOG2123388 consensus Uncharacterized conserved protein [Funct 96.12
KOG2227529 consensus Pre-initiation complex, subunit CDC6, AA 95.86
PRK08116268 hypothetical protein; Validated 95.82
COG2256436 MGS1 ATPase related to the helicase subunit of the 95.77
PRK10536262 hypothetical protein; Provisional 95.76
COG2909 894 MalT ATP-dependent transcriptional regulator [Tran 95.73
PF05621302 TniB: Bacterial TniB protein; InterPro: IPR008868 95.72
PRK12402337 replication factor C small subunit 2; Reviewed 95.7
cd01133274 F1-ATPase_beta F1 ATP synthase beta subunit, nucle 95.68
PRK13341725 recombination factor protein RarA/unknown domain f 95.65
PRK06893229 DNA replication initiation factor; Validated 95.61
TIGR03420226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Me 95.52
KOG2028554 consensus ATPase related to the helicase subunit o 95.49
PRK07003 830 DNA polymerase III subunits gamma and tau; Validat 95.49
PRK08118167 topology modulation protein; Reviewed 95.43
PRK06645507 DNA polymerase III subunits gamma and tau; Validat 95.38
PRK08727233 hypothetical protein; Validated 95.36
PRK05564313 DNA polymerase III subunit delta'; Validated 95.34
PHA02544316 44 clamp loader, small subunit; Provisional 95.33
PRK14963504 DNA polymerase III subunits gamma and tau; Provisi 95.31
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 95.05
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.03
TIGR01242364 26Sp45 26S proteasome subunit P45 family. Many pro 94.98
TIGR00635305 ruvB Holliday junction DNA helicase, RuvB subunit. 94.97
PRK08181269 transposase; Validated 94.91
PLN03025319 replication factor C subunit; Provisional 94.84
PRK14949 944 DNA polymerase III subunits gamma and tau; Provisi 94.71
PRK14960702 DNA polymerase III subunits gamma and tau; Provisi 94.7
PRK14961363 DNA polymerase III subunits gamma and tau; Provisi 94.68
TIGR00362405 DnaA chromosomal replication initiator protein Dna 94.62
PRK12323700 DNA polymerase III subunits gamma and tau; Provisi 94.58
PRK00149450 dnaA chromosomal replication initiation protein; R 94.35
PRK08691709 DNA polymerase III subunits gamma and tau; Validat 94.34
PRK14957546 DNA polymerase III subunits gamma and tau; Provisi 94.32
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 94.31
PF07693325 KAP_NTPase: KAP family P-loop domain; InterPro: IP 94.15
COG1373398 Predicted ATPase (AAA+ superfamily) [General funct 94.03
PRK09183259 transposase/IS protein; Provisional 93.89
PRK08939306 primosomal protein DnaI; Reviewed 93.86
KOG3864221 consensus Uncharacterized conserved protein [Funct 93.84
PRK14956484 DNA polymerase III subunits gamma and tau; Provisi 93.83
PRK06526254 transposase; Provisional 93.8
PRK12608380 transcription termination factor Rho; Provisional 93.8
PRK14088440 dnaA chromosomal replication initiation protein; P 93.79
PRK12377248 putative replication protein; Provisional 93.77
PRK04195482 replication factor C large subunit; Provisional 93.68
PRK14969527 DNA polymerase III subunits gamma and tau; Provisi 93.48
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 93.46
TIGR02639731 ClpA ATP-dependent Clp protease ATP-binding subuni 93.45
PRK14951618 DNA polymerase III subunits gamma and tau; Provisi 93.44
TIGR03346852 chaperone_ClpB ATP-dependent chaperone ClpB. Membe 93.35
smart00382148 AAA ATPases associated with a variety of cellular 93.32
PRK14087450 dnaA chromosomal replication initiation protein; P 93.23
PF05673249 DUF815: Protein of unknown function (DUF815); Inte 93.21
TIGR02880284 cbbX_cfxQ probable Rubsico expression protein CbbX 93.21
COG0593408 DnaA ATPase involved in DNA replication initiation 93.01
CHL00095821 clpC Clp protease ATP binding subunit 93.01
PRK14086617 dnaA chromosomal replication initiation protein; P 92.98
PRK06696223 uridine kinase; Validated 92.9
PRK14958509 DNA polymerase III subunits gamma and tau; Provisi 92.88
PRK07994647 DNA polymerase III subunits gamma and tau; Validat 92.88
TIGR03345852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. M 92.85
TIGR02639731 ClpA ATP-dependent Clp protease ATP-binding subuni 92.73
PRK08084235 DNA replication initiation factor; Provisional 92.61
PRK14970367 DNA polymerase III subunits gamma and tau; Provisi 92.47
PRK07261171 topology modulation protein; Provisional 92.47
KOG3864221 consensus Uncharacterized conserved protein [Funct 92.46
PRK07952244 DNA replication protein DnaC; Validated 92.34
PRK14964491 DNA polymerase III subunits gamma and tau; Provisi 92.2
TIGR02640262 gas_vesic_GvpN gas vesicle protein GvpN. Members o 92.07
PF02562205 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH 92.05
PF01695178 IstB_IS21: IstB-like ATP binding protein; InterPro 92.04
PRK05896605 DNA polymerase III subunits gamma and tau; Validat 91.96
PRK12422445 chromosomal replication initiation protein; Provis 91.96
PRK10865857 protein disaggregation chaperone; Provisional 91.92
COG0572218 Udk Uridine kinase [Nucleotide transport and metab 91.86
PRK00080328 ruvB Holliday junction DNA helicase RuvB; Reviewed 91.81
PRK06305451 DNA polymerase III subunits gamma and tau; Validat 91.77
CHL00181287 cbbX CbbX; Provisional 91.74
COG1875436 NYN ribonuclease and ATPase of PhoH family domains 91.68
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 91.34
CHL00095821 clpC Clp protease ATP binding subunit 91.33
COG2607287 Predicted ATPase (AAA+ superfamily) [General funct 91.29
PRK10865857 protein disaggregation chaperone; Provisional 91.22
TIGR00602637 rad24 checkpoint protein rad24. This family is bas 91.18
PRK11034758 clpA ATP-dependent Clp protease ATP-binding subuni 91.12
PRK14962472 DNA polymerase III subunits gamma and tau; Provisi 91.04
PRK06835329 DNA replication protein DnaC; Validated 91.0
TIGR03346852 chaperone_ClpB ATP-dependent chaperone ClpB. Membe 90.98
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 90.92
PRK07471365 DNA polymerase III subunit delta'; Validated 90.84
PRK09111598 DNA polymerase III subunits gamma and tau; Validat 90.82
PF00004132 AAA: ATPase family associated with various cellula 90.78
smart00763361 AAA_PrkA PrkA AAA domain. This is a family of PrkA 90.59
TIGR03689512 pup_AAA proteasome ATPase. In the Actinobacteria, 90.22
PRK06921266 hypothetical protein; Provisional 90.03
PRK07940394 DNA polymerase III subunit delta'; Validated 90.01
cd03281213 ABC_MSH5_euk MutS5 homolog in eukaryotes. The MutS 89.94
PF05496233 RuvB_N: Holliday junction DNA helicase ruvB N-term 89.83
PRK14955397 DNA polymerase III subunits gamma and tau; Provisi 89.79
COG1484254 DnaC DNA replication protein [DNA replication, rec 89.55
PRK07667193 uridine kinase; Provisional 89.47
PRK05642234 DNA replication initiation factor; Validated 89.37
PRK08927442 fliI flagellum-specific ATP synthase; Validated 89.34
KOG0473326 consensus Leucine-rich repeat protein [Function un 89.28
KOG3308225 consensus Uncharacterized protein of the uridine k 89.19
PRK07764 824 DNA polymerase III subunits gamma and tau; Validat 89.19
PRK14950585 DNA polymerase III subunits gamma and tau; Provisi 89.15
PF13207121 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6 89.01
PF13604196 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL 88.96
cd00561159 CobA_CobO_BtuR ATP:corrinoid adenosyltransferase B 88.95
PRK09112351 DNA polymerase III subunit delta'; Validated 88.94
PTZ00301210 uridine kinase; Provisional 88.87
cd03247178 ABCC_cytochrome_bd The CYD subfamily implicated in 88.67
TIGR02881261 spore_V_K stage V sporulation protein K. Members o 88.63
TIGR00678188 holB DNA polymerase III, delta' subunit. At positi 88.53
KOG0735952 consensus AAA+-type ATPase [Posttranslational modi 88.36
cd01123235 Rad51_DMC1_radA Rad51_DMC1_radA,B. This group of r 88.36
cd01131198 PilT Pilus retraction ATPase PilT. PilT is a nucle 88.32
COG4618580 ArpD ABC-type protease/lipase transport system, AT 88.03
PF00485194 PRK: Phosphoribulokinase / Uridine kinase family; 87.9
TIGR02397355 dnaX_nterm DNA polymerase III, subunit gamma and t 87.81
KOG09241042 consensus mRNA splicing factor ATP-dependent RNA h 87.78
PRK14954620 DNA polymerase III subunits gamma and tau; Provisi 87.5
TIGR02858270 spore_III_AA stage III sporulation protein AA. Mem 87.49
cd03214180 ABC_Iron-Siderophores_B12_Hemin ABC transporters, 87.38
PTZ00454398 26S protease regulatory subunit 6B-like protein; P 87.3
PRK08451535 DNA polymerase III subunits gamma and tau; Validat 87.17
PRK06002450 fliI flagellum-specific ATP synthase; Validated 87.08
PRK08149428 ATP synthase SpaL; Validated 86.94
PRK08972444 fliI flagellum-specific ATP synthase; Validated 86.67
PF00006215 ATP-synt_ab: ATP synthase alpha/beta family, nucle 86.55
cd01132274 F1_ATPase_alpha F1 ATP synthase alpha, central dom 86.43
PRK12678672 transcription termination factor Rho; Provisional 86.26
cd01135276 V_A-ATPase_B V/A-type ATP synthase (non-catalytic) 86.24
KOG1514767 consensus Origin recognition complex, subunit 1, a 86.23
PRK07594433 type III secretion system ATPase SsaN; Validated 86.22
COG1121254 ZnuC ABC-type Mn/Zn transport systems, ATPase comp 85.72
PRK08903227 DnaA regulatory inactivator Hda; Validated 85.6
PRK14953486 DNA polymerase III subunits gamma and tau; Provisi 85.48
PRK14952584 DNA polymerase III subunits gamma and tau; Provisi 85.45
PF14516331 AAA_35: AAA-like domain 85.44
PF12775272 AAA_7: P-loop containing dynein motor region D3; P 85.32
COG1124252 DppF ABC-type dipeptide/oligopeptide/nickel transp 85.25
PRK14959624 DNA polymerase III subunits gamma and tau; Provisi 85.23
PRK11034758 clpA ATP-dependent Clp protease ATP-binding subuni 85.13
cd03282204 ABC_MSH4_euk MutS4 homolog in eukaryotes. The MutS 85.07
PRK14965576 DNA polymerase III subunits gamma and tau; Provisi 84.98
PF03205140 MobB: Molybdopterin guanine dinucleotide synthesis 84.97
TIGR03345852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. M 84.94
COG4608268 AppF ABC-type oligopeptide transport system, ATPas 84.9
PLN02348395 phosphoribulokinase 84.84
TIGR03498418 FliI_clade3 flagellar protein export ATPase FliI. 84.81
cd01129264 PulE-GspE PulE/GspE The type II secretory pathway 84.75
PRK14971614 DNA polymerase III subunits gamma and tau; Provisi 84.68
PF00158168 Sigma54_activat: Sigma-54 interaction domain; Inte 84.68
PTZ00185574 ATPase alpha subunit; Provisional 84.67
PRK13531498 regulatory ATPase RavA; Provisional 84.66
TIGR01420343 pilT_fam pilus retraction protein PilT. This model 84.54
PF13671143 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1 84.45
PRK09099441 type III secretion system ATPase; Provisional 84.44
PRK09361225 radB DNA repair and recombination protein RadB; Pr 84.36
cd01394218 radB RadB. The archaeal protein radB shares simila 84.3
cd01136326 ATPase_flagellum-secretory_path_III Flagellum-spec 84.06
cd03220224 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transpo 84.05
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 84.03
smart0037026 LRR Leucine-rich repeats, outliers. 84.03
PRK14948620 DNA polymerase III subunits gamma and tau; Provisi 83.94
PRK12597461 F0F1 ATP synthase subunit beta; Provisional 83.74
PF03969362 AFG1_ATPase: AFG1-like ATPase; InterPro: IPR005654 83.7
PRK09270229 nucleoside triphosphate hydrolase domain-containin 83.53
PRK05480209 uridine/cytidine kinase; Provisional 83.51
TIGR01040466 V-ATPase_V1_B V-type (H+)-ATPase V1, B subunit. Th 83.49
TIGR03497413 FliI_clade2 flagellar protein export ATPase FliI. 83.31
PF14532138 Sigma54_activ_2: Sigma-54 interaction domain; PDB: 83.26
PRK06647563 DNA polymerase III subunits gamma and tau; Validat 83.21
TIGR02030337 BchI-ChlI magnesium chelatase ATPase subunit I. Th 82.98
PRK05541176 adenylylsulfate kinase; Provisional 82.98
TIGR00235207 udk uridine kinase. Model contains a number of lon 82.96
cd03263220 ABC_subfamily_A The ABCA subfamily mediates the tr 82.83
PRK08233182 hypothetical protein; Provisional 82.64
PRK15455644 PrkA family serine protein kinase; Provisional 82.59
PRK11608326 pspF phage shock protein operon transcriptional ac 82.51
TIGR03496411 FliI_clade1 flagellar protein export ATPase FliI. 82.41
TIGR01241495 FtsH_fam ATP-dependent metalloprotease FtsH. HflB( 82.36
PRK09280463 F0F1 ATP synthase subunit beta; Validated 82.18
cd03228171 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein 82.02
PRK09544251 znuC high-affinity zinc transporter ATPase; Review 82.0
cd03231201 ABC_CcmA_heme_exporter CcmA, the ATP-binding compo 82.0
cd01393226 recA_like RecA is a bacterial enzyme which has rol 81.97
PRK03992389 proteasome-activating nucleotidase; Provisional 81.77
KOG0473326 consensus Leucine-rich repeat protein [Function un 81.67
cd03237246 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 o 81.57
PRK07133725 DNA polymerase III subunits gamma and tau; Validat 81.48
TIGR01041458 ATP_syn_B_arch ATP synthase archaeal, B subunit. A 81.45
PRK06936439 type III secretion system ATPase; Provisional 81.39
KOG4308478 consensus LRR-containing protein [Function unknown 81.34
COG1428216 Deoxynucleoside kinases [Nucleotide transport and 81.33
PRK05439311 pantothenate kinase; Provisional 81.33
cd02025220 PanK Pantothenate kinase (PanK) catalyzes the phos 81.31
cd03238176 ABC_UvrA The excision repair protein UvrA; Nucleot 81.24
PRK05922434 type III secretion system ATPase; Validated 81.21
PLN00020413 ribulose bisphosphate carboxylase/oxygenase activa 80.92
PTZ00361438 26 proteosome regulatory subunit 4-like protein; P 80.72
smart0037026 LRR Leucine-rich repeats, outliers. 80.7
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 80.7
cd01120165 RecA-like_NTPases RecA-like NTPases. This family i 80.63
COG1763161 MobB Molybdopterin-guanine dinucleotide biosynthes 80.58
cd02024187 NRK1 Nicotinamide riboside kinase (NRK) is an enzy 80.57
PRK05688451 fliI flagellum-specific ATP synthase; Validated 80.49
KOG0734752 consensus AAA+-type ATPase containing the peptidas 80.33
COG3172187 NadR Predicted ATPase/kinase involved in NAD metab 80.3
COG0465596 HflB ATP-dependent Zn proteases [Posttranslational 80.25
PRK07721438 fliI flagellum-specific ATP synthase; Validated 80.18
COG0468279 RecA RecA/RadA recombinase [DNA replication, recom 80.07
TIGR03522301 GldA_ABC_ATP gliding motility-associated ABC trans 80.03
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information 
Probab=100.00  E-value=8.3e-66  Score=579.75  Aligned_cols=574  Identities=24%  Similarity=0.326  Sum_probs=426.2

