Citrus Sinensis ID: 037021

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------14
MDLPRRSHKDLIVNVSHVSDVLPPGKMNFVDLTCSIFVENTEVNKSIYTLFNVVYALNANESHVPYWESKLTRMLQESVGCKSKILMLTCLKTKSSASSMLLSFHKNQSPKSVSTTKTQTESQMHFSTKKATGVASMIK
cccccccEEEEEEEEEEcccccccccEEEEEccccHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHcccccccEEEEEEEcccccccccccccccccccccccccccccHHHHHHHHHHHHcHHcccc
ccccccccEEEEEEEEccccEEEEEEEcHEHccHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHcccccEEEEEEEEccccccHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHcc
MDLPRRSHKDLIVNvshvsdvlppgkmnfvdLTCSIFVENTEVNKSIYTLFNVVYALNANESHVPYWESKLTRMLQESVGCKSKILMLTCLKTKSSASSMLLsfhknqspksvsttktqtesqmhfstkkATGVASMIK
mdlprrshkdlivnvshvsdvlppgkMNFVDLTCSIFVENTEVNKSIYTLFNVVYALNANESHVPYWESKLTRMLQESVGCKSKILMLTCLKTKSSASSMLLsfhknqspksvsttktqtesqmhfstkkatgvasmik
MDLPRRSHKDLIVNVSHVSDVLPPGKMNFVDLTCSIFVENTEVNKSIYTLFNVVYALNANESHVPYWESKLTRMLQESVGCKSKILMLTCLKTKSSASSMLLSFHKNQSPKSVSTTKTQTESQMHFSTKKATGVASMIK
**********LIVNVSHVSDVLPPGKMNFVDLTCSIFVENTEVNKSIYTLFNVVYALNANESHVPYWESKLTRMLQESVGCKSKILMLTCLKT**********************************************
***PRRSHKDLIVNVSHVSDVLPPGKMNFVDLTCSIFVENTEVNKSIYTLFNVVYALNANESHVPYWESKLTRMLQESVGCKSKILMLTCLKTKSSASSMLLSFHKNQS******************************
********KDLIVNVSHVSDVLPPGKMNFVDLTCSIFVENTEVNKSIYTLFNVVYALNANESHVPYWESKLTRMLQESVGCKSKILMLTCLKTKSSASSMLLSFH**********************************
******SHKDLIVNVSHVSDVLPPGKMNFVDLTCSIFVENTEVNKSIYTLFNVVYALNANESHVPYWESKLTRMLQESVGCKSKILMLTCLKTKSSASSMLLSFHKNQSPKSVSTT********HFSTKKATGVASMIK
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDLPRRSHKDLIVNVSHVSDVLPPGKMNFVDLTCSIFVENTEVNKSIYTLFNVVYALNANESHVPYWESKLTRMLQESVGCKSKILMLTCLKTKSSASSMLLSFHKNQSPKSVSTTKTQTESQMHFSTKKATGVASMIK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query139 2.2.26 [Sep-21-2011]
P21613 967 Kinesin heavy chain OS=Do N/A no 0.611 0.087 0.38 5e-10
P17120 1184 Kinesin-like protein bimC yes no 0.647 0.076 0.383 7e-10
P46863 1066 Bipolar kinesin KRP-130 O yes no 0.517 0.067 0.404 2e-09
P46867 784 Kinesin-like protein Klp6 no no 0.697 0.123 0.327 3e-09
Q9I869 651 Kinesin-like protein KIF2 N/A no 0.633 0.135 0.349 1e-08
F9W301 477 Kinesin-1-like protein PS no no 0.827 0.241 0.333 2e-08
Q6RZZ9 1265 Kinesin-related protein 1 yes no 0.446 0.049 0.410 2e-08
Q8J1G4 1129 Kinesin-like protein KIP1 yes no 0.618 0.076 0.379 2e-08
Q29DY1 797 Kinesin-like protein Klp6 no no 0.834 0.145 0.298 2e-08
P82266 1009 Probable 125 kDa kinesin- no no 0.582 0.080 0.355 2e-08
>sp|P21613|KINH_DORPE Kinesin heavy chain OS=Doryteuthis pealeii PE=2 SV=1 Back     alignment and function desciption
 Score = 62.8 bits (151), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 38/100 (38%), Positives = 54/100 (54%), Gaps = 15/100 (15%)

Query: 6   RSHKDLIVNVSHV---SDVLPPGKMNFVDLTCS-----------IFVENTEVNKSIYTLF 51
           RSH   ++NV      +     GK+  VDL  S           +  E   +NKS+  L 
Sbjct: 203 RSHSVFLINVKQENVETQKKLSGKLYLVDLAGSEKVSKTGAEGAVLDEAKNINKSLSALG 262

Query: 52  NVVYAL-NANESHVPYWESKLTRMLQESVGCKSKILMLTC 90
           NV+ AL + N+SHVPY +SKLTR+LQES+G  ++  M+ C
Sbjct: 263 NVISALADGNKSHVPYRDSKLTRILQESLGGNARTTMVIC 302
Kinesin is a microtubule-associated force-producing protein that may play a role in organelle transport.
Loligo pealeii (taxid: 1051067)
>sp|P17120|BIMC_EMENI Kinesin-like protein bimC OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=bimC PE=2 SV=2 Back     alignment and function description
>sp|P46863|KL61_DROME Bipolar kinesin KRP-130 OS=Drosophila melanogaster GN=Klp61F PE=1 SV=2 Back     alignment and function description
>sp|P46867|KLP68_DROME Kinesin-like protein Klp68D OS=Drosophila melanogaster GN=Klp68D PE=2 SV=2 Back     alignment and function description
>sp|Q9I869|KF22A_XENLA Kinesin-like protein KIF22-A OS=Xenopus laevis GN=kif22-a PE=1 SV=1 Back     alignment and function description
>sp|F9W301|PSS1_ORYSJ Kinesin-1-like protein PSS1 OS=Oryza sativa subsp. japonica GN=PSS1 PE=1 SV=1 Back     alignment and function description
>sp|Q6RZZ9|KIF13_DICDI Kinesin-related protein 13 OS=Dictyostelium discoideum GN=kif13 PE=1 SV=1 Back     alignment and function description
>sp|Q8J1G4|KIP1_ASHGO Kinesin-like protein KIP1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=KIP1 PE=3 SV=1 Back     alignment and function description
>sp|Q29DY1|KLP68_DROPS Kinesin-like protein Klp68D OS=Drosophila pseudoobscura pseudoobscura GN=Klp68D PE=3 SV=1 Back     alignment and function description
>sp|P82266|K125_ARATH Probable 125 kDa kinesin-related protein OS=Arabidopsis thaliana GN=At2g36200 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query139
225464499 667 PREDICTED: kinesin-like protein KIF22-li 0.992 0.206 0.469 4e-27
302143839 643 unnamed protein product [Vitis vinifera] 0.992 0.214 0.469 4e-27
449469336 617 PREDICTED: kinesin-like protein KIF22-li 0.928 0.209 0.418 3e-22
307136491 616 kinesin-like protein [Cucumis melo subsp 0.928 0.209 0.423 4e-22
224134869 656 predicted protein [Populus trichocarpa] 0.935 0.198 0.418 4e-18
356529192 687 PREDICTED: kinesin-related protein 3-lik 0.784 0.158 0.418 3e-15
334187882 701 ATP binding microtubule motor family pro 0.726 0.144 0.446 5e-15
10176858 665 unnamed protein product [Arabidopsis tha 0.647 0.135 0.465 1e-14
297808399 741 hypothetical protein ARALYDRAFT_489253 [ 0.712 0.133 0.438 2e-14
356561540 611 PREDICTED: kinesin-like protein KIF22-li 0.856 0.194 0.369 5e-14
>gi|225464499|ref|XP_002272003.1| PREDICTED: kinesin-like protein KIF22-like [Vitis vinifera] Back     alignment and taxonomy information
 Score =  126 bits (316), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 84/179 (46%), Positives = 100/179 (55%), Gaps = 41/179 (22%)

Query: 2   DLPRRSHKDLIVNVS-HVSDVLPPGKMNFVDLTC-----------SIFVENTEVNKSIYT 49
           +LPRRSHK L+V VS   S+    GKMNFVDL                +ENT++NKS+Y 
Sbjct: 221 ELPRRSHKGLMVYVSSQNSETNLVGKMNFVDLAGYEDTRKKSVDGPNLMENTKINKSLYA 280

Query: 50  LFNVVYALNANESHVPYWESKLTRMLQESVGCKSKILMLTCL------------------ 91
           L NVVYAL+ NESHVPY ESKLTRMLQ+S G  ++ILM+TCL                  
Sbjct: 281 LQNVVYALSVNESHVPYRESKLTRMLQDSFGGMNQILMVTCLNPSFCQDTIYSVSLASRS 340

Query: 92  ----------KTKSSASSMLLSFHKNQSPKSVSTT-KTQTESQMHFSTKKATGVASMIK 139
                     K KSSA    LS  KN  P  VS+T K QT SQ+HFS KKA    S++K
Sbjct: 341 YQRAFTNSTKKIKSSAKPTGLSALKNGKPTGVSSTVKKQTSSQVHFSDKKANFTDSIVK 399

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|302143839|emb|CBI22700.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|449469336|ref|XP_004152377.1| PREDICTED: kinesin-like protein KIF22-like [Cucumis sativus] gi|449488639|ref|XP_004158124.1| PREDICTED: kinesin-like protein KIF22-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|307136491|gb|ADN34291.1| kinesin-like protein [Cucumis melo subsp. melo] Back     alignment and taxonomy information
>gi|224134869|ref|XP_002321925.1| predicted protein [Populus trichocarpa] gi|222868921|gb|EEF06052.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356529192|ref|XP_003533180.1| PREDICTED: kinesin-related protein 3-like [Glycine max] Back     alignment and taxonomy information
>gi|334187882|ref|NP_197779.4| ATP binding microtubule motor family protein [Arabidopsis thaliana] gi|332005850|gb|AED93233.1| ATP binding microtubule motor family protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|10176858|dbj|BAB10064.1| unnamed protein product [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297808399|ref|XP_002872083.1| hypothetical protein ARALYDRAFT_489253 [Arabidopsis lyrata subsp. lyrata] gi|297317920|gb|EFH48342.1| hypothetical protein ARALYDRAFT_489253 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|356561540|ref|XP_003549039.1| PREDICTED: kinesin-like protein KIF22-like, partial [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query139
TAIR|locus:2180122 628 AT5G02370 [Arabidopsis thalian 0.633 0.140 0.415 1.1e-11
ZFIN|ZDB-GENE-110408-6 992 si:ch73-130n22.1 "si:ch73-130n 0.611 0.085 0.36 2.4e-09
UNIPROTKB|E1BNN5 1393 KIF27 "Uncharacterized protein 0.640 0.063 0.333 4e-09
UNIPROTKB|Q86VH2 1401 KIF27 "Kinesin-like protein KI 0.611 0.060 0.329 5.1e-09
WB|WBGene00002222 1130 klp-11 [Caenorhabditis elegans 0.856 0.105 0.335 1.9e-08
UNIPROTKB|A0JN40 792 KIF3C "Kinesin-like protein KI 0.467 0.082 0.424 1.9e-08
UNIPROTKB|F8WAR6 672 KIF3C "Kinesin-like protein KI 0.467 0.096 0.424 2e-08
TAIR|locus:2027854 1025 AT1G73860 [Arabidopsis thalian 0.769 0.104 0.327 2.1e-08
UNIPROTKB|F8WER6 685 KIF3C "Kinesin-like protein KI 0.467 0.094 0.424 2.1e-08
TAIR|locus:2049791 1039 AT2G37420 [Arabidopsis thalian 0.604 0.080 0.357 2.2e-08
TAIR|locus:2180122 AT5G02370 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 169 (64.5 bits), Expect = 1.1e-11, P = 1.1e-11
 Identities = 42/101 (41%), Positives = 62/101 (61%)

Query:     2 DLPRRSHKDLIVNVSHVSDVLPPGKMNFVDLTCSI-----------FVENTEVNKSIYTL 50
             D+  RSH  L+++V+  S  L  GK+N +DL  +              E+ ++N+S++ L
Sbjct:   221 DVSSRSHGVLVISVT--SQGLVTGKINLIDLAGNEDNRRTGNEGIRLQESAKINQSLFAL 278

Query:    51 FNVVYALNANESHVPYWESKLTRMLQESVGCKSKILMLTCL 91
              NVVYALN N   VPY E+KLTR+LQ+S+G  S+ LM+ CL
Sbjct:   279 SNVVYALNNNLPRVPYRETKLTRILQDSLGGTSRALMVACL 319
GO:0003677 "DNA binding" evidence=IEA
GO:0003777 "microtubule motor activity" evidence=IEA;ISS
GO:0005524 "ATP binding" evidence=IEA
GO:0005794 "Golgi apparatus" evidence=ISM
GO:0006281 "DNA repair" evidence=IEA
GO:0007018 "microtubule-based movement" evidence=IEA
GO:0009507 "chloroplast" evidence=IDA
GO:0006275 "regulation of DNA replication" evidence=RCA
GO:0009909 "regulation of flower development" evidence=RCA
GO:0010389 "regulation of G2/M transition of mitotic cell cycle" evidence=RCA
GO:0016570 "histone modification" evidence=RCA
GO:0048449 "floral organ formation" evidence=RCA
ZFIN|ZDB-GENE-110408-6 si:ch73-130n22.1 "si:ch73-130n22.1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|E1BNN5 KIF27 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q86VH2 KIF27 "Kinesin-like protein KIF27" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
WB|WBGene00002222 klp-11 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
UNIPROTKB|A0JN40 KIF3C "Kinesin-like protein KIF3C" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F8WAR6 KIF3C "Kinesin-like protein KIF3C" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
TAIR|locus:2027854 AT1G73860 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|F8WER6 KIF3C "Kinesin-like protein KIF3C" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
TAIR|locus:2049791 AT2G37420 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query139
cd01376319 cd01376, KISc_KID_like, Kinesin motor domain, KIF2 4e-17
pfam00225326 pfam00225, Kinesin, Kinesin motor domain 1e-16
cd01364352 cd01364, KISc_BimC_Eg5, Kinesin motor domain, BimC 7e-15
cd01366329 cd01366, KISc_C_terminal, Kinesin motor domain, KI 1e-13
cd01372341 cd01372, KISc_KIF4, Kinesin motor domain, KIF4-lik 5e-12
smart00129335 smart00129, KISc, Kinesin motor, catalytic domain 2e-11
cd01371333 cd01371, KISc_KIF3, Kinesin motor domain, kinesins 2e-11
cd00106328 cd00106, KISc, Kinesin motor domain 4e-11
cd01369325 cd01369, KISc_KHC_KIF5, Kinesin motor domain, kine 5e-11
cd01363186 cd01363, Motor_domain, Myosin and Kinesin motor do 9e-09
cd01375334 cd01375, KISc_KIF9_like, Kinesin motor domain, KIF 4e-08
cd01370338 cd01370, KISc_KIP3_like, Kinesin motor domain, KIP 5e-08
cd01367322 cd01367, KISc_KIF2_like, Kinesin motor domain, KIF 6e-08
cd01365356 cd01365, KISc_KIF1A_KIF1B, Kinesin motor domain, K 1e-07
cd01374321 cd01374, KISc_CENP_E, Kinesin motor domain, CENP-E 2e-07
COG5059 568 COG5059, KIP1, Kinesin-like protein [Cytoskeleton] 6e-07
cd01373337 cd01373, KISc_KLP2_like, Kinesin motor domain, KLP 3e-05
cd01368345 cd01368, KISc_KIF23_like, Kinesin motor domain, KI 3e-04
PLN03188 1320 PLN03188, PLN03188, kinesin-12 family protein; Pro 0.001
>gnl|CDD|238672 cd01376, KISc_KID_like, Kinesin motor domain, KIF22/Kid-like subgroup Back     alignment and domain information 
 Score = 75.2 bits (185), Expect = 4e-17
 Identities = 36/103 (34%), Positives = 54/103 (52%), Gaps = 12/103 (11%)

Query: 6   RSHKDLIVNV-SHVSDVLPPGKMNFVDLTCS-----------IFVENTEVNKSIYTLFNV 53
           RSH  L + V    S++   GK+N +DL  S              E+  +N S++ L  V
Sbjct: 201 RSHAVLRIKVTQPASNIQLEGKLNLIDLAGSEDNRRTGNEGIRLKESAAINSSLFVLSKV 260

Query: 54  VYALNANESHVPYWESKLTRMLQESVGCKSKILMLTCLKTKSS 96
           V ALN     +PY ESKLTR+LQ+S+G  S+ +M+  +  + S
Sbjct: 261 VDALNKGLPRIPYRESKLTRLLQDSLGGGSRCIMVANIAPERS 303