Q ss_pred             cchhhcHHHHHHHHhcCCCCceEEEEEec----chhhHHHHHhcCCCccccCCCCcc-ccCCceeeccCCCcceEeCCCc
Q 037018           22 KTVKVKVKAVLVWLFMLDSMWLQFLTAVA----YKTAFVADIYNNNVDLSAMNPKLR-VPKRFINKAFPVAFPVDVNCAC   96 (663)
Q Consensus        22 ~G~~~~~~~i~~~L~~~~~~~~~vi~i~G----GKTtla~~v~~~~~~~~~~~~~~~-~~~~F~~~~~~~~~~v~vs~~~   96 (663)
                      ||.+..++++.+.|.+++.   ++|||+|    ||||||+.|||+.          . ++.+||..+|     |+||+.|
T Consensus       161 VG~e~~~~kl~~~L~~d~~---~iv~i~GMGGvGKTTL~~qi~N~~----------~~v~~~Fd~~iW-----V~VSk~f  222 (889)
T KOG4658|consen  161 VGLETMLEKLWNRLMEDDV---GIVGIYGMGGVGKTTLARQIFNKF----------DEVGNHFDGVIW-----VVVSKEF  222 (889)
T ss_pred             ccHHHHHHHHHHHhccCCC---CEEEEECCCcccHHHHHHHHhccc----------chhcccCceEEE-----EEEcccc
Confidence            9999999999999999974   8999999    9999999999998          6 9999999999     9999999


Q ss_pred             chhHHHHHHHHHHHhCCCCCcchhhhhHhhHHHHHHHHhhcCCcEEEEEeCCCCChhhHHHHHhhCCCCCCCceEEEEEe
Q 037018           97 NAQLNHILDDIIKSVMPPSRVNVIISEDYKLKTIILRDYLTNKKDFIVLDDVFDDREIWNDLEKFLPDNQNGSRVLILVT  176 (663)
Q Consensus        97 ~~~~~~l~~~i~~~l~~~~~~~~~~~~~~~l~~~~l~~~L~~kr~LlVLDdv~~~~~~~~~l~~~~~~~~~gskIiiT~r  176 (663)
                      +  ..+++++|+..++..+..+.-.. .+++ +.+|.+.|++|||+|||||||+ ..+|+.++.++|...+||||++|||
T Consensus       223 ~--~~~iq~~Il~~l~~~~~~~~~~~-~~~~-~~~i~~~L~~krfllvLDDIW~-~~dw~~I~~~~p~~~~g~KvvlTTR  297 (889)
T KOG4658|consen  223 T--TRKIQQTILERLGLLDEEWEDKE-EDEL-ASKLLNLLEGKRFLLVLDDIWE-EVDWDKIGVPFPSRENGSKVVLTTR  297 (889)
T ss_pred             c--HHhHHHHHHHHhccCCcccchhh-HHHH-HHHHHHHhccCceEEEEecccc-cccHHhcCCCCCCccCCeEEEEEec
Confidence            9  99999999999988654432222 3677 8999999999999999999999 9999999999999999999999999


Q ss_pred             CCCCC-------ceEecc----------------------------ccccc-------hhHHHHHhhccc-cCChhhHHH
Q 037018          177 DPFLL-------TSFELE----------------------------HGEKI-------RLNSALVGGPLI-RIKYEGWQF  213 (663)
Q Consensus       177 ~~~~~-------~~~~l~----------------------------~~~~i-------Plal~~~g~~L~-~~~~~~W~~  213 (663)
                      +..+.       ..++++                            +|+++       |||+.++|+.|+ |.+.++|+.
T Consensus       298 s~~V~~~~m~~~~~~~v~~L~~~eaW~LF~~~v~~~~~~~~~~i~~lak~v~~kC~GLPLAl~viG~~ma~K~t~~eW~~  377 (889)
T KOG4658|consen  298 SEEVCGRAMGVDYPIEVECLTPEEAWDLFQKKVGPNTLGSHPDIEELAKEVAEKCGGLPLALNVLGGLLACKKTVQEWRR  377 (889)
T ss_pred             cHhhhhccccCCccccccccCccccHHHHHHhhccccccccccHHHHHHHHHHHhCChHHHHHHHHHHhcCCCcHHHHHH
Confidence            76543       233333                            33333       999999999999 988999999