Members of this group might play a role in regulating chromosomal movement along microtubules in mitosis. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Kinesins are microtubule-dependent molecular motors that play important roles in intracellular transport and in cell division. In most kinesins, the motor domain is found at the N-terminus (N-type). N-type kinesins are (+) end-directed motors, i.e. they transport cargo towards the (+) end of the microtubule. Kinesin motor domains hydrolyze ATP at a rate of about 80 per second, and move along the microtubule at a speed of about 6400 Angstroms per second. To achieve that, kinesin head groups work in pairs. Upon replacing ADP with ATP, a kinesin motor domain increases its affinity for microtubule binding and locks in place. Also, the neck linker binds to the motor domain, which repositions the other head domain through the coiled-coil domain close to a second tubulin dimer, about 80 Angstroms along the microtubule. Meanwhile, ATP hydrolysis takes place, and when the second head domain binds to the microtubule, the first domain again replaces ADP with ATP, triggering a conformational change that pulls the first domain forward. Length = 319
>gnl|CDD|215803 pfam00225, Kinesin, Kinesin motor domain Back     alignment and domain information
>gnl|CDD|238660 cd01364, KISc_BimC_Eg5, Kinesin motor domain, BimC/Eg5 spindle pole proteins, participate in spindle assembly and chromosome segregation during cell division Back     alignment and domain information
>gnl|CDD|238662 cd01366, KISc_C_terminal, Kinesin motor domain, KIFC2/KIFC3/ncd-like carboxy-terminal kinesins Back     alignment and domain information
>gnl|CDD|238668 cd01372, KISc_KIF4, Kinesin motor domain, KIF4-like subfamily Back     alignment and domain information
>gnl|CDD|214526 smart00129, KISc, Kinesin motor, catalytic domain Back     alignment and domain information
>gnl|CDD|238667 cd01371, KISc_KIF3, Kinesin motor domain, kinesins II or KIF3_like proteins Back     alignment and domain information
>gnl|CDD|238054 cd00106, KISc, Kinesin motor domain Back     alignment and domain information
>gnl|CDD|238665 cd01369, KISc_KHC_KIF5, Kinesin motor domain, kinesin heavy chain (KHC) or KIF5-like subgroup Back     alignment and domain information
>gnl|CDD|238659 cd01363, Motor_domain, Myosin and Kinesin motor domain Back     alignment and domain information
>gnl|CDD|238671 cd01375, KISc_KIF9_like, Kinesin motor domain, KIF9-like subgroup; might play a role in cell shape remodeling Back     alignment and domain information
>gnl|CDD|238666 cd01370, KISc_KIP3_like, Kinesin motor domain, KIP3-like subgroup Back     alignment and domain information
>gnl|CDD|238663 cd01367, KISc_KIF2_like, Kinesin motor domain, KIF2-like group Back     alignment and domain information
>gnl|CDD|238661 cd01365, KISc_KIF1A_KIF1B, Kinesin motor domain, KIF1_like proteins Back     alignment and domain information
>gnl|CDD|238670 cd01374, KISc_CENP_E, Kinesin motor domain, CENP-E/KIP2-like subgroup, involved in chromosome movement and/or spindle elongation during mitosis Back     alignment and domain information
>gnl|CDD|227392 COG5059, KIP1, Kinesin-like protein [Cytoskeleton] Back     alignment and domain information
>gnl|CDD|238669 cd01373, KISc_KLP2_like, Kinesin motor domain, KLP2-like subgroup Back     alignment and domain information
>gnl|CDD|238664 cd01368, KISc_KIF23_like, Kinesin motor domain, KIF23-like subgroup Back     alignment and domain information
>gnl|CDD|215621 PLN03188, PLN03188, kinesin-12 family protein; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 139
KOG0243 1041 consensus Kinesin-like protein [Cytoskeleton] 100.0
KOG4280 574 consensus Kinesin-like protein [Cytoskeleton] 100.0
KOG0240 607 consensus Kinesin (SMY1 subfamily) [Cytoskeleton] 100.0
KOG0245 1221 consensus Kinesin-like protein [Cytoskeleton] 100.0
cd01373337 KISc_KLP2_like Kinesin motor domain, KLP2-like sub 100.0
cd01370338 KISc_KIP3_like Kinesin motor domain, KIP3-like sub 100.0
KOG0242 675 consensus Kinesin-like protein [Cytoskeleton] 99.97
cd01368345 KISc_KIF23_like Kinesin motor domain, KIF23-like s 99.97
cd01363186 Motor_domain Myosin and Kinesin motor domain. Thes 99.97
cd01367322 KISc_KIF2_like Kinesin motor domain, KIF2-like gro 99.97
cd01364352 KISc_BimC_Eg5 Kinesin motor domain, BimC/Eg5 spind 99.97
cd01376319 KISc_KID_like Kinesin motor domain, KIF22/Kid-like 99.97
PLN03188 1320 kinesin-12 family protein; Provisional 99.97
KOG0239670 consensus Kinesin (KAR3 subfamily) [Cytoskeleton] 99.97
cd01369325 KISc_KHC_KIF5 Kinesin motor domain, kinesin heavy 99.97
cd01375334 KISc_KIF9_like Kinesin motor domain, KIF9-like sub 99.97
cd01374321 KISc_CENP_E Kinesin motor domain, CENP-E/KIP2-like 99.97
cd01371333 KISc_KIF3 Kinesin motor domain, kinesins II or KIF 99.97
cd01372341 KISc_KIF4 Kinesin motor domain, KIF4-like subfamil 99.97
cd01365356 KISc_KIF1A_KIF1B Kinesin motor domain, KIF1_like p 99.97
cd01366329 KISc_C_terminal Kinesin motor domain, KIFC2/KIFC3/ 99.97
PF00225335 Kinesin: Kinesin motor domain; InterPro: IPR001752 99.96
KOG0246 676 consensus Kinesin-like protein [Cytoskeleton] 99.96
cd00106328 KISc Kinesin motor domain. This catalytic (head) d 99.95
smart00129335 KISc Kinesin motor, catalytic domain. ATPase. Micr 99.95
KOG0241 1714 consensus Kinesin-like protein [Cytoskeleton] 99.95
KOG0244 913 consensus Kinesin-like protein [Cytoskeleton] 99.95
KOG0247 809 consensus Kinesin-like protein [Cytoskeleton] 99.94
COG5059 568 KIP1 Kinesin-like protein [Cytoskeleton] 99.93
>KOG0243 consensus Kinesin-like protein [Cytoskeleton] Back     alignment and domain information 
Probab=100.00  E-value=7.7e-38  Score=282.07  Aligned_cols=133  Identities=31%  Similarity=0.438  Sum_probs=112.3

Q ss_pred             CCCCCcceEEEEEEEEeee------CCCCCeeEEEEeCCCC-----------cccccccccccHHHHHHHHHHHhcCCCc
Q 037021            1 MDLPRRSHKDLIVNVSHVS------DVLPPGKMNFVDLTCS-----------IFVENTEVNKSIYTLFNVVYALNANESH   63 (139)
Q Consensus         1 ~~~SSRSH~if~i~v~~~~------~~~~~s~L~lVDLAGS-----------~~~E~~~in~SL~aL~~vi~aL~~~~~~   63 (139)
                      +++|||||+||+|+|....      ...+.|||+|||||||           |.+|+..||+||.+||+||+||.++..|
T Consensus       260 N~~SSRSHsIFsItvhike~t~~geelvK~GKLNLVDLAGSENI~RSGA~~~RArEAG~INqSLLTLGRVInALVe~s~H  339 (1041)
T KOG0243|consen  260 NDQSSRSHSIFSITVHIKENTPEGEELVKIGKLNLVDLAGSENISRSGARNGRAREAGEINQSLLTLGRVINALVEHSGH  339 (1041)
T ss_pred             hhhccccceEEEEEEEEecCCCcchhhHhhcccceeeccccccccccccccchhHHhhhhhHHHHHHHHHHHHHHccCCC
Confidence            4789999999999997765      2578899999999999           8999999999999999999999999999


Q ss_pred             cccCcchhhhhhhcccCCCccEEEEEEecCCCCcccee---eeh------hhccCCcccc-----------cccccchhh
Q 037021           64 VPYWESKLTRMLQESVGCKSKILMLTCLKTKSSASSML---LSF------HKNQSPKSVS-----------TTKTQTESQ  123 (139)
Q Consensus        64 vpyr~SkLT~lL~~sLgg~~~t~~I~~vsp~~~~~~~~---L~f------~~~~~~~~~~-----------~~~~~~~~~  123 (139)
                      ||||+|||||||||+|||..+|+|||||||+..+-+++   |.|      |+|++.+|-+           .++.+++.|
T Consensus       340 IPYRESKLTRLLQDSLGGkTKT~iIATiSPa~~~lEETlSTLEYA~RAKnIkNKPevNQkl~K~~llKd~~~EIerLK~d  419 (1041)
T KOG0243|consen  340 IPYRESKLTRLLQDSLGGKTKTCIIATISPAKHNLEETLSTLEYAHRAKNIKNKPEVNQKLMKKTLLKDLYEEIERLKRD  419 (1041)
T ss_pred             CCchHHHHHHHHHHHhCCCceeEEEEEeCCCcccHHHHHHHHHHHHHhhhccCCCccchHHHHHHHHHHHHHHHHHHHHH
Confidence            99999999999999999999999999999976554444   778      4555554411           255677777


Q ss_pred             hhhhhhhhhcc
Q 037021          124 MHFSTKKATGV  134 (139)
Q Consensus       124 ~~~~~~~~~~~  134 (139)
                      + .+++++.||
T Consensus       420 l-~AaReKnGv  429 (1041)
T KOG0243|consen  420 L-AAAREKNGV  429 (1041)
T ss_pred             H-HHhHhhCce
Confidence            7 677777765

>KOG4280 consensus Kinesin-like protein [Cytoskeleton] Back     alignment and domain information
>KOG0240 consensus Kinesin (SMY1 subfamily) [Cytoskeleton] Back     alignment and domain information
>KOG0245 consensus Kinesin-like protein [Cytoskeleton] Back     alignment and domain information
>cd01373 KISc_KLP2_like Kinesin motor domain, KLP2-like subgroup Back     alignment and domain information
>cd01370 KISc_KIP3_like Kinesin motor domain, KIP3-like subgroup Back     alignment and domain information
>KOG0242 consensus Kinesin-like protein [Cytoskeleton] Back     alignment and domain information
>cd01368 KISc_KIF23_like Kinesin motor domain, KIF23-like subgroup Back     alignment and domain information
>cd01363 Motor_domain Myosin and Kinesin motor domain Back     alignment and domain information
>cd01367 KISc_KIF2_like Kinesin motor domain, KIF2-like group Back     alignment and domain information
>cd01364 KISc_BimC_Eg5 Kinesin motor domain, BimC/Eg5 spindle pole proteins, participate in spindle assembly and chromosome segregation during cell division Back     alignment and domain information
>cd01376 KISc_KID_like Kinesin motor domain, KIF22/Kid-like subgroup Back     alignment and domain information
>PLN03188 kinesin-12 family protein; Provisional Back     alignment and domain information
>KOG0239 consensus Kinesin (KAR3 subfamily) [Cytoskeleton] Back     alignment and domain information
>cd01369 KISc_KHC_KIF5 Kinesin motor domain, kinesin heavy chain (KHC) or KIF5-like subgroup Back     alignment and domain information
>cd01375 KISc_KIF9_like Kinesin motor domain, KIF9-like subgroup; might play a role in cell shape remodeling Back     alignment and domain information
>cd01374 KISc_CENP_E Kinesin motor domain, CENP-E/KIP2-like subgroup, involved in chromosome movement and/or spindle elongation during mitosis Back     alignment and domain information
>cd01371 KISc_KIF3 Kinesin motor domain, kinesins II or KIF3_like proteins Back     alignment and domain information
>cd01372 KISc_KIF4 Kinesin motor domain, KIF4-like subfamily Back     alignment and domain information
>cd01365 KISc_KIF1A_KIF1B Kinesin motor domain, KIF1_like proteins Back     alignment and domain information
>cd01366 KISc_C_terminal Kinesin motor domain, KIFC2/KIFC3/ncd-like carboxy-terminal kinesins Back     alignment and domain information
>PF00225 Kinesin: Kinesin motor domain; InterPro: IPR001752 Kinesin [, , ] is a microtubule-associated force-producing protein that may play a role in organelle transport Back     alignment and domain information
>KOG0246 consensus Kinesin-like protein [Cytoskeleton] Back     alignment and domain information
>cd00106 KISc Kinesin motor domain Back     alignment and domain information
>smart00129 KISc Kinesin motor, catalytic domain Back     alignment and domain information
>KOG0241 consensus Kinesin-like protein [Cytoskeleton] Back     alignment and domain information
>KOG0244 consensus Kinesin-like protein [Cytoskeleton] Back     alignment and domain information
>KOG0247 consensus Kinesin-like protein [Cytoskeleton] Back     alignment and domain information
>COG5059 KIP1 Kinesin-like protein [Cytoskeleton] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query139
2wbe_C373 Kinesin-5-Tubulin Complex With Amppnp Length = 373 4e-10
2h58_A330 Crystal Structure Of The Kifc3 Motor Domain In Comp 2e-09
4a14_A344 Human Kif7, A Kinesin Involved In Hedgehog Signalli 3e-09
2vvg_A350 Crystal Structure Of The G.Intestinalis Kinesin 2 G 3e-09
2y5w_A365 Crystal Structure Of Drosophila Melanogaster Kinesi 4e-09
2xt3_A344 Human Kif7, A Kinesin Involved In Hedgehog Signalli 2e-08
4aqv_C373 Model Of Human Kinesin-5 Motor Domain (3hqd) And Ma 2e-08
4ap0_A370 The Mitotic Kinesin Eg5 In Complex With Mg-Adp And 2e-08
4a1z_A368 Eg5-1 Length = 368 3e-08
1ii6_A368 Crystal Structure Of The Mitotic Kinesin Eg5 In Com 3e-08
1q0b_A367 Crystal Structure Of The Motor Protein Ksp In Compl 3e-08
4a28_A368 Eg5-2 Length = 368 3e-08
3hqd_A369 Human Kinesin Eg5 Motor Domain In Complex With Ampp 3e-08
3b6u_A372 Crystal Structure Of The Motor Domain Of Human Kine 3e-08
1x88_A359 Human Eg5 Motor Domain Bound To Mg-Adp And Monastro 3e-08
3zcw_A348 Eg5 - New Allosteric Binding Site Length = 348 3e-08
3b6v_A395 Crystal Structure Of The Motor Domain Of Human Kine 4e-08
3bfn_A388 Crystal Structure Of The Motor Domain Of Human Kine 6e-08
1bg2_A325 Human Ubiquitous Kinesin Motor Domain Length = 325 7e-08
1mkj_A349 Human Kinesin Motor Domain With Docked Neck Linker 8e-08
4atx_C340 Rigor Kinesin Motor Domain With An Ordered Neck-Lin 9e-08
3lre_A355 Crystal Structure Analysis Of Human Kinesin-8 Motor 2e-07
1goj_A355 Structure Of A Fast Kinesin: Implications For Atpas 3e-07
1sdm_A369 Crystal Structure Of Kinesin-Like Calmodulin Bindin 4e-07
2ncd_A420 Ncd (Non-Claret Disjunctional) Dimer From D. Melano 4e-07
2rep_A376 Crystal Structure Of The Motor Domain Of Human Kine 4e-07
3u06_A412 Crystal Structure Of The Kinesin-14 Ncdg347d Length 4e-07
3l1c_A383 Kinesin-14 Protein Ncd, T436s Mutant Length = 383 5e-07
1cz7_A406 The Crystal Structure Of A Minus-End Directed Micro 5e-07
3h4s_A386 Structure Of The Complex Of A Mitotic Kinesin With 7e-07
4h1g_A715 Structure Of Candida Albicans Kar3 Motor Domain Fus 7e-07
3t0q_A349 Motor Domain Structure Of The Kar3-Like Kinesin Fro 2e-06
1n6m_A409 Rotation Of The StalkNECK AND ONE HEAD IN A NEW CRY 3e-06
2heh_A387 Crystal Structure Of The Kif2c Motor Domain (Casp T 1e-05
3edl_D331 Kinesin13-Microtubule Ring Complex Length = 331 1e-05
3kin_B117 Kinesin (Dimeric) From Rattus Norvegicus Length = 1 1e-05
1v8j_A410 The Crystal Structure Of The Minimal Functional Dom 1e-05
4etp_A403 C-Terminal Motor And Motor Homology Domain Of Kar3v 2e-05
1f9w_A347 Crystal Structures Of Mutants Reveal A Signalling P 3e-05
2kin_B100 Kinesin (Monomeric) From Rattus Norvegicus Length = 3e-05
1ry6_A360 Crystal Structure Of Internal Kinesin Motor Domain 3e-05
3kar_A346 The Motor Domain Of Kinesin-Like Protein Kar3, A Sa 5e-05
1f9t_A358 Crystal Structures Of Kinesin Mutants Reveal A Sign 5e-05
1f9v_A347 Crystal Structures Of Mutants Reveal A Signalling P 6e-05
4gkr_A371 Structure Of The C-Terminal Motor Domain Of Kar3 Fr 2e-04
1f9u_A347 Crystal Structures Of Mutants Reveal A Signalling P 3e-04
2gry_A420 Crystal Structure Of The Human Kif2 Motor Domain In 5e-04
>pdb|2WBE|C Chain C, Kinesin-5-Tubulin Complex With Amppnp Length = 373 Back     alignment and structure 
Iteration: 1