Q ss_pred             HHhhcCCCCCCCCcCCC---Chhhhhhhc-ceeCCCChhhHHHHhhhcccCCCceechHHHHHHHHHcCC-C----C---
Q 037018          214 FILHYGSMPLGSYFQGE---AMPTIWRHI-YSVMELPFHLKVCCLYLCVFRPSIEISTRQLYQLWVAEVS-K----R---  281 (663)
Q Consensus       214 ~~~~~~~~~l~~~~~~~---~~~~i~~~l-~sy~~L~~~~k~cfl~~a~Fp~~~~i~~~~Li~~Wi~~g~-~----g---  281 (663)
                      +.+.     +.+....+   ..+.++.-+ +|||+||+++|.||+|||+||||++|++++||.+|+|||| +    |   
T Consensus       378 ~~~~-----l~s~~~~~~~~~~~~i~~iLklSyd~L~~~lK~CFLycalFPED~~I~~e~Li~yWiaEGfi~~~~~~~~~  452 (889)
T KOG4658|consen  378 ALNV-----LKSSLAADFSGMEESILPILKLSYDNLPEELKSCFLYCALFPEDYEIKKEKLIEYWIAEGFIDPLDGGETA  452 (889)
T ss_pred             HHcc-----ccccccCCCCchhhhhHHhhhccHhhhhHHHHHHHHhhccCCcccccchHHHHHHHHhccCcCccccccch
Confidence            9999     87775444   235664555 9999999999999999999999999999999999999998 3    1   


Q ss_pred             --------------------CCCCccceEEcCHHHHHHHHHhcc-----cCceEEecCCC------ccCCCceeEEEEEe
Q 037018          282 --------------------RAGGTIKACYVPGFVYTSLFFMAG-----MMEFVWMPHMQ------LETLANVKRCFILE  330 (663)
Q Consensus       282 --------------------~~~~~~~~~~mhdll~dl~~~~~~-----~~~~~~~~~~~------~~~~~~~r~lsi~~  330 (663)
                                          ...+...+|+|||++||+|.++|+     +++++...+.+      ...+..+|+++++.
T Consensus       453 ~d~G~~~i~~LV~~~Ll~~~~~~~~~~~~kmHDvvRe~al~ias~~~~~~e~~iv~~~~~~~~~~~~~~~~~~rr~s~~~  532 (889)
T KOG4658|consen  453 EDVGYDYIEELVRASLLIEERDEGRKETVKMHDVVREMALWIASDFGKQEENQIVSDGVGLSEIPQVKSWNSVRRMSLMN  532 (889)
T ss_pred             hcchHHHHHHHHHHHHHhhcccccceeEEEeeHHHHHHHHHHhccccccccceEEECCcCccccccccchhheeEEEEec
Confidence                                112567899999999999999999     66655444311      33456789999999


Q ss_pred             cccccccccccC-CCcccEEEeecCccccccccch-hHHhcCCCcccEEEecCCc-CcccCccCCCCCCcCeEeccCCCC
Q 037018          331 DLIDEFISLEHS-DMYLQSFLNHTLESDRLALIDC-ENFCKKFKHLRVLNLGSAI-LYQYPPGLENLFHLKYLKLNIPSL  407 (663)
Q Consensus       331 ~~~~~~~~~~~~-~~~lr~L~l~~~~~~~~~~~~l-~~~~~~l~~Lr~L~L~~~~-l~~lp~~~~~l~~L~~L~L~~~~i  407 (663)
                      +.+....  ... ++++++|.+.++...   ...+ .+||..+|.||+|||++|. +..+|..++.+.+||||+++++.+
T Consensus       533 ~~~~~~~--~~~~~~~L~tLll~~n~~~---l~~is~~ff~~m~~LrVLDLs~~~~l~~LP~~I~~Li~LryL~L~~t~I  607 (889)
T KOG4658|consen  533 NKIEHIA--GSSENPKLRTLLLQRNSDW---LLEISGEFFRSLPLLRVLDLSGNSSLSKLPSSIGELVHLRYLDLSDTGI  607 (889)
T ss_pred             cchhhcc--CCCCCCccceEEEeecchh---hhhcCHHHHhhCcceEEEECCCCCccCcCChHHhhhhhhhcccccCCCc
Confidence            9866665  455 789999999998630   1234 6777999999999999877 779999999999999999999999


Q ss_pred             ccchhhhcccccccEeeccCC-cccccchhhhcCcCCcEEEccCCCC--CCCCCCCcCCCCCCcEeeCcCCCCCChhhcC
Q 037018          408 NCLPSLLCTLLNLQTLEMPAS-YIDHSPEGIWMMQKLMHLNFGSINL--PAPPKNYSSSLKNLIFISSLNPSSCTPDILG  484 (663)
Q Consensus       408 ~~lp~~i~~L~~L~~L~L~~~-~l~~lp~~l~~l~~L~~L~l~~~~~--~~~~~~~l~~l~~L~~L~l~~~~~~~~~~l~  484 (663)
                      ..+|..+++|+.|.+|++..+ .+..+|.....+++|++|.+.....  .......+..+.+|+.+.....+..+...+.
T Consensus       608 ~~LP~~l~~Lk~L~~Lnl~~~~~l~~~~~i~~~L~~Lr~L~l~~s~~~~~~~~l~el~~Le~L~~ls~~~~s~~~~e~l~  687 (889)
T KOG4658|consen  608 SHLPSGLGNLKKLIYLNLEVTGRLESIPGILLELQSLRVLRLPRSALSNDKLLLKELENLEHLENLSITISSVLLLEDLL  687 (889)
T ss_pred             cccchHHHHHHhhheeccccccccccccchhhhcccccEEEeeccccccchhhHHhhhcccchhhheeecchhHhHhhhh
Confidence            999999999999999999999 6677776677799999999983321  1122222334444444443322221112223


Q ss_pred             CCCCcc----EEEeecCCCccccchhhhhcCCCCCCEEEEeecCccc--------------------------ccccccc
Q 037018          485 RLPNVQ----TLRISGDLSHYHSGVSKSLCELHKLECLQLVHEGRMW--------------------------QLSRMVL  534 (663)
Q Consensus       485 ~l~~L~----~L~l~~~~~~~~~~~~~~l~~l~~L~~L~l~~~~~l~--------------------------~lp~~~~  534 (663)
                      .+++|+    .+.+.++   .....+..+..+.+|+.|.+.+|+..+                          ..|.+++
T Consensus       688 ~~~~L~~~~~~l~~~~~---~~~~~~~~~~~l~~L~~L~i~~~~~~e~~~~~~~~~~~~~~f~~l~~~~~~~~~~~r~l~  764 (889)
T KOG4658|consen  688 GMTRLRSLLQSLSIEGC---SKRTLISSLGSLGNLEELSILDCGISEIVIEWEESLIVLLCFPNLSKVSILNCHMLRDLT  764 (889)
T ss_pred             hhHHHHHHhHhhhhccc---ccceeecccccccCcceEEEEcCCCchhhcccccccchhhhHHHHHHHHhhccccccccc
Confidence            333333    2222111   223334444455555555555533211                          0011112


Q ss_pred             ccccCCCCceEEEEecccCCCCChhhhcCCCCCcEEEeecCCCCCceeeecCCCCCCcccEEEccCCCCcccccccc---
Q 037018          535 SEYQFPPCLTQLSLSNTQLMEDPMPALEKLPHLEVLKLKQNSYSERKLACVGSGSFPQLKILHLKSMLWLEEWTMGA---  611 (663)
Q Consensus       535 ~l~~~l~~L~~L~L~~~~l~~~~~~~l~~l~~L~~L~L~~~~~~~~~~~~~~~~~~~~L~~L~L~~~~~l~~l~~~~---  611 (663)
                      |... .++|+.|.+..|...+.+++....+..+..+.+..+.+.+...... .++|+++..+.+.+ +.+..+....   
T Consensus       765 ~~~f-~~~L~~l~l~~~~~~e~~i~~~k~~~~l~~~i~~f~~~~~l~~~~~-l~~l~~i~~~~l~~-~~l~~~~ve~~p~  841 (889)
T KOG4658|consen  765 WLLF-APHLTSLSLVSCRLLEDIIPKLKALLELKELILPFNKLEGLRMLCS-LGGLPQLYWLPLSF-LKLEELIVEECPK  841 (889)
T ss_pred             hhhc-cCcccEEEEecccccccCCCHHHHhhhcccEEecccccccceeeec-CCCCceeEecccCc-cchhheehhcCcc
Confidence            4444 7888888888887777777777777777776776666666533333 56777777777776 3455554443   


Q ss_pred             -ccccccceEEeecC-CCCCCCccc
Q 037018          612 -GAMPKLESLIVNPC-AYLRKLPEE  634 (663)
Q Consensus       612 -~~l~~L~~L~l~~c-~~l~~l~~~  634 (663)
                       +.+|.+.++.+.+| ..+...|..
T Consensus       842 l~~~P~~~~~~i~~~~~~~~~~~~~  866 (889)
T KOG4658|consen  842 LGKLPLLSTLTIVGCEEKLKEYPDG  866 (889)
T ss_pred             cccCccccccceeccccceeecCCc
Confidence             66777777777776 555555543