 Score = 60.1 bits (144), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 34/84 (40%), Positives = 47/84 (55%), Gaps = 12/84 (14%)
Query: 20  DVLPPGKMNFVDLTCSIFV------------ENTEVNKSIYTLFNVVYALNANESHVPYW 67
           D+L  GK+N VDL  S  V            E   +N+S+ TL  V+ AL     HVPY 
Sbjct: 255 DMLKIGKLNLVDLAGSENVSKAGNEKGIRVRETVNINQSLLTLGRVITALVDRAPHVPYR 314
Query: 68  ESKLTRMLQESVGCKSKILMLTCL 91
           ESKLTR+LQES+G ++K  ++  +
Sbjct: 315 ESKLTRLLQESLGGRTKTSIIATI 338
>pdb|2H58|A Chain A, Crystal Structure Of The Kifc3 Motor Domain In Complex With Adp Length = 330 Back     alignment and structure
>pdb|4A14|A Chain A, Human Kif7, A Kinesin Involved In Hedgehog Signalling Length = 344 Back     alignment and structure
>pdb|2VVG|A Chain A, Crystal Structure Of The G.Intestinalis Kinesin 2 Gikin2a Motor Domain Length = 350 Back     alignment and structure
>pdb|2Y5W|A Chain A, Crystal Structure Of Drosophila Melanogaster Kinesin-1 Motor Domain Dimer Length = 365 Back     alignment and structure
>pdb|2XT3|A Chain A, Human Kif7, A Kinesin Involved In Hedgehog Signalling Length = 344 Back     alignment and structure
>pdb|4AQV|C Chain C, Model Of Human Kinesin-5 Motor Domain (3hqd) And Mammalian Tubulin Heterodimer (1jff) Docked Into The 9.7-angstrom Cryo-em Map Of Microtubule-bound Kinesin-5 Motor Domain In The Ampppnp State. Length = 373 Back     alignment and structure
>pdb|4AP0|A Chain A, The Mitotic Kinesin Eg5 In Complex With Mg-Adp And Ispinesib Length = 370 Back     alignment and structure
>pdb|4A1Z|A Chain A, Eg5-1 Length = 368 Back     alignment and structure
>pdb|1II6|A Chain A, Crystal Structure Of The Mitotic Kinesin Eg5 In Complex With Mg-Adp. Length = 368 Back     alignment and structure
>pdb|1Q0B|A Chain A, Crystal Structure Of The Motor Protein Ksp In Complex With Adp And Monastrol Length = 367 Back     alignment and structure
>pdb|4A28|A Chain A, Eg5-2 Length = 368 Back     alignment and structure
>pdb|3HQD|A Chain A, Human Kinesin Eg5 Motor Domain In Complex With Amppnp And Mg2+ Length = 369 Back     alignment and structure
>pdb|3B6U|A Chain A, Crystal Structure Of The Motor Domain Of Human Kinesin Family Member 3b In Complex With Adp Length = 372 Back     alignment and structure
>pdb|1X88|A Chain A, Human Eg5 Motor Domain Bound To Mg-Adp And Monastrol Length = 359 Back     alignment and structure
>pdb|3ZCW|A Chain A, Eg5 - New Allosteric Binding Site Length = 348 Back     alignment and structure
>pdb|3B6V|A Chain A, Crystal Structure Of The Motor Domain Of Human Kinesin Family Member 3c In Complex With Adp Length = 395 Back     alignment and structure
>pdb|3BFN|A Chain A, Crystal Structure Of The Motor Domain Of Human Kinesin Family Member 22 Length = 388 Back     alignment and structure
>pdb|1BG2|A Chain A, Human Ubiquitous Kinesin Motor Domain Length = 325 Back     alignment and structure
>pdb|1MKJ|A Chain A, Human Kinesin Motor Domain With Docked Neck Linker Length = 349 Back     alignment and structure
>pdb|4ATX|C Chain C, Rigor Kinesin Motor Domain With An Ordered Neck-Linker, Docked On Tubulin Dimer, Modelled Into The 8a Cryo-Em Map Of Doublecortin-Microtubules Decorated With Kinesin Length = 340 Back     alignment and structure
>pdb|3LRE|A Chain A, Crystal Structure Analysis Of Human Kinesin-8 Motor Domain Length = 355 Back     alignment and structure
>pdb|1GOJ|A Chain A, Structure Of A Fast Kinesin: Implications For Atpase Mechanism And Interactions With Microtubules Length = 355 Back     alignment and structure
>pdb|1SDM|A Chain A, Crystal Structure Of Kinesin-Like Calmodulin Binding Protein Length = 369 Back     alignment and structure
>pdb|2NCD|A Chain A, Ncd (Non-Claret Disjunctional) Dimer From D. Melanogaster Length = 420 Back     alignment and structure
>pdb|2REP|A Chain A, Crystal Structure Of The Motor Domain Of Human Kinesin Family Member C1 Length = 376 Back     alignment and structure
>pdb|3U06|A Chain A, Crystal Structure Of The Kinesin-14 Ncdg347d Length = 412 Back     alignment and structure
>pdb|3L1C|A Chain A, Kinesin-14 Protein Ncd, T436s Mutant Length = 383 Back     alignment and structure
>pdb|1CZ7|A Chain A, The Crystal Structure Of A Minus-End Directed Microtubule Motor Protein Ncd Reveals Variable Dimer Conformations Length = 406 Back     alignment and structure
>pdb|3H4S|A Chain A, Structure Of The Complex Of A Mitotic Kinesin With Its Calcium Binding Regulator Length = 386 Back     alignment and structure
>pdb|4H1G|A Chain A, Structure Of Candida Albicans Kar3 Motor Domain Fused To Maltose- Binding Protein Length = 715 Back     alignment and structure
>pdb|3T0Q|A Chain A, Motor Domain Structure Of The Kar3-Like Kinesin From Ashbya Gossypii Length = 349 Back     alignment and structure
>pdb|1N6M|A Chain A, Rotation Of The StalkNECK AND ONE HEAD IN A NEW CRYSTAL Structure Of The Kinesin Motor Protein, Ncd Length = 409 Back     alignment and structure
>pdb|2HEH|A Chain A, Crystal Structure Of The Kif2c Motor Domain (Casp Target) Length = 387 Back     alignment and structure
>pdb|3EDL|D Chain D, Kinesin13-Microtubule Ring Complex Length = 331 Back     alignment and structure
>pdb|3KIN|B Chain B, Kinesin (Dimeric) From Rattus Norvegicus Length = 117 Back     alignment and structure
>pdb|1V8J|A Chain A, The Crystal Structure Of The Minimal Functional Domain Of The Microtubule Destabilizer Kif2c Complexed With Mg-adp Length = 410 Back     alignment and structure
>pdb|4ETP|A Chain A, C-Terminal Motor And Motor Homology Domain Of Kar3vik1 Fused To A Synthetic Heterodimeric Coiled Coil Length = 403 Back     alignment and structure
>pdb|1F9W|A Chain A, Crystal Structures Of Mutants Reveal A Signalling Pathway For Activation Of The Kinesin Motor Atpase Length = 347 Back     alignment and structure
>pdb|2KIN|B Chain B, Kinesin (Monomeric) From Rattus Norvegicus Length = 100 Back     alignment and structure
>pdb|1RY6|A Chain A, Crystal Structure Of Internal Kinesin Motor Domain Length = 360 Back     alignment and structure
>pdb|3KAR|A Chain A, The Motor Domain Of Kinesin-Like Protein Kar3, A Saccharomyces Cerevisiae Kinesin-Related Protein Length = 346 Back     alignment and structure
>pdb|1F9T|A Chain A, Crystal Structures Of Kinesin Mutants Reveal A Signalling Pathway For Activation Of The Motor Atpase Length = 358 Back     alignment and structure
>pdb|1F9V|A Chain A, Crystal Structures Of Mutants Reveal A Signalling Pathway For Activation Of The Kinesin Motor Atpase Length = 347 Back     alignment and structure
>pdb|4GKR|A Chain A, Structure Of The C-Terminal Motor Domain Of Kar3 From Candida Glabrata Length = 371 Back     alignment and structure
>pdb|1F9U|A Chain A, Crystal Structures Of Mutants Reveal A Signalling Pathway For Activation Of The Kinesin Motor Atpase Length = 347 Back     alignment and structure
>pdb|2GRY|A Chain A, Crystal Structure Of The Human Kif2 Motor Domain In Complex With Adp Length = 420 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query139
3cob_A369 Kinesin heavy chain-like protein; motor, switch II 5e-16
1ry6_A360 Internal kinesin; kinesin motor domain, nucleotide 5e-16
3bfn_A388 Kinesin-like protein KIF22; limited proteolysis, s 6e-16
2h58_A330 Kinesin-like protein KIFC3 variant; motor domain, 8e-16
3dc4_A344 Kinesin-like protein NOD; catalytic domain, ATPase 1e-15
3u06_A412 Protein claret segregational; motor domain, stalk 2e-15
1bg2_A325 Kinesin; motor protein, ATPase, microtubule associ 5e-15
2rep_A376 Kinesin-like protein KIFC1; structural genomics co 1e-14
1x88_A359 Kinesin-like protein KIF11; switch II, motor domai 2e-14
2wbe_C373 Bipolar kinesin KRP-130; EG5, KLP61F, tubulin, mit 3e-14
2vvg_A350 Kinesin-2; motor protein, nucleotide-binding, micr 6e-14
2heh_A387 KIF2C protein; kinesin, motor domain, ADP, structu 8e-14
2y65_A365 Kinesin, kinesin heavy chain; motor protein; HET: 8e-14
4etp_A403 Kinesin-like protein KAR3; kinesin motor protein, 9e-14
1v8k_A410 Kinesin-like protein KIF2C; microtubule destabiliz 2e-13
1f9v_A347 Kinesin-like protein KAR3; kinesin-related protein 2e-13
3t0q_A349 AGR253WP; kinesin, alpha and beta proteins, P-loop 4e-13
4a14_A344 Kinesin, kinesin-like protein KIF7; motor protein, 5e-13
1goj_A355 Kinesin, kinesin heavy chain; motor protein, ATPas 6e-13
2nr8_A358 Kinesin-like protein KIF9; motor domain, ADP, stru 8e-13
2kin_B100 Kinesin; motor protein, cytoskeleton; HET: ADP; 2. 1e-12
1t5c_A349 CENP-E protein, centromeric protein E; kinesin mot 2e-12
3lre_A355 Kinesin-like protein KIF18A; motor protein, nucleo 2e-12
3b6u_A372 Kinesin-like protein KIF3B; structural genomics co 3e-12
3kin_B117 Kinesin heavy chain; motor protein, cytoskeleton; 3e-12
3gbj_A354 KIF13B protein; kinesin, motor domain, ADP, struct 2e-11
2zfi_A366 Kinesin-like protein KIF1A, kinesin heavy chain is 9e-11
2owm_A443 Nckin3-434, related to kinesin-like protein KIF1C; 2e-09
>3cob_A Kinesin heavy chain-like protein; motor, switch II, loop L11, conformation, nucleotide, ATP-binding, microtubule, motor protein; HET: ADP; 2.20A {Solanum tuberosum} SCOP: c.37.1.9 PDB: 3cnz_A* 1sdm_A* 3h4s_A* Length = 369 Back     alignment and structure
 Score = 71.9 bits (177), Expect = 5e-16
 Identities = 38/145 (26%), Positives = 63/145 (43%), Gaps = 28/145 (19%)

Query: 6   RSHKDLIVNVS---HVSDVLPPGKMNFVDL-----------TCSIFVENTEVNKSIYTLF 51
           RSH  + V +      +  +  GK++FVDL             +   E   +NKS+  L 
Sbjct: 205 RSHLIVSVIIESTNLQTQAIARGKLSFVDLAGSERVKKSGSAGNQLKEAQSINKSLSALG 264

Query: 52  NVVYALNANESHVPYWESKLTRMLQESVGCKSKILMLTCL--------KTKSS------A 97
           +V+ AL++   H+PY   KLT ++ +S+G  +K LM   +        +T +S       
Sbjct: 265 DVISALSSGNQHIPYRNHKLTMLMSDSLGGNAKTLMFVNISPAESNLDETHNSLTYASRV 324

Query: 98  SSMLLSFHKNQSPKSVSTTKTQTES 122
            S++    KN S K V+  K     
Sbjct: 325 RSIVNDPSKNVSSKEVARLKKLVSY 349
>1ry6_A Internal kinesin; kinesin motor domain, nucleotide-free, transport protein; 1.60A {Plasmodium falciparum} SCOP: c.37.1.9 Length = 360 Back     alignment and structure
>3bfn_A Kinesin-like protein KIF22; limited proteolysis, structural genomics consortium domain, ADP, SGC, ATP-binding, DNA-binding, microtubule, MO protein; HET: ADP; 2.30A {Homo sapiens} Length = 388 Back     alignment and structure
>2h58_A Kinesin-like protein KIFC3 variant; motor domain, ADP, structural genomics, structur Al genomics consortium, SGC; HET: ADP; 1.85A {Homo sapiens} Length = 330 Back     alignment and structure
>3dc4_A Kinesin-like protein NOD; catalytic domain, ATPase, microtubule, ADP, nucleotide-binding protein, ATP-binding, coiled coil, motor protein; HET: ADP; 1.90A {Drosophila melanogaster} PDB: 3dcb_A* 3dco_N* 3pxn_A* Length = 344 Back     alignment and structure
>3u06_A Protein claret segregational; motor domain, stalk rotation, power stroke, kinesin-14, MICR binding, NCD, transport, molecular motor; HET: ADP GOL; 2.35A {Drosophila melanogaster} PDB: 2ncd_A* 1n6m_A* 1cz7_A* 3l1c_A* Length = 412 Back     alignment and structure
>1bg2_A Kinesin; motor protein, ATPase, microtubule associated; HET: ADP; 1.80A {Homo sapiens} SCOP: c.37.1.9 PDB: 2p4n_K* 1mkj_A* 2kin_A* 3kin_A* Length = 325 Back     alignment and structure
>2rep_A Kinesin-like protein KIFC1; structural genomics consortium, motor domain, ADP, binding, cell cycle, cell division, endosome, microtubule; HET: ADP; 2.60A {Homo sapiens} Length = 376 Back     alignment and structure
>1x88_A Kinesin-like protein KIF11; switch II, motor domain, NECK linker, cell cycle; HET: ADP NAT; 1.80A {Homo sapiens} SCOP: c.37.1.9 PDB: 3hqd_A* 3ken_A* 2pg2_A* 1yrs_A* 2fme_A* 2g1q_A* 2gm1_A* 1ii6_A* 2uyi_A* 2uym_A* 2wog_A* 2x2r_A* 2x7c_A* 2x7d_A* 2x7e_A* 2xae_A* 3k3b_A* 3k5e_A* 3l9h_A* 1q0b_A* ... Length = 359 Back     alignment and structure
>2wbe_C Bipolar kinesin KRP-130; EG5, KLP61F, tubulin, mitosis, GTP-binding, motor protein, cell division, cell cycle, microtubule, ATP-binding; HET: GTP ANP GDP TA1; 9.40A {Drosophila melanogaster} Length = 373 Back     alignment and structure
>2vvg_A Kinesin-2; motor protein, nucleotide-binding, microtubule, ATP-binding; HET: ADP; 1.60A {Giardia intestinalis} Length = 350 Back     alignment and structure
>2heh_A KIF2C protein; kinesin, motor domain, ADP, structural genomics, structural genomics consortium, SGC, structural protein; HET: ADP; 2.15A {Homo sapiens} PDB: 3edl_D* Length = 387 Back     alignment and structure
>2y65_A Kinesin, kinesin heavy chain; motor protein; HET: ADP; 2.20A {Drosophila melanogaster} PDB: 2y5w_A* Length = 365 Back     alignment and structure
>4etp_A Kinesin-like protein KAR3; kinesin motor protein, kinesin motor homology domain, karyog mitosis, microtubules; HET: ADP EBC; 2.30A {Saccharomyces cerevisiae} Length = 403 Back     alignment and structure
>1v8k_A Kinesin-like protein KIF2C; microtubule destabilizer, structural P; HET: ANP; 2.25A {Mus musculus} SCOP: c.37.1.9 PDB: 1v8j_A* 2gry_A* Length = 410 Back     alignment and structure
>1f9v_A Kinesin-like protein KAR3; kinesin-related protein, motor protein, microtubinding proteinbule, contractIle protein; HET: ADP; 1.30A {Saccharomyces cerevisiae} SCOP: c.37.1.9 PDB: 1f9t_A* 1f9w_A* 1f9u_A* 3kar_A* Length = 347 Back     alignment and structure
>3t0q_A AGR253WP; kinesin, alpha and beta proteins, P-loop containing nucleosi triphosphate hydrolases, microtubule motor protein; HET: ADP; 2.35A {Ashbya gossypii} Length = 349 Back     alignment and structure
>4a14_A Kinesin, kinesin-like protein KIF7; motor protein, motor domain; HET: ADP; 1.60A {Homo sapiens} PDB: 2xt3_A* Length = 344 Back     alignment and structure
>1goj_A Kinesin, kinesin heavy chain; motor protein, ATPase; HET: ADP; 2.3A {Neurospora crassa} SCOP: c.37.1.9 Length = 355 Back     alignment and structure
>2kin_B Kinesin; motor protein, cytoskeleton; HET: ADP; 2.00A {Rattus norvegicus} SCOP: c.37.1.9 Length = 100 Back     alignment and structure
>1t5c_A CENP-E protein, centromeric protein E; kinesin motor-domain-ADP complex, stranded beta-sheet core with solvent exposed alpha-helices; HET: ADP PIN; 2.50A {Homo sapiens} Length = 349 Back     alignment and structure
>3lre_A Kinesin-like protein KIF18A; motor protein, nucleotide binding, microtubule binding, ATP- cell projection, cytoskeleton, glycoprotein, microtubule; HET: ADP; 2.20A {Homo sapiens} Length = 355 Back     alignment and structure
>3b6u_A Kinesin-like protein KIF3B; structural genomics consortium, motor domain, ADP, SGC, ATP-binding, coiled coil, microtubule, motor protein; HET: ADP; 1.80A {Homo sapiens} PDB: 3b6v_A* Length = 372 Back     alignment and structure
>3kin_B Kinesin heavy chain; motor protein, cytoskeleton; HET: ADP; 3.10A {Rattus norvegicus} SCOP: c.37.1.9 Length = 117 Back     alignment and structure
>3gbj_A KIF13B protein; kinesin, motor domain, ADP, structural genomics, structural genomics consortium, SGC, ATP-binding, microtubule, motor protein; HET: ADP; 2.10A {Homo sapiens} Length = 354 Back     alignment and structure
>2zfi_A Kinesin-like protein KIF1A, kinesin heavy chain isoform 5C; alpha and beta protein, enzyme, ATPase, P-loop, motor protein, ATP-binding, coiled coil; HET: ADP; 1.55A {Mus musculus} SCOP: c.37.1.9 PDB: 1vfw_A* 1vfx_A* 1vfz_A* 1vfv_A* 2zfj_A* 2zfk_A* 2zfl_A* 2zfm_A* 1i5s_A* 1i6i_A* 2hxf_C* 1ia0_K* 2hxh_C* Length = 366 Back     alignment and structure
>2owm_A Nckin3-434, related to kinesin-like protein KIF1C; motor domain, ADP, NECK linker, motor PR; HET: ADP; 3.25A {Neurospora crassa} Length = 443 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query139
1t5c_A349 CENP-E protein, centromeric protein E; kinesin mot 100.0
2y65_A365 Kinesin, kinesin heavy chain; motor protein; HET: 100.0
2vvg_A350 Kinesin-2; motor protein, nucleotide-binding, micr 100.0
1x88_A359 Kinesin-like protein KIF11; switch II, motor domai 100.0
1goj_A355 Kinesin, kinesin heavy chain; motor protein, ATPas 100.0
1bg2_A325 Kinesin; motor protein, ATPase, microtubule associ 100.0
3bfn_A388 Kinesin-like protein KIF22; limited proteolysis, s 100.0
3cob_A369 Kinesin heavy chain-like protein; motor, switch II 100.0
1f9v_A347 Kinesin-like protein KAR3; kinesin-related protein 100.0
3lre_A355 Kinesin-like protein KIF18A; motor protein, nucleo 100.0
3t0q_A349 AGR253WP; kinesin, alpha and beta proteins, P-loop 100.0
2rep_A376 Kinesin-like protein KIFC1; structural genomics co 100.0
2h58_A330 Kinesin-like protein KIFC3 variant; motor domain, 100.0
1ry6_A360 Internal kinesin; kinesin motor domain, nucleotide 100.0
2owm_A443 Nckin3-434, related to kinesin-like protein KIF1C; 100.0
3nwn_A359 Kinesin-like protein KIF9; motor domain, ADP, stru 100.0
2nr8_A358 Kinesin-like protein KIF9; motor domain, ADP, stru 100.0
3b6u_A372 Kinesin-like protein KIF3B; structural genomics co 100.0
3dc4_A344 Kinesin-like protein NOD; catalytic domain, ATPase 100.0
4a14_A344 Kinesin, kinesin-like protein KIF7; motor protein, 100.0
3u06_A412 Protein claret segregational; motor domain, stalk 100.0
2wbe_C373 Bipolar kinesin KRP-130; EG5, KLP61F, tubulin, mit 100.0
4etp_A403 Kinesin-like protein KAR3; kinesin motor protein, 100.0
2zfi_A366 Kinesin-like protein KIF1A, kinesin heavy chain is 100.0
3gbj_A354 KIF13B protein; kinesin, motor domain, ADP, struct 100.0
2heh_A387 KIF2C protein; kinesin, motor domain, ADP, structu 100.0
1v8k_A410 Kinesin-like protein KIF2C; microtubule destabiliz 100.0
4h1g_A715 Maltose binding protein-cakar3 motor domain fusio; 100.0
2kin_B100 Kinesin; motor protein, cytoskeleton; HET: ADP; 2. 99.92
3kin_B117 Kinesin heavy chain; motor protein, cytoskeleton; 99.89
>1t5c_A CENP-E protein, centromeric protein E; kinesin motor-domain-ADP complex, stranded beta-sheet core with solvent exposed alpha-helices; HET: ADP PIN; 2.50A {Homo sapiens} Back     alignment and structure
Probab=100.00  E-value=1.7e-37  Score=256.05  Aligned_cols=120  Identities=23%  Similarity=0.331  Sum_probs=103.6