>PLN03210 Resistant to P Back     alignment and domain information
>PF00931 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is the NB-ARC domain, a novel signalling motif found in bacteria and eukaryotes, shared by plant resistance gene products and regulators of cell death in animals [] Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PRK00411 cdc6 cell division control protein 6; Reviewed Back     alignment and domain information
>cd01128 rho_factor Transcription termination factor rho is a bacterial ATP-dependent RNA/DNA helicase Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily Back     alignment and domain information
>TIGR02928 orc1/cdc6 family replication initiation protein Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>PRK09376 rho transcription termination factor Rho; Provisional Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>PF05729 NACHT: NACHT domain Back     alignment and domain information
>PF13191 AAA_16: AAA ATPase domain; PDB: 2V1U_A Back     alignment and domain information
>TIGR00767 rho transcription termination factor Rho Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>PF13173 AAA_14: AAA domain Back     alignment and domain information
>PF01637 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 This domain has been found in a number of bacterial and archaeal proteins, all of which contain a conserved P-loop motif that is involved in binding ATP Back     alignment and domain information
>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>PTZ00202 tuzin; Provisional Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2543 consensus Origin recognition complex, subunit 5 [Replication, recombination and repair] Back     alignment and domain information
>PTZ00112 origin recognition complex 1 protein; Provisional Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional Back     alignment and domain information
>PF04665 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 This entry contains uncharacterised proteins belonging to the B354L family which include the pox virus A32 protein Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>TIGR02903 spore_lon_C ATP-dependent protease, Lon family Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK13342 recombination factor protein RarA; Reviewed Back     alignment and domain information
>PRK00440 rfc replication factor C small subunit; Reviewed Back     alignment and domain information
>PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2227 consensus Pre-initiation complex, subunit CDC6, AAA+ superfamily ATPase [Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK08116 hypothetical protein; Validated Back     alignment and domain information
>COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK10536 hypothetical protein; Provisional Back     alignment and domain information
>COG2909 MalT ATP-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>PF05621 TniB: Bacterial TniB protein; InterPro: IPR008868 This family consists of several bacterial TniB NTP-binding proteins Back     alignment and domain information
>PRK12402 replication factor C small subunit 2; Reviewed Back     alignment and domain information
>cd01133 F1-ATPase_beta F1 ATP synthase beta subunit, nucleotide-binding domain Back     alignment and domain information
>PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed Back     alignment and domain information
>PRK06893 DNA replication initiation factor; Validated Back     alignment and domain information
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda Back     alignment and domain information
>KOG2028 consensus ATPase related to the helicase subunit of the Holliday junction resolvase [Replication, recombination and repair] Back     alignment and domain information
>PRK07003 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK08118 topology modulation protein; Reviewed Back     alignment and domain information
>PRK06645 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK08727 hypothetical protein; Validated Back     alignment and domain information
>PRK05564 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PHA02544 44 clamp loader, small subunit; Provisional Back     alignment and domain information
>PRK14963 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>TIGR01242 26Sp45 26S proteasome subunit P45 family Back     alignment and domain information
>TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit Back     alignment and domain information
>PRK08181 transposase; Validated Back     alignment and domain information
>PLN03025 replication factor C subunit; Provisional Back     alignment and domain information
>PRK14949 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14960 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14961 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR00362 DnaA chromosomal replication initiator protein DnaA Back     alignment and domain information
>PRK12323 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK00149 dnaA chromosomal replication initiation protein; Reviewed Back     alignment and domain information
>PRK08691 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14957 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PF07693 KAP_NTPase: KAP family P-loop domain; InterPro: IPR011646 The KAP (after Kidins220/ARMS and PifA) family of predicted NTPases are sporadically distributed across a wide phylogenetic range in bacteria and in animals Back     alignment and domain information
>COG1373 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>PRK09183 transposase/IS protein; Provisional Back     alignment and domain information
>PRK08939 primosomal protein DnaI; Reviewed Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK14956 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK06526 transposase; Provisional Back     alignment and domain information
>PRK12608 transcription termination factor Rho; Provisional Back     alignment and domain information
>PRK14088 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK12377 putative replication protein; Provisional Back     alignment and domain information
>PRK04195 replication factor C large subunit; Provisional Back     alignment and domain information
>PRK14969 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>PRK14951 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>PRK14087 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PF05673 DUF815: Protein of unknown function (DUF815); InterPro: IPR008533 This domain consists of several bacterial proteins of unknown function Back     alignment and domain information
>TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX Back     alignment and domain information
>COG0593 DnaA ATPase involved in DNA replication initiation [DNA replication, recombination, and repair] Back     alignment and domain information
>CHL00095 clpC Clp protease ATP binding subunit Back     alignment and domain information
>PRK14086 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK06696 uridine kinase; Validated Back     alignment and domain information
>PRK14958 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK07994 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family Back     alignment and domain information
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>PRK08084 DNA replication initiation factor; Provisional Back     alignment and domain information
>PRK14970 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK07261 topology modulation protein; Provisional Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK07952 DNA replication protein DnaC; Validated Back     alignment and domain information
>PRK14964 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN Back     alignment and domain information
>PF02562 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH is a cytoplasmic protein and predicted ATPase that is induced by phosphate starvation and belongings to the phosphate regulon (pho) in Escherichia coli [] Back     alignment and domain information
>PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif Back     alignment and domain information
>PRK05896 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK12422 chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK10865 protein disaggregation chaperone; Provisional Back     alignment and domain information
>COG0572 Udk Uridine kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed Back     alignment and domain information
>PRK06305 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>CHL00181 cbbX CbbX; Provisional Back     alignment and domain information
>COG1875 NYN ribonuclease and ATPase of PhoH family domains [General function prediction only] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>CHL00095 clpC Clp protease ATP binding subunit Back     alignment and domain information
>COG2607 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>PRK10865 protein disaggregation chaperone; Provisional Back     alignment and domain information
>TIGR00602 rad24 checkpoint protein rad24 Back     alignment and domain information
>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14962 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK06835 DNA replication protein DnaC; Validated Back     alignment and domain information
>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>PRK07471 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK09111 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport Back     alignment and domain information
>smart00763 AAA_PrkA PrkA AAA domain Back     alignment and domain information
>TIGR03689 pup_AAA proteasome ATPase Back     alignment and domain information
>PRK06921 hypothetical protein; Provisional Back     alignment and domain information
>PRK07940 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>cd03281 ABC_MSH5_euk MutS5 homolog in eukaryotes Back     alignment and domain information
>PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair Back     alignment and domain information
>PRK14955 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK07667 uridine kinase; Provisional Back     alignment and domain information
>PRK05642 DNA replication initiation factor; Validated Back     alignment and domain information
>PRK08927 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG3308 consensus Uncharacterized protein of the uridine kinase family [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK07764 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14950 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A Back     alignment and domain information
>PF13604 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A Back     alignment and domain information
>cd00561 CobA_CobO_BtuR ATP:corrinoid adenosyltransferase BtuR/CobO/CobP Back     alignment and domain information
>PRK09112 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PTZ00301 uridine kinase; Provisional Back     alignment and domain information
>cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis Back     alignment and domain information
>TIGR02881 spore_V_K stage V sporulation protein K Back     alignment and domain information
>TIGR00678 holB DNA polymerase III, delta' subunit Back     alignment and domain information
>KOG0735 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd01123 Rad51_DMC1_radA Rad51_DMC1_radA,B Back     alignment and domain information
>cd01131 PilT Pilus retraction ATPase PilT Back     alignment and domain information
>COG4618 ArpD ABC-type protease/lipase transport system, ATPase and permease components [General function prediction only] Back     alignment and domain information
>PF00485 PRK: Phosphoribulokinase / Uridine kinase family; InterPro: IPR006083 Phosphoribulokinase (PRK) 2 Back     alignment and domain information
>TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau Back     alignment and domain information
>KOG0924 consensus mRNA splicing factor ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK14954 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR02858 spore_III_AA stage III sporulation protein AA Back     alignment and domain information
>cd03214 ABC_Iron-Siderophores_B12_Hemin ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea Back     alignment and domain information
>PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional Back     alignment and domain information
>PRK08451 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK06002 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>PRK08149 ATP synthase SpaL; Validated Back     alignment and domain information
>PRK08972 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>PF00006 ATP-synt_ab: ATP synthase alpha/beta family, nucleotide-binding domain This Pfam entry corresponds to chains a,b,c,d,e and f; InterPro: IPR000194 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane Back     alignment and domain information
>cd01132 F1_ATPase_alpha F1 ATP synthase alpha, central domain Back     alignment and domain information
>PRK12678 transcription termination factor Rho; Provisional Back     alignment and domain information
>cd01135 V_A-ATPase_B V/A-type ATP synthase (non-catalytic) subunit B Back     alignment and domain information
>KOG1514 consensus Origin recognition complex, subunit 1, and related proteins [Replication, recombination and repair] Back     alignment and domain information
>PRK07594 type III secretion system ATPase SsaN; Validated Back     alignment and domain information
>COG1121 ZnuC ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK08903 DnaA regulatory inactivator Hda; Validated Back     alignment and domain information
>PRK14953 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14952 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF14516 AAA_35: AAA-like domain Back     alignment and domain information
>PF12775 AAA_7: P-loop containing dynein motor region D3; PDB: 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A 3VKH_A 3VKG_A Back     alignment and domain information
>COG1124 DppF ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK14959 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional Back     alignment and domain information
>cd03282 ABC_MSH4_euk MutS4 homolog in eukaryotes Back     alignment and domain information
>PRK14965 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF03205 MobB: Molybdopterin guanine dinucleotide synthesis protein B; PDB: 2F1R_B 1P9N_A 1NP6_B 2NPI_A 1XJC_A Back     alignment and domain information
>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family Back     alignment and domain information
>COG4608 AppF ABC-type oligopeptide transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>PLN02348 phosphoribulokinase Back     alignment and domain information
>TIGR03498 FliI_clade3 flagellar protein export ATPase FliI Back     alignment and domain information
>cd01129 PulE-GspE PulE/GspE The type II secretory pathway is the main terminal branch of the general secretory pathway (GSP) Back     alignment and domain information
>PRK14971 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF00158 Sigma54_activat: Sigma-54 interaction domain; InterPro: IPR002078 Some bacterial regulatory proteins activate the expression of genes from promoters recognised by core RNA polymerase associated with the alternative sigma-54 factor Back     alignment and domain information
>PTZ00185 ATPase alpha subunit; Provisional Back     alignment and domain information
>PRK13531 regulatory ATPase RavA; Provisional Back     alignment and domain information
>TIGR01420 pilT_fam pilus retraction protein PilT Back     alignment and domain information
>PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B Back     alignment and domain information
>PRK09099 type III secretion system ATPase; Provisional Back     alignment and domain information
>PRK09361 radB DNA repair and recombination protein RadB; Provisional Back     alignment and domain information
>cd01394 radB RadB Back     alignment and domain information
>cd01136 ATPase_flagellum-secretory_path_III Flagellum-specific ATPase/type III secretory pathway virulence-related protein Back     alignment and domain information
>cd03220 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transporter subfamily is involved in extracellular polysaccharide export Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>PRK14948 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK12597 F0F1 ATP synthase subunit beta; Provisional Back     alignment and domain information
>PF03969 AFG1_ATPase: AFG1-like ATPase; InterPro: IPR005654 ATPase family gene 1 (AFG1) ATPase is a 377 amino acid putative protein with an ATPase motif typical of the protein family including SEC18p PAS1, CDC48-VCP and TBP Back     alignment and domain information
>PRK09270 nucleoside triphosphate hydrolase domain-containing protein; Reviewed Back     alignment and domain information
>PRK05480 uridine/cytidine kinase; Provisional Back     alignment and domain information
>TIGR01040 V-ATPase_V1_B V-type (H+)-ATPase V1, B subunit Back     alignment and domain information
>TIGR03497 FliI_clade2 flagellar protein export ATPase FliI Back     alignment and domain information
>PF14532 Sigma54_activ_2: Sigma-54 interaction domain; PDB: 3CO5_B 3N70_H Back     alignment and domain information
>PRK06647 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR02030 BchI-ChlI magnesium chelatase ATPase subunit I Back     alignment and domain information
>PRK05541 adenylylsulfate kinase; Provisional Back     alignment and domain information
>TIGR00235 udk uridine kinase Back     alignment and domain information
>cd03263 ABC_subfamily_A The ABCA subfamily mediates the transport of a variety of lipid compounds Back     alignment and domain information
>PRK08233 hypothetical protein; Provisional Back     alignment and domain information
>PRK15455 PrkA family serine protein kinase; Provisional Back     alignment and domain information
>PRK11608 pspF phage shock protein operon transcriptional activator; Provisional Back     alignment and domain information
>TIGR03496 FliI_clade1 flagellar protein export ATPase FliI Back     alignment and domain information
>TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH Back     alignment and domain information
>PRK09280 F0F1 ATP synthase subunit beta; Validated Back     alignment and domain information
>cd03228 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export Back     alignment and domain information
>PRK09544 znuC high-affinity zinc transporter ATPase; Reviewed Back     alignment and domain information
>cd03231 ABC_CcmA_heme_exporter CcmA, the ATP-binding component of the bacterial CcmAB transporter Back     alignment and domain information
>cd01393 recA_like RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response Back     alignment and domain information
>PRK03992 proteasome-activating nucleotidase; Provisional Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>cd03237 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 of RNase L inhibitor Back     alignment and domain information
>PRK07133 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR01041 ATP_syn_B_arch ATP synthase archaeal, B subunit Back     alignment and domain information
>PRK06936 type III secretion system ATPase; Provisional Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>COG1428 Deoxynucleoside kinases [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK05439 pantothenate kinase; Provisional Back     alignment and domain information
>cd02025 PanK Pantothenate kinase (PanK) catalyzes the phosphorylation of pantothenic acid to form 4'-phosphopantothenic, which is the first of five steps in coenzyme A (CoA) biosynthetic pathway Back     alignment and domain information
>cd03238 ABC_UvrA The excision repair protein UvrA; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion Back     alignment and domain information
>PRK05922 type III secretion system ATPase; Validated Back     alignment and domain information
>PLN00020 ribulose bisphosphate carboxylase/oxygenase activase -RuBisCO activase (RCA); Provisional Back     alignment and domain information
>PTZ00361 26 proteosome regulatory subunit 4-like protein; Provisional Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>cd01120 RecA-like_NTPases RecA-like NTPases Back     alignment and domain information
>COG1763 MobB Molybdopterin-guanine dinucleotide biosynthesis protein [Coenzyme metabolism] Back     alignment and domain information
>cd02024 NRK1 Nicotinamide riboside kinase (NRK) is an enzyme involved in the metabolism of nicotinamide adenine dinucleotide (NAD+) Back     alignment and domain information
>PRK05688 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>KOG0734 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG3172 NadR Predicted ATPase/kinase involved in NAD metabolism [Coenzyme metabolism] Back     alignment and domain information
>COG0465 HflB ATP-dependent Zn proteases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK07721 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>COG0468 RecA RecA/RadA recombinase [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR03522 GldA_ABC_ATP gliding motility-associated ABC transporter ATP-binding subunit GldA Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query663
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-21
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 7e-12
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 8e-17
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 9e-13
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-11
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-07
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 4e-04
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-11
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-09
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-07
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-05
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 3e-11
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-07
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-11
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 6e-08
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-05
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 4e-05
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 5e-11
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 6e-10
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-07
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-05
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-05
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 7e-11
2z66_A 306 Variable lymphocyte receptor B, TOLL-like recepto; 3e-04
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 1e-10
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 5e-07
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 5e-06
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-10
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 7e-10
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-09
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 3e-08
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 8e-06
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 2e-10
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-08
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 7e-08
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-04
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 2e-04
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-09
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 3e-08
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 5e-07
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-06
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-09
2a5y_B549 CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis 3e-09
1z6t_A591 APAF-1, apoptotic protease activating factor 1; ca 1e-08
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 2e-08
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 4e-08
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 3e-07
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 5e-07
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 7e-04
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 7e-08
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 4e-06
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-04
4fmz_A347 Internalin; leucine rich repeat, structural genomi 8e-08
4fmz_A347 Internalin; leucine rich repeat, structural genomi 4e-06
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-07
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-07
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 6e-06
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-07
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 4e-06
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-04
1o6v_A 466 Internalin A; bacterial infection, extracellular r 6e-07
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 7e-07
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 1e-06
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 2e-06
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-06
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 2e-06
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 2e-06
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-06
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 3e-04
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-05
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 6e-05
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 1e-05
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 6e-05
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-05
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-05
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-04
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 4e-05
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 3e-04
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 7e-05
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 2e-04
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 5e-04
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 8e-05
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 9e-05
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-04
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 3e-04
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 3e-04
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 3e-04
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 5e-04
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
 Score = 98.0 bits (243), Expect = 3e-21
 Identities = 83/501 (16%), Positives = 146/501 (29%), Gaps = 161/501 (32%)

Query: 52  KTAFVADIYNNNVDLSAMNPKLRVPKRFINKAFPVAFPVDV-NCACNAQLNHILDDIIKS 110
           KT    D+  +      M+             F + F +++ NC     +  +L  ++  
Sbjct: 163 KTWVALDVCLSYKVQCKMD-------------FKI-FWLNLKNCNSPETVLEMLQKLLYQ 208

Query: 111 VMPPSRVNVIISEDYKLKTIILRDYLTN-------KKDFIVLDDVFDDREIWNDLEKFLP 163
           + P        S + KL+   ++  L         +   +VL +V +  + WN       
Sbjct: 209 IDPNWTSRSDHSSNIKLRIHSIQAELRRLLKSKPYENCLLVLLNVQN-AKAWNAFN---- 263

Query: 164 DNQNGSRVLIL-----VTD---PFLLTSFELEH-------GEKIRL-------------N 195
                 ++L+      VTD       T   L+H        E   L              
Sbjct: 264 ---LSCKILLTTRFKQVTDFLSAATTTHISLDHHSMTLTPDEVKSLLLKYLDCRPQDLPR 320

Query: 196 SALVGGPL--------IRIKYEGWQFFILHYGSMPLGSYFQG--EAM-PTIWRHIYSVME 244
             L   P         IR     W  +  H     L +  +     + P  +R ++    
Sbjct: 321 EVLTTNPRRLSIIAESIRDGLATWDNW-KHVNCDKLTTIIESSLNVLEPAEYRKMF---- 375

Query: 245 LPFHLKVCCLYLCVFRPSIEISTRQLYQLWVAE-----------------VSKRRAGGTI 287
                      L VF PS  I T  L  +W                    V K+    TI
Sbjct: 376 ---------DRLSVFPPSAHIPTILLSLIWFDVIKSDVMVVVNKLHKYSLVEKQPKESTI 426

Query: 288 KACYVPGFVYTSLFFMAGMMEFVWMPHMQLETLANVKRCFILEDLIDEFISLEHSDMYLQ 347
               +P  +Y  L     +     + H  +    N+ + F  +DL        + D Y  
Sbjct: 427 ---SIPS-IY--LELKVKLENEYAL-HRSIVDHYNIPKTFDSDDL-----IPPYLDQYFY 474

Query: 348 SFLNHTLESDRLALIDCENFCKKFKHLRVLNLGSAILYQYPPGLENLFHLKYLKLN---- 403
           S + H                    HL+ +                LF + +L       
Sbjct: 475 SHIGH--------------------HLKNIEHP---------ERMTLFRMVFLDFRFLEQ 505

Query: 404 -----IPSLNCLPSLLCTLLNLQTLEMPASYI-DHSPEGIWMMQKLMHLNFGSINLPAPP 457
                  + N   S+L TL  L+  +    YI D+ P+   ++  ++        LP   
Sbjct: 506 KIRHDSTAWNASGSILNTLQQLKFYK---PYICDNDPKYERLVNAILD------FLPKIE 556