Q ss_pred             CCCCCcceEEEEEEEEeeeC--------CCCCeeEEEEeCCCC-----------cccccccccccHHHHHHHHHHHhcCC
Q 037021            1 MDLPRRSHKDLIVNVSHVSD--------VLPPGKMNFVDLTCS-----------IFVENTEVNKSIYTLFNVVYALNANE   61 (139)
Q Consensus         1 ~~~SSRSH~if~i~v~~~~~--------~~~~s~L~lVDLAGS-----------~~~E~~~in~SL~aL~~vi~aL~~~~   61 (139)
                      +++|||||+||+|+|++.+.        ....|+|+|||||||           +++|+..||+||++||+||.+|.+++
T Consensus       196 N~~SSRSH~if~i~v~~~~~~~~~~~~~~~~~skL~lVDLAGSEr~~~t~~~g~rl~E~~~INkSL~aLg~vI~aL~~~~  275 (349)
T 1t5c_A          196 NQRSSRSHTIFRMILESREKGEPSNCEGSVKVSHLNLVDLAGSERAAQTGAAGVRLKEGCNINRSLFILGQVIKKLSDGQ  275 (349)
T ss_dssp             SCTTTTCEEEEEEEEEEEECC-------CEEEEEEEEEECCCGGGTC-------CCCSSSCCCHHHHHHHHHHHHHHHTC
T ss_pred             CCCCCCceEEEEEEEEEeccCCCcCcCccEEEEEEEEEECCCCccccccCCccccchhhhHHhHHHHHHHHHHHHHhccC
Confidence            47899999999999998762        345789999999999           78999999999999999999999865


Q ss_pred             --CccccCcchhhhhhhcccCCCccEEEEEEecCCCCcccee-eehhhccCCcccccccccc
Q 037021           62 --SHVPYWESKLTRMLQESVGCKSKILMLTCLKTKSSASSML-LSFHKNQSPKSVSTTKTQT  120 (139)
Q Consensus        62 --~~vpyr~SkLT~lL~~sLgg~~~t~~I~~vsp~~~~~~~~-L~f~~~~~~~~~~~~~~~~  120 (139)
                        .||||||||||+||||+|||||+|+||+||+|++..||+. |+|+.+.+.+...+...+.
T Consensus       276 ~~~hvPyRdSkLT~lLqdsLgGnskt~mI~~isP~~~~ETlsTL~fA~rak~I~n~~~vn~~  337 (349)
T 1t5c_A          276 VGGFINYRDSKLTRILQNSLGGNAKTRIICTITPVSFDETLTALQFASTAKYMKNTPYVNEV  337 (349)
T ss_dssp             CTTSSCGGGSHHHHHTGGGTTSSSEEEEEEEECTTCSHHHHHHHHHHHHHTTCCCCCCCCEE
T ss_pred             CCCCCcccccHHHHHHHHhcCCCceEEEEEEeCCCCHHHHHHHHHHHHHHhhcccCceeccC
Confidence              6999999999999999999999999999999987766666 9996666655555544443
>2y65_A Kinesin, kinesin heavy chain; motor protein; HET: ADP; 2.20A {Drosophila melanogaster} PDB: 2y5w_A* Back     alignment and structure
>2vvg_A Kinesin-2; motor protein, nucleotide-binding, microtubule, ATP-binding; HET: ADP; 1.60A {Giardia intestinalis} Back     alignment and structure
>1x88_A Kinesin-like protein KIF11; switch II, motor domain, NECK linker, cell cycle; HET: ADP NAT; 1.80A {Homo sapiens} SCOP: c.37.1.9 PDB: 3hqd_A* 3ken_A* 2pg2_A* 1yrs_A* 2fme_A* 2g1q_A* 2gm1_A* 1ii6_A* 2uyi_A* 2uym_A* 2wog_A* 2x2r_A* 2x7c_A* 2x7d_A* 2x7e_A* 2xae_A* 3k3b_A* 3k5e_A* 3l9h_A* 1q0b_A* ... Back     alignment and structure
>1goj_A Kinesin, kinesin heavy chain; motor protein, ATPase; HET: ADP; 2.3A {Neurospora crassa} SCOP: c.37.1.9 Back     alignment and structure
>1bg2_A Kinesin; motor protein, ATPase, microtubule associated; HET: ADP; 1.80A {Homo sapiens} SCOP: c.37.1.9 PDB: 2p4n_K* 1mkj_A* 2kin_A* 3kin_A* Back     alignment and structure
>3bfn_A Kinesin-like protein KIF22; limited proteolysis, structural genomics consortium domain, ADP, SGC, ATP-binding, DNA-binding, microtubule, MO protein; HET: ADP; 2.30A {Homo sapiens} Back     alignment and structure
>3cob_A Kinesin heavy chain-like protein; motor, switch II, loop L11, conformation, nucleotide, ATP-binding, microtubule, motor protein; HET: ADP; 2.20A {Solanum tuberosum} SCOP: c.37.1.9 PDB: 3cnz_A* 1sdm_A* 3h4s_A* Back     alignment and structure
>1f9v_A Kinesin-like protein KAR3; kinesin-related protein, motor protein, microtubinding proteinbule, contractIle protein; HET: ADP; 1.30A {Saccharomyces cerevisiae} SCOP: c.37.1.9 PDB: 1f9t_A* 1f9w_A* 1f9u_A* 3kar_A* Back     alignment and structure
>3lre_A Kinesin-like protein KIF18A; motor protein, nucleotide binding, microtubule binding, ATP- cell projection, cytoskeleton, glycoprotein, microtubule; HET: ADP; 2.20A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>3t0q_A AGR253WP; kinesin, alpha and beta proteins, P-loop containing nucleosi triphosphate hydrolases, microtubule motor protein; HET: ADP; 2.35A {Ashbya gossypii} Back     alignment and structure
>2rep_A Kinesin-like protein KIFC1; structural genomics consortium, motor domain, ADP, binding, cell cycle, cell division, endosome, microtubule; HET: ADP; 2.60A {Homo sapiens} Back     alignment and structure
>2h58_A Kinesin-like protein KIFC3 variant; motor domain, ADP, structural genomics, structur Al genomics consortium, SGC; HET: ADP; 1.85A {Homo sapiens} Back     alignment and structure
>1ry6_A Internal kinesin; kinesin motor domain, nucleotide-free, transport protein; 1.60A {Plasmodium falciparum} SCOP: c.37.1.9 Back     alignment and structure
>2owm_A Nckin3-434, related to kinesin-like protein KIF1C; motor domain, ADP, NECK linker, motor PR; HET: ADP; 3.25A {Neurospora crassa} Back     alignment and structure
>3nwn_A Kinesin-like protein KIF9; motor domain, ADP, structural genomics, structural consortium, SGC, contractIle protein; HET: ADP; 2.00A {Homo sapiens} Back     alignment and structure
>3b6u_A Kinesin-like protein KIF3B; structural genomics consortium, motor domain, ADP, SGC, ATP-binding, coiled coil, microtubule, motor protein; HET: ADP; 1.80A {Homo sapiens} PDB: 3b6v_A* Back     alignment and structure
>3dc4_A Kinesin-like protein NOD; catalytic domain, ATPase, microtubule, ADP, nucleotide-binding protein, ATP-binding, coiled coil, motor protein; HET: ADP; 1.90A {Drosophila melanogaster} PDB: 3dcb_A* 3dco_N* 3pxn_A* Back     alignment and structure
>4a14_A Kinesin, kinesin-like protein KIF7; motor protein, motor domain; HET: ADP; 1.60A {Homo sapiens} SCOP: c.37.1.0 PDB: 2xt3_A* Back     alignment and structure
>3u06_A Protein claret segregational; motor domain, stalk rotation, power stroke, kinesin-14, MICR binding, NCD, transport, molecular motor; HET: ADP GOL; 2.35A {Drosophila melanogaster} PDB: 2ncd_A* 1n6m_A* 1cz7_A* 3l1c_A* Back     alignment and structure
>2wbe_C Bipolar kinesin KRP-130; EG5, KLP61F, tubulin, mitosis, GTP-binding, motor protein, cell division, cell cycle, microtubule, ATP-binding; HET: GTP ANP GDP TA1; 9.40A {Drosophila melanogaster} Back     alignment and structure
>4etp_A Kinesin-like protein KAR3; kinesin motor protein, kinesin motor homology domain, karyog mitosis, microtubules; HET: ADP EBC; 2.30A {Saccharomyces cerevisiae} Back     alignment and structure
>2zfi_A Kinesin-like protein KIF1A, kinesin heavy chain isoform 5C; alpha and beta protein, enzyme, ATPase, P-loop, motor protein, ATP-binding, coiled coil; HET: ADP; 1.55A {Mus musculus} SCOP: c.37.1.9 PDB: 1vfw_A* 1vfx_A* 1vfz_A* 1vfv_A* 2zfj_A* 2zfk_A* 2zfl_A* 2zfm_A* 1i5s_A* 1i6i_A* 2hxf_C* 1ia0_K* 2hxh_C* Back     alignment and structure
>3gbj_A KIF13B protein; kinesin, motor domain, ADP, structural genomics, structural genomics consortium, SGC, ATP-binding, microtubule, motor protein; HET: ADP; 2.10A {Homo sapiens} SCOP: c.37.1.9 Back     alignment and structure
>2heh_A KIF2C protein; kinesin, motor domain, ADP, structural genomics, structural genomics consortium, SGC, structural protein; HET: ADP; 2.15A {Homo sapiens} PDB: 3edl_D* Back     alignment and structure
>1v8k_A Kinesin-like protein KIF2C; microtubule destabilizer, structural P; HET: ANP; 2.25A {Mus musculus} SCOP: c.37.1.9 PDB: 1v8j_A* 2gry_A* Back     alignment and structure
>4h1g_A Maltose binding protein-cakar3 motor domain fusio; kinesin motor domain, motor protein, chimera; HET: MTT ADP EDO; 2.15A {Escherichia coli} Back     alignment and structure
>2kin_B Kinesin; motor protein, cytoskeleton; HET: ADP; 2.00A {Rattus norvegicus} SCOP: c.37.1.9 Back     alignment and structure
>3kin_B Kinesin heavy chain; motor protein, cytoskeleton; HET: ADP; 3.10A {Rattus norvegicus} SCOP: c.37.1.9 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 139
d1bg2a_323 c.37.1.9 (A:) Kinesin {Human (Homo sapiens) [TaxId 3e-14
d1ry6a_330 c.37.1.9 (A:) Kinesin {Malaria parasite (Plasmodiu 4e-13
d2ncda_368 c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjun 2e-12
d1v8ka_362 c.37.1.9 (A:) Kinesin {Mouse (Mus musculus), kif2c 6e-12
d1x88a1345 c.37.1.9 (A:18-362) Kinesin {Human (Homo sapiens), 3e-10
d1sdma_364 c.37.1.9 (A:) Kinesin heavy chain-like protein {Po 6e-10
d1f9va_342 c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjun 1e-09
d2zfia1349 c.37.1.9 (A:4-352) Kinesin {Mouse (Mus musculus), 4e-08
d1goja_354 c.37.1.9 (A:) Kinesin {Neurospora crassa [TaxId: 5 3e-07
>d1bg2a_ c.37.1.9 (A:) Kinesin {Human (Homo sapiens) [TaxId: 9606]} Length = 323 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Motor proteins
domain: Kinesin
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 65.7 bits (159), Expect = 3e-14
 Identities = 33/105 (31%), Positives = 53/105 (50%), Gaps = 14/105 (13%)

Query: 1   MDLPRRSHKDLIVNV---SHVSDVLPPGKMNFVDLTCSIFVENTE-----------VNKS 46
            +   RSH   ++NV   +  ++    GK+  VDL  S  V  T            +NKS
Sbjct: 196 NEHSSRSHSIFLINVKQENTQTEQKLSGKLYLVDLAGSEKVSKTGAEGAVLDEAKNINKS 255

Query: 47  IYTLFNVVYALNANESHVPYWESKLTRMLQESVGCKSKILMLTCL 91
           +  L NV+ AL    ++VPY +SK+TR+LQ+S+G   +  ++ C 
Sbjct: 256 LSALGNVISALAEGSTYVPYRDSKMTRILQDSLGGNCRTTIVICC 300
>d1ry6a_ c.37.1.9 (A:) Kinesin {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Length = 330 Back     information, alignment and structure
>d2ncda_ c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjunctional) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 368 Back     information, alignment and structure
>d1v8ka_ c.37.1.9 (A:) Kinesin {Mouse (Mus musculus), kif2c [TaxId: 10090]} Length = 362 Back     information, alignment and structure
>d1x88a1 c.37.1.9 (A:18-362) Kinesin {Human (Homo sapiens), mitotic kinesin eg5 [TaxId: 9606]} Length = 345 Back     information, alignment and structure
>d1sdma_ c.37.1.9 (A:) Kinesin heavy chain-like protein {Potato (Solanum tuberosum) [TaxId: 4113]} Length = 364 Back     information, alignment and structure
>d1f9va_ c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjunctional) {Baker's yeast (Saccharomyces cerevisiae), Kar [TaxId: 4932]} Length = 342 Back     information, alignment and structure
>d2zfia1 c.37.1.9 (A:4-352) Kinesin {Mouse (Mus musculus), kif1a [TaxId: 10090]} Length = 349 Back     information, alignment and structure
>d1goja_ c.37.1.9 (A:) Kinesin {Neurospora crassa [TaxId: 5141]} Length = 354 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query139
d1sdma_364 Kinesin heavy chain-like protein {Potato (Solanum 100.0
d1goja_354 Kinesin {Neurospora crassa [TaxId: 5141]} 99.97
d2ncda_368 Kinesin motor Ncd (non-claret disjunctional) {Frui 99.97
d1x88a1345 Kinesin {Human (Homo sapiens), mitotic kinesin eg5 99.97
d1v8ka_362 Kinesin {Mouse (Mus musculus), kif2c [TaxId: 10090 99.97
d1ry6a_330 Kinesin {Malaria parasite (Plasmodium falciparum) 99.97
d1bg2a_323 Kinesin {Human (Homo sapiens) [TaxId: 9606]} 99.97
d1f9va_342 Kinesin motor Ncd (non-claret disjunctional) {Bake 99.97
d2zfia1349 Kinesin {Mouse (Mus musculus), kif1a [TaxId: 10090 99.96
>d1sdma_ c.37.1.9 (A:) Kinesin heavy chain-like protein {Potato (Solanum tuberosum) [TaxId: 4113]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Motor proteins
domain: Kinesin heavy chain-like protein
species: Potato (Solanum tuberosum) [TaxId: 4113]

Probab=100.00  E-value=2.3e-34  Score=235.61  Aligned_cols=117  Identities=28%  Similarity=0.433  Sum_probs=98.9

Q ss_pred             CCCCcceEEEEEEEEeee---CCCCCeeEEEEeCCCC-----------cccccccccccHHHHHHHHHHHhcCCCccccC
Q 037021            2 DLPRRSHKDLIVNVSHVS---DVLPPGKMNFVDLTCS-----------IFVENTEVNKSIYTLFNVVYALNANESHVPYW   67 (139)
Q Consensus         2 ~~SSRSH~if~i~v~~~~---~~~~~s~L~lVDLAGS-----------~~~E~~~in~SL~aL~~vi~aL~~~~~~vpyr   67 (139)
                      .+|||||+||+|++.+.+   .....++|+|||||||           +++|+..||+||.+|++||.+|++++.|||||
T Consensus       196 ~~ssRsH~i~~i~v~~~~~~~~~~~~~kl~~vDLAGsEr~~~~~~~g~~~~E~~~iN~SL~~L~~vi~aL~~~~~~ipyR  275 (364)
T d1sdma_         196 EQSSRSHLIVSVIIESTNLQTQAIARGKLSFVDLAGSERVKKSGSAGNQLKEAQSINKSLSALGDVISALSSGNQHIPYR  275 (364)
T ss_dssp             CHHHHSEEEEEEEEEEEETTTCCEEEEEEEEEECCCCSCCCC---------CCCTTCHHHHHHHHHHHHHHHTCSCCCGG
T ss_pred             ccccccceEEEEEEEEeccCcceeeeEEEEeechhhccccccccccCceeeeccccccchhhHHHHHHHHHcCCCcCCch
Confidence            578999999999999987   3567799999999999           67899999999999999999999999999999


Q ss_pred             cchhhhhhhcccCCCccEEEEEEecCCCCcccee---eehhhccCCcccccccc
Q 037021           68 ESKLTRMLQESVGCKSKILMLTCLKTKSSASSML---LSFHKNQSPKSVSTTKT  118 (139)
Q Consensus        68 ~SkLT~lL~~sLgg~~~t~~I~~vsp~~~~~~~~---L~f~~~~~~~~~~~~~~  118 (139)
                      +||||+||+|+|||||+|+||+||+|+..+.+++   |+|+.+.+.+...+...
T Consensus       276 ~SkLT~lL~d~Lggns~t~~I~~isp~~~~~~eTl~TL~fa~~ak~i~n~p~~n  329 (364)
T d1sdma_         276 NHKLTMLMSDSLGGNAKTLMFVNISPAESNLDETHNSLTYASRVRSIVNDPSKN  329 (364)
T ss_dssp             GCHHHHHTTTTTTSSSEEEEEEEECCBGGGHHHHHHHHHHHHHHTTCCCCCCCC
T ss_pred             hhhhhHHHHhhcCCCceEEEEEEeCCCcchHHHHHHHHHHHHHHhhcccCCccc
Confidence            9999999999999999999999999966444444   88955555554444433
>d1goja_ c.37.1.9 (A:) Kinesin {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d2ncda_ c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjunctional) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1x88a1 c.37.1.9 (A:18-362) Kinesin {Human (Homo sapiens), mitotic kinesin eg5 [TaxId: 9606]} Back     information, alignment and structure
>d1v8ka_ c.37.1.9 (A:) Kinesin {Mouse (Mus musculus), kif2c [TaxId: 10090]} Back     information, alignment and structure
>d1ry6a_ c.37.1.9 (A:) Kinesin {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1bg2a_ c.37.1.9 (A:) Kinesin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f9va_ c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjunctional) {Baker's yeast (Saccharomyces cerevisiae), Kar [TaxId: 4932]} Back     information, alignment and structure
>d2zfia1 c.37.1.9 (A:4-352) Kinesin {Mouse (Mus musculus), kif1a [TaxId: 10090]} Back     information, alignment and structure