Query: 458 KN-YSSSLKNLIFISSLNPSS 477
           +N   S   +L+ I+ +    
Sbjct: 557 ENLICSKYTDLLRIALMAEDE 577
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Length = 549 Back     alignment and structure
>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Length = 591 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query663
2a5y_B549 CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis 100.0
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.95
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 99.95
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.95
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.95
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 99.94
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 99.94
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.94
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.94
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.94
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 99.94
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.94
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 99.94
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.94
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.94
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.94
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.93
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.93
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.93
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.93
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.93
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.93
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.93
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 99.93
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.92
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.92
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.92
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.92
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.92
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.92
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.92
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.91
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.91
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.91
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.91
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.91
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.91
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.9
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.9
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.9
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.9
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.9
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.9
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.9
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.9
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.9
1z6t_A591 APAF-1, apoptotic protease activating factor 1; ca 99.89
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.89
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.88
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.87
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.87
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.87
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.86
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.86
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.86
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.86
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.86
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.85
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.85
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.85
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.84
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.84
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.83
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.83
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.83
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.83
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.82
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.82
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.81
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.81
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.8
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.8
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.8
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.78
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.77
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.76
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.76
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.76
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.76
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.74
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.74
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.73
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.73
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.73
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.73
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.73
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.72
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.72
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.72
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.72
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.72
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.69
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.68
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.67
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.67
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.66
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.66
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.64
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.63
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.63
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.61
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.61
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.58
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.57
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.56
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.54
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.54
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.53
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.52
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.5
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.49
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.49
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.47
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.45
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.43
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.43
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.42
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.4
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.4
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.4
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.39
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.36
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.36
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.36
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.34
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.32
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.31
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.31
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.26
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.25
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.24
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.23
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.19
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.17
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.14
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.14
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.12
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.11
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.11
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.07
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.06
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.03
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 98.94
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 98.94
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 98.78
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 98.73
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 98.71
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.69
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 98.67
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 98.65
4gt6_A394 Cell surface protein; leucine rich repeats, putati 98.55
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 98.53
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 98.51
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.49
1w5s_A412 Origin recognition complex subunit 2 ORC2; replica 98.44
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.42
4gt6_A394 Cell surface protein; leucine rich repeats, putati 98.42
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 98.33
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.29
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.13
1fnn_A389 CDC6P, cell division control protein 6; ORC1, AAA 98.06
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.0
2v1u_A387 Cell division control protein 6 homolog; DNA repli 97.95
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 97.95
2qby_B384 CDC6 homolog 3, cell division control protein 6 ho 97.91
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 97.9
2qen_A350 Walker-type ATPase; unknown function; HET: ADP; 2. 97.88
2qby_A386 CDC6 homolog 1, cell division control protein 6 ho 97.83
2chg_A226 Replication factor C small subunit; DNA-binding pr 97.8
2fna_A357 Conserved hypothetical protein; structural genomic 97.72
1njg_A250 DNA polymerase III subunit gamma; rossman-like fol 97.68
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.55
1sxj_B323 Activator 1 37 kDa subunit; clamp loader, processi 97.36
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.27
3te6_A318 Regulatory protein SIR3; heterochromatin, gene sil 97.18
1iqp_A327 RFCS; clamp loader, extended AAA-ATPase domain, co 96.99
1jbk_A195 CLPB protein; beta barrel, chaperone; 1.80A {Esche 96.67
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 96.37
2p65_A187 Hypothetical protein PF08_0063; CLPB, malaria, str 96.17
2chq_A319 Replication factor C small subunit; DNA-binding pr 96.14
2w58_A202 DNAI, primosome component (helicase loader); ATP-b 96.01
3h4m_A285 Proteasome-activating nucleotidase; ATPase, PAN, A 95.91
2z4s_A440 Chromosomal replication initiator protein DNAA; AA 95.91
1sxj_E354 Activator 1 40 kDa subunit; clamp loader, processi 95.84
3co5_A143 Putative two-component system transcriptional RES 95.73
3syl_A309 Protein CBBX; photosynthesis, rubisco activase, AA 95.42
1sxj_D353 Activator 1 41 kDa subunit; clamp loader, processi 95.38
3u61_B324 DNA polymerase accessory protein 44; AAA+, ATP hyd 95.37
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 95.25
1jr3_A373 DNA polymerase III subunit gamma; processivity, pr 94.84
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 94.81
3n70_A145 Transport activator; sigma-54, ntpase, PSI, MCSG, 94.76
2qz4_A262 Paraplegin; AAA+, SPG7, protease, ADP, structural 94.73
1hqc_A324 RUVB; extended AAA-ATPase domain, complex with nuc 94.52
1d2n_A272 N-ethylmaleimide-sensitive fusion protein; hexamer 94.33
1l8q_A324 Chromosomal replication initiator protein DNAA; AA 94.19
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 93.93
3pvs_A447 Replication-associated recombination protein A; ma 93.7
1sxj_A516 Activator 1 95 kDa subunit; clamp loader, processi 93.7
2zan_A444 Vacuolar protein sorting-associating protein 4B; S 93.1
2qp9_X355 Vacuolar protein sorting-associated protein 4; ATP 93.05
1sxj_C340 Activator 1 40 kDa subunit; clamp loader, processi 92.91
1lv7_A257 FTSH; alpha/beta domain, four helix bundle, hydrol 92.56
3cf0_A301 Transitional endoplasmic reticulum ATPase; AAA, P9 92.53
4fcw_A311 Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 92.29
3uk6_A368 RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding 92.24
3eie_A322 Vacuolar protein sorting-associated protein 4; AAA 92.22
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 92.01
1xwi_A322 SKD1 protein; VPS4B, AAA ATPase, protein transport 91.83
3vfd_A389 Spastin; ATPase, microtubule severing, hydrolase; 91.77
3d8b_A357 Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s 91.54
1ojl_A304 Transcriptional regulatory protein ZRAR; response 91.53
1r6b_X758 CLPA protein; AAA+, N-terminal domain, CLPS, cryst 90.7
1g5t_A196 COB(I)alamin adenosyltransferase; P-loop protein, 89.91
1rz3_A201 Hypothetical protein rbstp0775; MCSG, structural g 89.6
3pxg_A468 Negative regulator of genetic competence CLPC/MEC; 88.85
3bos_A242 Putative DNA replication factor; P-loop containing 88.15
1a5t_A334 Delta prime, HOLB; zinc finger, DNA replication; 2 86.83
2ce7_A476 Cell division protein FTSH; metalloprotease; HET: 85.62
3c8u_A208 Fructokinase; YP_612366.1, putative fructose trans 85.35
2ck3_D482 ATP synthase subunit beta\, mitochondrial; hydrola 84.41
1qvr_A854 CLPB protein; coiled coil, AAA ATPase, chaperone; 84.27
3b9p_A297 CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc 83.94
2r62_A268 Cell division protease FTSH homolog; ATPase domain 83.81
2qgz_A308 Helicase loader, putative primosome component; str 83.72
2cbz_A237 Multidrug resistance-associated protein 1; ABC pro 83.62
3hu3_A489 Transitional endoplasmic reticulum ATPase; VCP, tr 83.52
2pze_A229 Cystic fibrosis transmembrane conductance regulat; 83.49
3pxi_A758 Negative regulator of genetic competence CLPC/MEC; 83.32
1odf_A290 YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser 82.74
3pfi_A338 Holliday junction ATP-dependent DNA helicase RUVB; 82.56
1in4_A334 RUVB, holliday junction DNA helicase RUVB; AAA+-cl 82.41
2vhj_A331 Ntpase P4, P4; non- hydrolysable ATP analogue, hyd 82.38
1fx0_B498 ATP synthase beta chain; latent ATPase, thermal st 81.89
2r44_A331 Uncharacterized protein; putative ATPase, structur 81.77
1sky_E473 F1-ATPase, F1-ATP synthase; F1FO ATP synthase, alp 81.23
1ofh_A310 ATP-dependent HSL protease ATP-binding subunit HSL 81.04
3vr4_D465 V-type sodium ATPase subunit D; V-ATPase, rotary m 80.75
1qvr_A854 CLPB protein; coiled coil, AAA ATPase, chaperone; 80.66
>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Back     alignment and structure
Probab=100.00  E-value=1.3e-33  Score=312.43  Aligned_cols=252  Identities=12%  Similarity=0.114  Sum_probs=191.1

Q ss_pred             cccchhhcHHHHHHHHhcCCCCceEEEEEec----chhhHHHHHhc--CCCccccCCCCccccCCceeeccCCCcceEeC
Q 037018           20 SSKTVKVKVKAVLVWLFMLDSMWLQFLTAVA----YKTAFVADIYN--NNVDLSAMNPKLRVPKRFINKAFPVAFPVDVN   93 (663)
Q Consensus        20 ~~~G~~~~~~~i~~~L~~~~~~~~~vi~i~G----GKTtla~~v~~--~~~~~~~~~~~~~~~~~F~~~~~~~~~~v~vs   93 (663)
                      ..+||+.++++|.++|.....+..+||+|+|    ||||||+++|+  |.          +++.+|+.++|     |+++
T Consensus       129 ~~~GR~~~~~~l~~~L~~~~~~~~~vv~I~G~gGvGKTtLA~~v~~~~~~----------~~~~~F~~~~w-----v~vs  193 (549)
T 2a5y_B          129 TCYIREYHVDRVIKKLDEMCDLDSFFLFLHGRAGSGKSVIASQALSKSDQ----------LIGINYDSIVW-----LKDS  193 (549)
T ss_dssp             CSCCCHHHHHHHHHHHHHHTTSSSEEEEEECSTTSSHHHHHHHHHHHCSS----------TBTTTBSEEEE-----EECC
T ss_pred             ccCCchHHHHHHHHHHhcccCCCceEEEEEcCCCCCHHHHHHHHHHhhhH----------HHhccCCcEEE-----EEEC
Confidence            3369999999999999876444689999999    99999999998  67          89999999999     9999


Q ss_pred             CCc--chhHHHHHHHHHHHhCCCCC---cchhhhh-HhhHHHHHHHHhhcCC-cEEEEEeCCCCChhhHHHHHhhCCCCC
Q 037018           94 CAC--NAQLNHILDDIIKSVMPPSR---VNVIISE-DYKLKTIILRDYLTNK-KDFIVLDDVFDDREIWNDLEKFLPDNQ  166 (663)
Q Consensus        94 ~~~--~~~~~~l~~~i~~~l~~~~~---~~~~~~~-~~~l~~~~l~~~L~~k-r~LlVLDdv~~~~~~~~~l~~~~~~~~  166 (663)
                      +.+  +  ..++++.|+.+++....   ....+.. .+.+ ...+++.|++| ||||||||||+ ..++ .+..     .
T Consensus       194 ~~~~~~--~~~~~~~il~~l~~~~~~~~~~~~~~~~~~~l-~~~l~~~L~~~kr~LlVLDdv~~-~~~~-~~~~-----~  263 (549)
T 2a5y_B          194 GTAPKS--TFDLFTDILLMLKSEDDLLNFPSVEHVTSVVL-KRMICNALIDRPNTLFVFDDVVQ-EETI-RWAQ-----E  263 (549)
T ss_dssp             CCSTTH--HHHHHHHHHHHHTTTSCCTTCCCCTTCCHHHH-HHHHHHHHTTSTTEEEEEEEECC-HHHH-HHHH-----H
T ss_pred             CCCCCC--HHHHHHHHHHHHhcCcccccccccccccHHHH-HHHHHHHHcCCCcEEEEEECCCC-chhh-cccc-----c
Confidence            985  7  99999999999987532   1112222 4667 88999999996 99999999999 6654 2221     1


Q ss_pred             CCceEEEEEeCCCCC-------ceEecc---------------------------------ccccchhHHHHHhhccccC
Q 037018          167 NGSRVLILVTDPFLL-------TSFELE---------------------------------HGEKIRLNSALVGGPLIRI  206 (663)
Q Consensus       167 ~gskIiiT~r~~~~~-------~~~~l~---------------------------------~~~~iPlal~~~g~~L~~~  206 (663)
                      +|||||||||++.++       .+|+++                                 .+.++|||++++|+.|+..
T Consensus       264 ~gs~ilvTTR~~~v~~~~~~~~~~~~l~~L~~~ea~~Lf~~~a~~~~~~~~~~~~~~~I~~~c~GlPLAl~~~g~~l~~~  343 (549)
T 2a5y_B          264 LRLRCLVTTRDVEISNAASQTCEFIEVTSLEIDECYDFLEAYGMPMPVGEKEEDVLNKTIELSSGNPATLMMFFKSCEPK  343 (549)
T ss_dssp             TTCEEEEEESBGGGGGGCCSCEEEEECCCCCHHHHHHHHHHTSCCCC--CHHHHHHHHHHHHHTTCHHHHHHHHTTCCSS
T ss_pred             CCCEEEEEcCCHHHHHHcCCCCeEEECCCCCHHHHHHHHHHHhcCCCCchhHHHHHHHHHHHhCCChHHHHHHHHHhccc
Confidence            699999999975432       356666                                 1222399999999999833


Q ss_pred             ChhhHHHHHhhcCCCCCCCCcCCCChhhhhhhc-ceeCCCChhhHHHHh-----------hhcccCCCceechHHHHHHH
Q 037018          207 KYEGWQFFILHYGSMPLGSYFQGEAMPTIWRHI-YSVMELPFHLKVCCL-----------YLCVFRPSIEISTRQLYQLW  274 (663)
Q Consensus       207 ~~~~W~~~~~~~~~~~l~~~~~~~~~~~i~~~l-~sy~~L~~~~k~cfl-----------~~a~Fp~~~~i~~~~Li~~W  274 (663)
                      . .+|...+..        ........++...+ +||+.||.++|.||+           |||+||+++.|+    |..|
T Consensus       344 ~-w~~~~~l~~--------~l~~~~~~~i~~~l~~Sy~~L~~~lk~~f~~Ls~~er~l~~~ls~fp~~~~i~----i~~w  410 (549)
T 2a5y_B          344 T-FEKMAQLNN--------KLESRGLVGVECITPYSYKSLAMALQRCVEVLSDEDRSALAFAVVMPPGVDIP----VKLW  410 (549)
T ss_dssp             S-HHHHHHHHH--------HHHHHCSSTTCCCSSSSSSSHHHHHHHHHHTSCHHHHHHTTGGGSSCTTCCEE----HHHH
T ss_pred             h-HHHHHHhHH--------HhhcccHHHHHHHHhcccccccHHHHHHHhccchhhhhHhhheeeeCCCCeee----eeee
Confidence            2 333333333        21111124564455 999999999999999           999999999999    8999


Q ss_pred             HHc--CC-C----C---------------------CCCCccceEEcCHHHHHHHHHhcccCce
Q 037018          275 VAE--VS-K----R---------------------RAGGTIKACYVPGFVYTSLFFMAGMMEF  309 (663)
Q Consensus       275 i~~--g~-~----g---------------------~~~~~~~~~~mhdll~dl~~~~~~~~~~  309 (663)
                      +|+  || .    +                     ...+...+|+|||++|++|+.++.++++
T Consensus       411 ~a~~~G~i~~~~~~~~~~~~~~~l~~L~~rsLl~~~~~~~~~~~~mHdlv~~~a~~~~~~~~~  473 (549)
T 2a5y_B          411 SCVIPVDICSNEEEQLDDEVADRLKRLSKRGALLSGKRMPVLTFKIDHIIHMFLKHVVDAQTI  473 (549)
T ss_dssp             HHHSCC-------CCCTHHHHHHHHHTTTBSSCSEEECSSSCEEECCHHHHHHHHTTSCTHHH
T ss_pred             eeeccceeccCCCCCCHHHHHHHHHHHHHcCCeeEecCCCceEEEeChHHHHHHHHHHHHHHH
Confidence            999  88 3    1                     1112456899999999999999887643
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>2qen_A Walker-type ATPase; unknown function; HET: ADP; 2.25A {Pyrococcus abyssi} Back     alignment and structure
>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Back     alignment and structure
>2fna_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE ADP; 2.00A {Sulfolobus solfataricus} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} Back     alignment and structure
>2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A Back     alignment and structure
>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* Back     alignment and structure
>1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} Back     alignment and structure
>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* Back     alignment and structure
>1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} Back     alignment and structure
>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Back     alignment and structure
>1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* Back     alignment and structure
>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Back     alignment and structure
>1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} Back     alignment and structure
>1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A Back     alignment and structure
>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* Back     alignment and structure
>1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Back     alignment and structure
>4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* Back     alignment and structure
>3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* Back     alignment and structure
>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} Back     alignment and structure
>3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} Back     alignment and structure
>3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} Back     alignment and structure
>1ojl_A Transcriptional regulatory protein ZRAR; response regulator, two component system, AAA domain, NTRC family, DNA-binding; HET: ATP; 3.0A {Salmonella typhimurium} Back     alignment and structure
>1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* Back     alignment and structure
>1g5t_A COB(I)alamin adenosyltransferase; P-loop protein, cobalamin biosynthesis, RECA fold; HET: ATP; 1.80A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1g5r_A* 1g64_A* Back     alignment and structure
>1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6 Back     alignment and structure
>3pxg_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 3.65A {Bacillus subtilis} Back     alignment and structure
>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A Back     alignment and structure
>1a5t_A Delta prime, HOLB; zinc finger, DNA replication; 2.20A {Escherichia coli K12} SCOP: a.80.1.1 c.37.1.20 PDB: 1jr3_E* 1xxh_E* 1xxi_E* 3glf_E* 3glg_E* 3glh_E* 3gli_E* Back     alignment and structure
>2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* Back     alignment and structure
>3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} Back     alignment and structure
>2ck3_D ATP synthase subunit beta\, mitochondrial; hydrolase; HET: ANP ADP; 1.9A {Bos taurus} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1cow_D* 1bmf_D* 1e1q_D* 1e1r_D* 1efr_D* 1e79_D* 1h8h_D* 1ohh_D* 1qo1_D 1w0j_D* 1w0k_D* 1h8e_D* 2jdi_D* 2jiz_D* 2jj1_D* 2jj2_D* 2v7q_D* 2wss_D* 2w6j_D 2w6e_D ... Back     alignment and structure
>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 Back     alignment and structure
>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Back     alignment and structure
>2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* Back     alignment and structure
>2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} Back     alignment and structure
>2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} Back     alignment and structure
>3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* Back     alignment and structure
>2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A Back     alignment and structure
>3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} Back     alignment and structure
>1odf_A YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser2 intergenic region; yeast protein, ATP binding protein; 2.25A {Saccharomyces cerevisiae} SCOP: c.37.1.6 Back     alignment and structure
>3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} Back     alignment and structure
>1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* Back     alignment and structure
>2vhj_A Ntpase P4, P4; non- hydrolysable ATP analogue, hydrolase, virus dsRNA, molecular motor, packaging ATPase, hexameric helicase; HET: ADP; 1.80A {Pseudomonas phage PHI12} PDB: 2vhq_A* 1w44_A* 1w46_A* 1w47_A* 1w48_A* 1w49_A* 1w4a_A* 1w4b_A* 1w4c_A 2vht_A* 2vhu_A* 2vhc_A* Back     alignment and structure
>1fx0_B ATP synthase beta chain; latent ATPase, thermal stability, potential tentoxin binding hydrolase; 3.20A {Spinacia oleracea} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1kmh_B* Back     alignment and structure
>2r44_A Uncharacterized protein; putative ATPase, structural genomics, joint center for struc genomics, JCSG; HET: MSE PG4; 2.00A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>1sky_E F1-ATPase, F1-ATP synthase; F1FO ATP synthase, alpha3BETA3 SUBC F1-ATPase, hydrolase; 3.20A {Bacillus SP} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 Back     alignment and structure
>1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* Back     alignment and structure
>3vr4_D V-type sodium ATPase subunit D; V-ATPase, rotary motor, P-loop, hydrolas ATPase, ATP binding; HET: MSE B3P; 2.17A {Enterococcus hirae} PDB: 3vr3_D* 3vr2_D* 3vr5_D 3vr6_D* Back     alignment and structure
>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 663
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 0.001
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]

 Score = 39.6 bits (91), Expect = 0.001
 Identities = 26/173 (15%), Positives = 58/173 (33%), Gaps = 20/173 (11%)

Query: 438 WMMQKLMHLNFGSINLPAPPKNYSSSLKNLIFISSLNPSSCTPDILGRLPNVQTLRISG- 496
            ++  L  L+     L        +SL NL  +   N        L  L  +  L++   
Sbjct: 216 GILTNLDELSLNGNQLKDIGTL--ASLTNLTDLDLANNQISNLAPLSGLTKLTELKLGAN 273

Query: 497 ---DLSHYHSGVSKSLCELHKLECLQLVHEGRMWQLSRMVLSEYQFP--------PCLTQ 545
              ++S      + +  EL++ +   +     +  L+ + L                L +
Sbjct: 274 QISNISPLAGLTALTNLELNENQLEDISPISNLKNLTYLTLYFNNISDISPVSSLTKLQR 333

Query: 546 LSLSNTQLMEDPMPALEKLPHLEVLKLKQNSYSERKLACVGSGSFPQLKILHL 598
           L  +N ++ +  + +L  L ++  L    N  S+         +  ++  L L
Sbjct: 334 LFFANNKVSD--VSSLANLTNINWLSAGHNQISDL----TPLANLTRITQLGL 380

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query663
d2a5yb3277 CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI 99.95
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.86
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.84
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.83
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.82
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.82
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.76
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.74
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.7
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.7
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.65
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.61
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.58
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.58
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.55
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.55
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.55
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.55
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.54
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.52
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.5
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.48
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.4
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.39
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.33
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.23
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.21
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.19
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.16
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.13
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.12
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.02
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 98.99
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 98.92
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 98.88
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.6
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.48
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.59
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.54
d1fnna2276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 97.24
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.17
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.05
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 96.94
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 96.71
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 96.61
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 96.52
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 96.41
d2fnaa2283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 96.39
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 96.33
d1w5sa2287 CDC6-like protein APE0152, N-terminal domain {Aero 96.32
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 96.16
d1sxje2252 Replication factor C5 {Baker's yeast (Saccharomyce 95.95
d1r6bx2268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 95.75
d1jbka_195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 95.64
d1njfa_239 delta prime subunit of DNA polymerase III, N-domai 94.87
d1qvra2387 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 94.24
d1rz3a_198 Hypothetical protein rbstp0775 {Bacillus stearothe 92.66
d1sxja2253 Replication factor C1 {Baker's yeast (Saccharomyce 91.96
d1a5ta2207 delta prime subunit of DNA polymerase III, N-domai 91.37
d1d2na_246 Hexamerization domain of N-ethylmalemide-sensitive 90.74
d2jdid3276 Central domain of beta subunit of F1 ATP synthase 90.35
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 89.69
d1in4a2238 Holliday junction helicase RuvB {Thermotoga mariti 89.68
d1ixsb2239 Holliday junction helicase RuvB {Thermus thermophi 89.57
d1xjca_165 Molybdopterin-guanine dinucleotide biosynthesis pr 87.83
d1lv7a_256 AAA domain of cell division protein FtsH {Escheric 87.53
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 87.0
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 86.6
d1vpla_238 Putative ABC transporter TM0544 {Thermotoga mariti 85.96
d1sgwa_200 Putative ABC transporter PF0895 {Pyrococcus furios 84.81
d1uj2a_213 Uridine-cytidine kinase 2 {Human (Homo sapiens) [T 84.42
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 83.73
d1o5za2296 Folylpolyglutamate synthetase {Thermotoga maritima 83.4
d1ixza_247 AAA domain of cell division protein FtsH {Thermus 83.37
d1e32a2258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 83.09
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 82.94
d1g8pa_333 ATPase subunit of magnesium chelatase, BchI {Rhodo 82.85
d1sq5a_308 Pantothenate kinase PanK {Escherichia coli [TaxId: 82.22
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 81.99
d2iyva1165 Shikimate kinase (AroK) {Mycobacterium tuberculosi 81.79
d1r7ra3265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 81.75
d1fx0a3276 Central domain of alpha subunit of F1 ATP synthase 81.22
d2gc6a2296 Folylpolyglutamate synthetase {Lactobacillus casei 80.63
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 80.58
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: CED-4, NB-ARC domain
species: Caenorhabditis elegans [TaxId: 6239]

Probab=99.95  E-value=3.2e-28  Score=242.00  Aligned_cols=210  Identities=12%  Similarity=0.014  Sum_probs=156.6

Q ss_pred             ccCCccccccchhhcHHHHHHHHhcCCCCceEEEEEec----chhhHHHHHhcCCCccccCCCCccccCCceeeccCCCc
Q 037018           13 HSSSTSCSSKTVKVKVKAVLVWLFMLDSMWLQFLTAVA----YKTAFVADIYNNNVDLSAMNPKLRVPKRFINKAFPVAF   88 (663)
Q Consensus        13 ~~~~~~~~~~G~~~~~~~i~~~L~~~~~~~~~vi~i~G----GKTtla~~v~~~~~~~~~~~~~~~~~~~F~~~~~~~~~   88 (663)
                      ...+....++||+.++++|+++|......+.++|+|+|    ||||||+++|++..        ..+..+|++++|    
T Consensus        14 ~~~p~~~~~~gR~~~~~~i~~~L~~~~~~~~~~v~I~GmgGiGKTtLA~~v~~~~~--------~~~~~~f~~~~W----   81 (277)
T d2a5yb3          14 GNVPKQMTCYIREYHVDRVIKKLDEMCDLDSFFLFLHGRAGSGKSVIASQALSKSD--------QLIGINYDSIVW----   81 (277)
T ss_dssp             TTCBCCCCSCCCHHHHHHHHHHHHHHTTSSSEEEEEECSTTSSHHHHHHHHHHHCS--------STBTTTBSEEEE----
T ss_pred             cCCCCCCceeCcHHHHHHHHHHHHhccCCCceEEEEECCCCCCHHHHHHHHHHhhh--------hhhhhcCceEEE----
Confidence            34455567899999999999999875544789999999    99999999998651        137888999999    


Q ss_pred             ceEeCCCcchhHHHHHHHHHH---HhCCCCC--cch-hhhh-HhhHHHHHHHHhhcCCcEEEEEeCCCCChhhHHHHHhh
Q 037018           89 PVDVNCACNAQLNHILDDIIK---SVMPPSR--VNV-IISE-DYKLKTIILRDYLTNKKDFIVLDDVFDDREIWNDLEKF  161 (663)
Q Consensus        89 ~v~vs~~~~~~~~~l~~~i~~---~l~~~~~--~~~-~~~~-~~~l~~~~l~~~L~~kr~LlVLDdv~~~~~~~~~l~~~  161 (663)
                       |++++.++  ...+...+..   .+.....  .+. .+.. .... ...+.+.+.+||+|+||||||+ ..+|+.+.. 
T Consensus        82 -v~vs~~~~--~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~L~~kr~LlVLDDv~~-~~~~~~~~~-  155 (277)
T d2a5yb3          82 -LKDSGTAP--KSTFDLFTDILLMLKSEDDLLNFPSVEHVTSVVLK-RMICNALIDRPNTLFVFDDVVQ-EETIRWAQE-  155 (277)
T ss_dssp             -EECCCCST--THHHHHHHHHHHHHTTTSCCTTCCCCTTCCHHHHH-HHHHHHHTTSTTEEEEEEEECC-HHHHHHHHH-
T ss_pred             -EEecCCCC--HHHHHHHHHHHHHHhcchhhcCCccchhhhhHHHH-HHHHHHHhccCCeeEecchhhH-Hhhhhhhcc-
Confidence             99999888  6666555544   3332211  111 1111 2333 5678889999999999999999 999887653 


Q ss_pred             CCCCCCCceEEEEEeCCCCC-------ceEecc---------------------------------ccccchhHHHHHhh
Q 037018          162 LPDNQNGSRVLILVTDPFLL-------TSFELE---------------------------------HGEKIRLNSALVGG  201 (663)
Q Consensus       162 ~~~~~~gskIiiT~r~~~~~-------~~~~l~---------------------------------~~~~iPlal~~~g~  201 (663)
                           .|||||||||++..+       ..|+++                                 .+.+.|||++++|+
T Consensus       156 -----~~srilvTTR~~~v~~~~~~~~~~~~l~~L~~~ea~~Lf~~~~~~~~~~~~~~~~~~~iv~~c~GlPLAl~~ig~  230 (277)
T d2a5yb3         156 -----LRLRCLVTTRDVEISNAASQTCEFIEVTSLEIDECYDFLEAYGMPMPVGEKEEDVLNKTIELSSGNPATLMMFFK  230 (277)
T ss_dssp             -----TTCEEEEEESBGGGGGGCCSCEEEEECCCCCHHHHHHHHHHTSCCCC--CHHHHHHHHHHHHHTTCHHHHHHHHT
T ss_pred             -----cCceEEEEeehHHHHHhcCCCCceEECCCCCHHHHHHHHHHHhCCccCchhhHHHHHHHHHHhCCCHHHHHHHHH
Confidence                 489999999976543       457776                                 22333999999999


Q ss_pred             ccccCChhhHHHHHhhcCCCCCCCCcCCCChhhhhhhc--ceeCCCChhhHHHHhh
Q 037018          202 PLIRIKYEGWQFFILHYGSMPLGSYFQGEAMPTIWRHI--YSVMELPFHLKVCCLY  255 (663)
Q Consensus       202 ~L~~~~~~~W~~~~~~~~~~~l~~~~~~~~~~~i~~~l--~sy~~L~~~~k~cfl~  255 (663)
                      .|+..+.++|.+....     +..    +...++ ..+  +||++||+++|.||-+
T Consensus       231 ~l~~k~~~~~~~~~~~-----L~~----~~~~~v-~~il~~sY~~L~~~lk~c~~~  276 (277)
T d2a5yb3         231 SCEPKTFEKMAQLNNK-----LES----RGLVGV-ECITPYSYKSLAMALQRCVEV  276 (277)
T ss_dssp             TCCSSSHHHHHHHHHH-----HHH----HCSSTT-CCCSSSSSSSHHHHHHHHHHT
T ss_pred             HhccCCHHHHHHHHHH-----Hhc----CcHHHH-HHHHHHHHhcccHHHHHHHHh
Confidence            9996677899888777     432    233556 555  9999999999999975
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d2jdid3 c.37.1.11 (D:82-357) Central domain of beta subunit of F1 ATP synthase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fx0a3 c.37.1.11 (A:97-372) Central domain of alpha subunit of F1 ATP synthase {Spinach (Spinacia oleracea), chloroplast [TaxId: 3562]} Back     information, alignment and structure
>d2gc6a2 c.72.2.2 (A:1-296) Folylpolyglutamate synthetase {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure