Citrus Sinensis ID: 037081


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70-----
MMQTRRGTFVEARHGGYWLGVLEKKTHESINNRLALVMKSGKYTLGYKAAIRSLRRNLIILSSNCPPLRKSEIEY
ccccccccEEEccccccccHHHHHHHHHHHHHHHHHHHHcccEEEEHHHHHHHHHHcEEEEEccccccccccccc
cEEEEccEEEEccccccEEEEEEccccHHHHHHHHHHHHHcEEEEcHHHHHHHHHHccEEEEccccccccccccc
mmqtrrgtfvearhggyWLGVLEKKTHESINNRLALVMKSGKYTLGYKAAIRSLRRNLIIlssncpplrkseiey
mmqtrrgtfvearhggywlGVLEKKTHESINNRLALVMKSGKYTLGYKAAIRSLRRNliilssncpplrkseiey
MMQTRRGTFVEARHGGYWLGVLEKKTHESINNRLALVMKSGKYTLGYKAAIRSLRRNLIILSSNCPPLRKSEIEY
*******TFVEARHGGYWLGVLEKKTHESINNRLALVMKSGKYTLGYKAAIRSLRRNLIILSS************
********************************RLALVMKSGKYTLGYKAAIRSLRRNLIILSSNCPPLRKS****
********FVEARHGGYWLGVLEKKTHESINNRLALVMKSGKYTLGYKAAIRSLRRNLIILSSNCPPLRKSEIEY
MMQTRRGTFVEARHGGYWLGVLEKKTHESINNRLALVMKSGKYTLGYKAAIRSLRRNLIILSSNCPPLRKS****
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MMQTRRGTFVEARHGGYWLGVLEKKTHESINNRLALVMKSGKYTLGYKAAIRSLRRNLIILSSNCPPLRKSEIEY
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query75 2.2.26 [Sep-21-2011]
O49884112 60S ribosomal protein L30 N/A no 0.693 0.464 0.781 2e-17
Q9M5M6112 60S ribosomal protein L30 N/A no 0.693 0.464 0.763 6e-17
Q9LSA3112 60S ribosomal protein L30 yes no 0.693 0.464 0.727 4e-16
Q9C8F7112 Putative 60S ribosomal pr yes no 0.693 0.464 0.727 4e-16
Q8VZ19112 60S ribosomal protein L30 no no 0.693 0.464 0.709 1e-15
Q9SDG6111 60S ribosomal protein L30 yes no 0.693 0.468 0.672 1e-14
O48558112 60S ribosomal protein L30 N/A no 0.693 0.464 0.654 2e-14
P58375113 60S ribosomal protein L30 N/A no 0.706 0.469 0.660 1e-13
Q5I7K9112 60S ribosomal protein L30 N/A no 0.68 0.455 0.685 1e-13
Q6FXZ0105 60S ribosomal protein L30 yes no 0.68 0.485 0.648 6e-13
>sp|O49884|RL30_LUPLU 60S ribosomal protein L30 OS=Lupinus luteus GN=RPL30 PE=3 SV=1 Back     alignment and function desciption
 Score = 87.8 bits (216), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 43/55 (78%), Positives = 49/55 (89%), Gaps = 3/55 (5%)

Query: 24 KKTHESINNRLALVMKSGKYTLGYKAAIRSLRRN---LIILSSNCPPLRKSEIEY 75
          KKTHESINNRLALVMKSGKYTLGYK  ++SLR +   LII+++NCPPLRKSEIEY
Sbjct: 8  KKTHESINNRLALVMKSGKYTLGYKTVLKSLRSSKGKLIIIANNCPPLRKSEIEY 62





Lupinus luteus (taxid: 3873)
>sp|Q9M5M6|RL30_EUPES 60S ribosomal protein L30 OS=Euphorbia esula GN=RPL30 PE=3 SV=1 Back     alignment and function description
>sp|Q9LSA3|RL303_ARATH 60S ribosomal protein L30-3 OS=Arabidopsis thaliana GN=RPL30C PE=3 SV=1 Back     alignment and function description
>sp|Q9C8F7|RL301_ARATH Putative 60S ribosomal protein L30-1 OS=Arabidopsis thaliana GN=RPL30A PE=3 SV=1 Back     alignment and function description
>sp|Q8VZ19|RL302_ARATH 60S ribosomal protein L30-2 OS=Arabidopsis thaliana GN=RPL30B PE=3 SV=1 Back     alignment and function description
>sp|Q9SDG6|RL30_ORYSJ 60S ribosomal protein L30 OS=Oryza sativa subsp. japonica GN=RPL30 PE=3 SV=1 Back     alignment and function description
>sp|O48558|RL30_MAIZE 60S ribosomal protein L30 OS=Zea mays GN=RPL30 PE=3 SV=1 Back     alignment and function description
>sp|P58375|RL30_SPOFR 60S ribosomal protein L30 OS=Spodoptera frugiperda GN=RpL30 PE=3 SV=1 Back     alignment and function description
>sp|Q5I7K9|RL30_WHEAT 60S ribosomal protein L30 OS=Triticum aestivum PE=1 SV=2 Back     alignment and function description
>sp|Q6FXZ0|RL30_CANGA 60S ribosomal protein L30 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=RPL30 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query75
255576194112 60S ribosomal protein L30, putative [Ric 0.693 0.464 0.818 2e-16
224081200112 predicted protein [Populus trichocarpa] 0.693 0.464 0.8 3e-16
224104913112 predicted protein [Populus trichocarpa] 0.693 0.464 0.8 4e-16
217073834112 unknown [Medicago truncatula] gi|3884965 0.693 0.464 0.781 4e-16
449445100112 PREDICTED: 60S ribosomal protein L30-lik 0.693 0.464 0.8 6e-16
282848250112 60S ribosomal protein L30 [Jatropha curc 0.693 0.464 0.781 6e-16
224093800112 predicted protein [Populus trichocarpa] 0.693 0.464 0.781 6e-16
357502689112 60S ribosomal protein L30 [Medicago trun 0.693 0.464 0.781 7e-16
6094048112 RecName: Full=60S ribosomal protein L30 0.693 0.464 0.781 7e-16
225438619112 PREDICTED: 60S ribosomal protein L30 [Vi 0.693 0.464 0.781 7e-16
>gi|255576194|ref|XP_002528991.1| 60S ribosomal protein L30, putative [Ricinus communis] gi|223531581|gb|EEF33410.1| 60S ribosomal protein L30, putative [Ricinus communis] Back     alignment and taxonomy information
 Score = 89.7 bits (221), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 45/55 (81%), Positives = 49/55 (89%), Gaps = 3/55 (5%)

Query: 24 KKTHESINNRLALVMKSGKYTLGYKAAIRSLRRN---LIILSSNCPPLRKSEIEY 75
          KKTHESINNRLALVMKSGKYTLGYK  +RSLR +   LII+S+NCPPLRKSEIEY
Sbjct: 8  KKTHESINNRLALVMKSGKYTLGYKTVLRSLRTSKGKLIIISNNCPPLRKSEIEY 62




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|224081200|ref|XP_002306331.1| predicted protein [Populus trichocarpa] gi|118484057|gb|ABK93914.1| unknown [Populus trichocarpa] gi|118485363|gb|ABK94539.1| unknown [Populus trichocarpa] gi|222855780|gb|EEE93327.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224104913|ref|XP_002313617.1| predicted protein [Populus trichocarpa] gi|224131730|ref|XP_002328094.1| predicted protein [Populus trichocarpa] gi|118483895|gb|ABK93838.1| unknown [Populus trichocarpa] gi|222837609|gb|EEE75974.1| predicted protein [Populus trichocarpa] gi|222850025|gb|EEE87572.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|217073834|gb|ACJ85277.1| unknown [Medicago truncatula] gi|388496542|gb|AFK36337.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|449445100|ref|XP_004140311.1| PREDICTED: 60S ribosomal protein L30-like isoform 1 [Cucumis sativus] gi|449445102|ref|XP_004140312.1| PREDICTED: 60S ribosomal protein L30-like isoform 2 [Cucumis sativus] gi|449479854|ref|XP_004155728.1| PREDICTED: 60S ribosomal protein L30-like isoform 1 [Cucumis sativus] gi|449479857|ref|XP_004155729.1| PREDICTED: 60S ribosomal protein L30-like isoform 2 [Cucumis sativus] Back     alignment and taxonomy information
>gi|282848250|gb|ADB02906.1| 60S ribosomal protein L30 [Jatropha curcas] Back     alignment and taxonomy information
>gi|224093800|ref|XP_002309997.1| predicted protein [Populus trichocarpa] gi|118481493|gb|ABK92689.1| unknown [Populus trichocarpa] gi|118483057|gb|ABK93438.1| unknown [Populus trichocarpa] gi|222852900|gb|EEE90447.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|357502689|ref|XP_003621633.1| 60S ribosomal protein L30 [Medicago truncatula] gi|355496648|gb|AES77851.1| 60S ribosomal protein L30 [Medicago truncatula] gi|388504426|gb|AFK40279.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|6094048|sp|O49884.1|RL30_LUPLU RecName: Full=60S ribosomal protein L30 gi|2879811|emb|CAA11256.1| ribosomal protein L30 [Lupinus luteus] Back     alignment and taxonomy information
>gi|225438619|ref|XP_002281037.1| PREDICTED: 60S ribosomal protein L30 [Vitis vinifera] gi|296082469|emb|CBI21474.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query75
TAIR|locus:2013205112 AT1G36240 [Arabidopsis thalian 0.693 0.464 0.727 1.4e-16
TAIR|locus:2093984112 RLK902 "receptor-like kinase 9 0.693 0.464 0.727 1.4e-16
TAIR|locus:2029401112 AT1G77940 [Arabidopsis thalian 0.693 0.464 0.709 3.7e-16
UNIPROTKB|G1K316108 RPL30 "60S ribosomal protein L 0.693 0.481 0.636 4.4e-13
UNIPROTKB|P67883115 RPL30 "60S ribosomal protein L 0.693 0.452 0.636 4.4e-13
UNIPROTKB|Q3T0D5115 RPL30 "60S ribosomal protein L 0.693 0.452 0.636 4.4e-13
UNIPROTKB|E5RI99114 RPL30 "60S ribosomal protein L 0.693 0.456 0.636 4.4e-13
UNIPROTKB|P62888115 RPL30 "60S ribosomal protein L 0.693 0.452 0.636 4.4e-13
UNIPROTKB|F2Z554115 RPL30 "Uncharacterized protein 0.693 0.452 0.636 4.4e-13
MGI|MGI:98037115 Rpl30 "ribosomal protein L30" 0.693 0.452 0.636 4.4e-13
TAIR|locus:2013205 AT1G36240 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 205 (77.2 bits), Expect = 1.4e-16, P = 1.4e-16
 Identities = 40/55 (72%), Positives = 49/55 (89%)

Query:    24 KKTHESINNRLALVMKSGKYTLGYKAAIRSLRRN---LIILSSNCPPLRKSEIEY 75
             KK+HE IN+RLALVMKSGKYTLGYK+ ++SLR +   LI++SSNCPPLR+SEIEY
Sbjct:     8 KKSHEGINSRLALVMKSGKYTLGYKSVLKSLRSSKGKLILISSNCPPLRRSEIEY 62




GO:0003735 "structural constituent of ribosome" evidence=IEA;ISS
GO:0005622 "intracellular" evidence=IEA
GO:0005840 "ribosome" evidence=IEA
GO:0006412 "translation" evidence=IEA;ISS
GO:0009507 "chloroplast" evidence=ISM
GO:0022625 "cytosolic large ribosomal subunit" evidence=IDA
GO:0005829 "cytosol" evidence=IDA
TAIR|locus:2093984 RLK902 "receptor-like kinase 902" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2029401 AT1G77940 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|G1K316 RPL30 "60S ribosomal protein L30" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|P67883 RPL30 "60S ribosomal protein L30" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q3T0D5 RPL30 "60S ribosomal protein L30" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E5RI99 RPL30 "60S ribosomal protein L30" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|P62888 RPL30 "60S ribosomal protein L30" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F2Z554 RPL30 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
MGI|MGI:98037 Rpl30 "ribosomal protein L30" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9C8F7RL301_ARATHNo assigned EC number0.72720.69330.4642yesno
Q9LSA3RL303_ARATHNo assigned EC number0.72720.69330.4642yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
GSVIVG00015281001
SubName- Full=Chromosome chr18 scaffold_1, whole genome shotgun sequence; (112 aa)
(Vitis vinifera)
Predicted Functional Partners:
GSVIVG00023139001
SubName- Full=Chromosome chr8 scaffold_29, whole genome shotgun sequence; (136 aa)
    0.941
GSVIVG00018552001
SubName- Full=Chromosome chr13 scaffold_17, whole genome shotgun sequence; (155 aa)
    0.854
GSVIVG00026857001
RecName- Full=60S ribosomal protein L36; (110 aa)
     0.850
GSVIVG00029522001
SubName- Full=Chromosome chr13 scaffold_48, whole genome shotgun sequence; (129 aa)
     0.821
GSVIVG00019318001
SubName- Full=Putative uncharacterized protein (Chromosome chr7 scaffold_20, whole genome shotg [...] (245 aa)
    0.807
GSVIVG00031140001
SubName- Full=Chromosome chr14 scaffold_54, whole genome shotgun sequence; (234 aa)
    0.790
GSVIVG00005647001
SubName- Full=Chromosome undetermined scaffold_155, whole genome shotgun sequence; (159 aa)
   0.786
GSVIVG00019030001
SubName- Full=Chromosome chr15 scaffold_19, whole genome shotgun sequence; (103 aa)
    0.780
GSVIVG00025458001
SubName- Full=Chromosome chr8 scaffold_34, whole genome shotgun sequence; (208 aa)
    0.767
Rps5
SubName- Full=Chromosome chr4 scaffold_39, whole genome shotgun sequence; (204 aa)
    0.766

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query75
PTZ00106108 PTZ00106, PTZ00106, 60S ribosomal protein L30; Pro 3e-25
COG1911100 COG1911, RPL30, Ribosomal protein L30E [Translatio 6e-15
pfam0124895 pfam01248, Ribosomal_L7Ae, Ribosomal protein L7Ae/ 7e-09
PRK0101899 PRK01018, PRK01018, 50S ribosomal protein L30e; Re 5e-05
>gnl|CDD|185450 PTZ00106, PTZ00106, 60S ribosomal protein L30; Provisional Back     alignment and domain information
 Score = 89.8 bits (223), Expect = 3e-25
 Identities = 34/55 (61%), Positives = 45/55 (81%), Gaps = 3/55 (5%)

Query: 24 KKTHESINNRLALVMKSGKYTLGYKAAIRSLRR---NLIILSSNCPPLRKSEIEY 75
          KK  ESIN++L LVMKSGKYTLG K+ +++LR     L+I+S+NCPP+R+SEIEY
Sbjct: 7  KKAQESINSKLQLVMKSGKYTLGTKSTLKALRNGKAKLVIISNNCPPIRRSEIEY 61


Length = 108

>gnl|CDD|224823 COG1911, RPL30, Ribosomal protein L30E [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|216387 pfam01248, Ribosomal_L7Ae, Ribosomal protein L7Ae/L30e/S12e/Gadd45 family Back     alignment and domain information
>gnl|CDD|179205 PRK01018, PRK01018, 50S ribosomal protein L30e; Reviewed Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 75
COG1911100 RPL30 Ribosomal protein L30E [Translation, ribosom 99.85
KOG2988112 consensus 60S ribosomal protein L30 [Translation, 99.8
PTZ00106108 60S ribosomal protein L30; Provisional 99.61
PRK0101899 50S ribosomal protein L30e; Reviewed 99.41
PRK0668382 hypothetical protein; Provisional 99.04
PRK07714100 hypothetical protein; Provisional 98.97
PRK05583104 ribosomal protein L7Ae family protein; Provisional 98.93
PRK1360282 putative ribosomal protein L7Ae-like; Provisional 98.87
PRK0728398 hypothetical protein; Provisional 98.83
TIGR03677117 rpl7ae 50S ribosomal protein L7Ae. Multifunctional 98.7
PF0124895 Ribosomal_L7Ae: Ribosomal protein L7Ae/L30e/S12e/G 98.7
PRK1360182 putative L7Ae-like ribosomal protein; Provisional 98.67
PRK04175122 rpl7ae 50S ribosomal protein L7Ae; Validated 98.61
COG1358116 RPL8A Ribosomal protein HS6-type (S12/L30/L7a) [Tr 97.47
PRK09190220 hypothetical protein; Provisional 97.16
PRK1360084 putative ribosomal protein L7Ae-like; Provisional 96.0
KOG3406134 consensus 40S ribosomal protein S12 [Translation, 91.02
PTZ00222263 60S ribosomal protein L7a; Provisional 86.6
>COG1911 RPL30 Ribosomal protein L30E [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
Probab=99.85  E-value=5.2e-22  Score=133.35  Aligned_cols=50  Identities=44%  Similarity=0.743  Sum_probs=48.7

Q ss_pred             hHHhHHHHHHHHHHhcceEeehHHHHHHHhh---ceeeeeCCCChhhhhhhcC
Q 037081           26 THESINNRLALVMKSGKYTLGYKAAIRSLRR---NLIILSSNCPPLRKSEIEY   75 (75)
Q Consensus        26 ~~~~i~~~L~la~KTGK~~LG~KqTlK~l~~---KLVIiA~NcP~~~K~eIEY   75 (75)
                      ..+||+++|+++||||||+||+|+|||++++   ||||||+|||+++|+||||
T Consensus         3 ~~~~v~~~L~~avkTGkvilG~k~tiK~lk~gkaKliiiAsN~P~~~k~~iey   55 (100)
T COG1911           3 MGDDVEKELKLAVKTGKVILGSKRTIKSLKLGKAKLIIIASNCPKELKEDIEY   55 (100)
T ss_pred             ccchHHHHHHHHHhcCCEEEehHHHHHHHHcCCCcEEEEecCCCHHHHHHHHH
Confidence            5689999999999999999999999999999   9999999999999999998



>KOG2988 consensus 60S ribosomal protein L30 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PTZ00106 60S ribosomal protein L30; Provisional Back     alignment and domain information
>PRK01018 50S ribosomal protein L30e; Reviewed Back     alignment and domain information
>PRK06683 hypothetical protein; Provisional Back     alignment and domain information
>PRK07714 hypothetical protein; Provisional Back     alignment and domain information
>PRK05583 ribosomal protein L7Ae family protein; Provisional Back     alignment and domain information
>PRK13602 putative ribosomal protein L7Ae-like; Provisional Back     alignment and domain information
>PRK07283 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03677 rpl7ae 50S ribosomal protein L7Ae Back     alignment and domain information
>PF01248 Ribosomal_L7Ae: Ribosomal protein L7Ae/L30e/S12e/Gadd45 family; InterPro: IPR004038 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>PRK13601 putative L7Ae-like ribosomal protein; Provisional Back     alignment and domain information
>PRK04175 rpl7ae 50S ribosomal protein L7Ae; Validated Back     alignment and domain information
>COG1358 RPL8A Ribosomal protein HS6-type (S12/L30/L7a) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK09190 hypothetical protein; Provisional Back     alignment and domain information
>PRK13600 putative ribosomal protein L7Ae-like; Provisional Back     alignment and domain information
>KOG3406 consensus 40S ribosomal protein S12 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PTZ00222 60S ribosomal protein L7a; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query75
1ysh_C104 Localization And Dynamic Behavior Of Ribosomal Prot 1e-15
3izr_f112 Localization Of The Large Subunit Ribosomal Protein 1e-14
1t0k_B105 Joint X-ray And Nmr Refinement Of Yeast L30e-mrna C 9e-14
1ck2_A104 Yeast (Saccharomyces Cerevisiae) Ribosomal Protein 1e-13
2zkr_6115 Structure Of A Mammalian Ribosomal 60s Subunit With 2e-13
3vi6_A125 Crystal Structure Of Human L30e Length = 125 2e-13
3jyw_298 Structure Of The 60s Proteins For Eukaryotic Riboso 6e-13
4a18_G104 T.Thermophila 60s Ribosomal Subunit In Complex With 6e-12
3zf7_g105 High-resolution Cryo-electron Microscopy Structure 2e-11
2bo1_A101 Crystal Structure Of A Hybrid Ribosomal Protein L30 1e-04
>pdb|1YSH|C Chain C, Localization And Dynamic Behavior Of Ribosomal Protein L30e Length = 104 Back     alignment and structure

Iteration: 1

Score = 77.8 bits (190), Expect = 1e-15, Method: Compositional matrix adjust. Identities = 38/55 (69%), Positives = 47/55 (85%), Gaps = 3/55 (5%) Query: 24 KKTHESINNRLALVMKSGKYTLGYKAAIRSLRRN---LIILSSNCPPLRKSEIEY 75 KK+ E+INN+L LVMKSGKYTLGYK +++LR + LIIL++NCPPLRKSEIEY Sbjct: 3 KKSGENINNKLQLVMKSGKYTLGYKTVLKTLRSSKGKLIILANNCPPLRKSEIEY 57
>pdb|3IZR|FF Chain f, Localization Of The Large Subunit Ribosomal Proteins Into A 5.5 A Cryo-Em Map Of Triticum Aestivum Translating 80s Ribosome Length = 112 Back     alignment and structure
>pdb|1T0K|B Chain B, Joint X-ray And Nmr Refinement Of Yeast L30e-mrna Complex Length = 105 Back     alignment and structure
>pdb|1CK2|A Chain A, Yeast (Saccharomyces Cerevisiae) Ribosomal Protein L30 Length = 104 Back     alignment and structure
>pdb|2ZKR|6 Chain 6, Structure Of A Mammalian Ribosomal 60s Subunit Within An 80s Complex Obtained By Docking Homology Models Of The Rna And Proteins Into An 8.7 A Cryo-Em Map Length = 115 Back     alignment and structure
>pdb|3VI6|A Chain A, Crystal Structure Of Human L30e Length = 125 Back     alignment and structure
>pdb|3JYW|2 Chain 2, Structure Of The 60s Proteins For Eukaryotic Ribosome Based On Cryo-Em Map Of Thermomyces Lanuginosus Ribosome At 8.9a Resolution Length = 98 Back     alignment and structure
>pdb|4A18|G Chain G, T.Thermophila 60s Ribosomal Subunit In Complex With Initiation Factor 6. This File Contains 26s Rrna And Proteins Of Molecule 1 Length = 104 Back     alignment and structure
>pdb|3ZF7|GG Chain g, High-resolution Cryo-electron Microscopy Structure Of The Trypanosoma Brucei Ribosome Length = 105 Back     alignment and structure
>pdb|2BO1|A Chain A, Crystal Structure Of A Hybrid Ribosomal Protein L30e With Surface Residues From T. Celer, And Core Residues From Yeast Length = 101 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query75
3cpq_A110 50S ribosomal protein L30E; RNA-protein, elongatio 3e-17
3iz5_F 190 60S ribosomal protein L9 (L6P); eukaryotic ribosom 3e-17
3u5e_c105 L32, RP73, YL38, 60S ribosomal protein L30; transl 3e-17
4a18_G104 RPL30; ribosome, eukaryotic initiation factor 6, E 6e-17
3vi6_A125 60S ribosomal protein L30; three-layer alpha/beta/ 7e-17
1w41_A101 50S ribosomal protein L30E; electrostatic interact 6e-15
3v7q_A101 Probable ribosomal protein YLXQ; L7AE superfamily, 2e-10
3on1_A101 BH2414 protein; structural genomics, PSI-2, protei 3e-10
>3cpq_A 50S ribosomal protein L30E; RNA-protein, elongation factor, ribonucleoprotein, structural genomics, NPPSFA; 1.90A {Methanocaldococcus jannaschii} Length = 110 Back     alignment and structure
 Score = 68.7 bits (168), Expect = 3e-17
 Identities = 12/57 (21%), Positives = 30/57 (52%), Gaps = 3/57 (5%)

Query: 22 LEKKTHESINNRLALVMKSGKYTLGYKAAIRSLRRN---LIILSSNCPPLRKSEIEY 75
          + ++ +  +N  +   + +GK  LG K  I+ ++     L++L+ N P   + +++Y
Sbjct: 1  MRRRENMDVNKAIRTAVDTGKVILGSKRTIKFVKHGEGKLVVLAGNIPKDLEEDVKY 57


>3u5e_c L32, RP73, YL38, 60S ribosomal protein L30; translation, ribosome, ribosomal R ribosomal protein, STM1, eukaryotic ribosome; 3.00A {Saccharomyces cerevisiae} PDB: 3izc_f 3izs_f 3o58_Z 3o5h_Z 1t0k_B 3u5i_c 1ck2_A 1cn7_A 1nmu_B* 3jyw_2 Length = 105 Back     alignment and structure
>4a18_G RPL30; ribosome, eukaryotic initiation factor 6, EIF6, transla large ribosomal subunit, rRNA; 3.52A {Tetrahymena thermophila} PDB: 4a19_G 4a1b_G 4a1d_G 4adx_6 Length = 104 Back     alignment and structure
>3vi6_A 60S ribosomal protein L30; three-layer alpha/beta/ALPA; 1.59A {Homo sapiens} PDB: 2zkr_6 1ysh_C Length = 125 Back     alignment and structure
>1w41_A 50S ribosomal protein L30E; electrostatic interactions, thermostability, protein engineering; 1.7A {Thermococcus celer} SCOP: d.79.3.1 PDB: 3n4y_A 3lfo_A 1w40_A 1go0_A 1go1_A 1h7m_A 1w42_A 1w3e_X 3ra6_A 3ra5_A 3n4z_A 2bo1_A Length = 101 Back     alignment and structure
>3v7q_A Probable ribosomal protein YLXQ; L7AE superfamily, K-turn binding, K-turn RNA, hypothetical R protein, RNA binding protein; HET: CIT; 1.55A {Bacillus subtilis} Length = 101 Back     alignment and structure
>3on1_A BH2414 protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG, unknown function; HET: MSE; 1.65A {Bacillus halodurans} Length = 101 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query75
3iz5_f112 60S ribosomal protein L30 (L30E); eukaryotic ribos 99.64
3vi6_A125 60S ribosomal protein L30; three-layer alpha/beta/ 99.52
3j21_Z99 50S ribosomal protein L30E; archaea, archaeal, KIN 99.45
3u5e_c105 L32, RP73, YL38, 60S ribosomal protein L30; transl 99.45
4a18_G104 RPL30; ribosome, eukaryotic initiation factor 6, E 99.43
3cpq_A110 50S ribosomal protein L30E; RNA-protein, elongatio 99.31
1w41_A101 50S ribosomal protein L30E; electrostatic interact 99.3
3v7q_A101 Probable ribosomal protein YLXQ; L7AE superfamily, 99.2
3on1_A101 BH2414 protein; structural genomics, PSI-2, protei 99.2
3v7e_A82 Ribosome-associated protein L7AE-like; RNA-protein 99.12
2xzm_U126 Ribosomal protein L7AE containing protein; ribosom 99.08
2jnb_A144 NHP2-like protein 1; splicing, KINK-turn RNA-bindi 98.99
2ale_A134 SNU13, NHP2/L7AE family protein YEL026W; splicing, 98.98
2lbw_A121 H/ACA ribonucleoprotein complex subunit 2; L7AE, s 98.94
2fc3_A124 50S ribosomal protein L7AE; alpha-beta-alpha sandw 98.85
2aif_A135 Ribosomal protein L7A; high-mobility like protein, 98.84
1vq8_F120 50S ribosomal protein L7AE; ribosome 50S, protein- 98.83
1rlg_A119 50S ribosomal protein L7AE; protein-RNA, structura 98.81
3o85_A122 Ribosomal protein L7AE; alpha beta sandwich fold, 98.77
3u5c_M143 40S ribosomal protein S12, 40S ribosomal protein S 98.46
1xbi_A120 50S ribosomal protein L7AE; alpha-beta-alpha sandw 98.32
2zkr_f266 60S ribosomal protein L7A; protein-RNA complex, 60 97.18
2kg4_A165 Growth arrest and DNA-damage-inducible protein GA 96.63
3jyw_G113 60S ribosomal protein L8(A); eukaryotic ribosome, 96.22
3izc_H256 60S ribosomal protein RPL8 (L7AE); eukaryotic ribo 95.73
4a17_F255 RPL7A, 60S ribosomal protein L9; eukaryotic riboso 91.78
2bjq_A 345 MFP2A; motility, nematode, MSP; 1.75A {Ascaris suu 89.29
3ir9_A166 Peptide chain release factor subunit 1; structural 81.22
>3vi6_A 60S ribosomal protein L30; three-layer alpha/beta/ALPA; 1.59A {Homo sapiens} PDB: 2zkr_6 1ysh_C Back     alignment and structure
>3j21_Z 50S ribosomal protein L30E; archaea, archaeal, KINK-turn, protein synthe ribosome; 6.60A {Pyrococcus furiosus} Back     alignment and structure
>3u5e_c L32, RP73, YL38, 60S ribosomal protein L30; translation, ribosome, ribosomal R ribosomal protein, STM1, eukaryotic ribosome; 3.00A {Saccharomyces cerevisiae} PDB: 3izc_f 3izs_f 3o58_Z 3o5h_Z 1t0k_B 3u5i_c 4b6a_c 1ck2_A 1cn7_A 1nmu_B* 3jyw_2 Back     alignment and structure
>4a18_G RPL30; ribosome, eukaryotic initiation factor 6, EIF6, transla large ribosomal subunit, rRNA; 3.52A {Tetrahymena thermophila} PDB: 4a19_G 4a1b_G 4a1d_G 4adx_6 Back     alignment and structure
>3cpq_A 50S ribosomal protein L30E; RNA-protein, elongation factor, ribonucleoprotein, structural genomics, NPPSFA; 1.90A {Methanocaldococcus jannaschii} Back     alignment and structure
>1w41_A 50S ribosomal protein L30E; electrostatic interactions, thermostability, protein engineering; 1.7A {Thermococcus celer} SCOP: d.79.3.1 PDB: 3n4y_A 3lfo_A 1w40_A 1go0_A 1go1_A 1h7m_A 1w42_A 1w3e_X 3ra6_A 3ra5_A 3n4z_A 2bo1_A Back     alignment and structure
>3v7q_A Probable ribosomal protein YLXQ; L7AE superfamily, K-turn binding, K-turn RNA, hypothetical R protein, RNA binding protein; HET: CIT; 1.55A {Bacillus subtilis} Back     alignment and structure
>3on1_A BH2414 protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG, unknown function; HET: MSE; 1.65A {Bacillus halodurans} Back     alignment and structure
>3v7e_A Ribosome-associated protein L7AE-like; RNA-protein complex, K-turn, L7AE-like, A member L7AE/L30E superfamily; HET: SAM; 2.80A {Bacillus subtilis} Back     alignment and structure
>2xzm_U Ribosomal protein L7AE containing protein; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_U Back     alignment and structure
>2jnb_A NHP2-like protein 1; splicing, KINK-turn RNA-binding protein, NHPX, RNA binding protein; NMR {Homo sapiens} SCOP: d.79.3.1 Back     alignment and structure
>2ale_A SNU13, NHP2/L7AE family protein YEL026W; splicing, RNA, yeast, His-TAG, RNA binding protein; 1.80A {Saccharomyces cerevisiae} SCOP: d.79.3.1 PDB: 1zwz_A 2ozb_A 3siu_A 3siv_A 1e7k_A Back     alignment and structure
>2lbw_A H/ACA ribonucleoprotein complex subunit 2; L7AE, snoRNP, scaRNP, RNA binding protein; NMR {Saccharomyces cerevisiae} PDB: 2lbx_A Back     alignment and structure
>2fc3_A 50S ribosomal protein L7AE; alpha-beta-alpha sandwich, ribosome, RNA binding protein; 1.56A {Aeropyrum pernix} SCOP: d.79.3.1 PDB: 3pla_C* 3id5_C* 3hax_D* 2hvy_D* 3hay_D* 3nvi_B 3nmu_C 3nvk_E* 3lwr_C 3lwo_C* 3lwq_C* 3lwp_C 3lwv_C 3hjw_C* 2czw_A 1pxw_A Back     alignment and structure
>2aif_A Ribosomal protein L7A; high-mobility like protein, transcription factor, structural genomics, structural genomics consortium, SGC; 1.90A {Cryptosporidium parvum} SCOP: d.79.3.1 Back     alignment and structure
>1vq8_F 50S ribosomal protein L7AE; ribosome 50S, protein-protein complex, RNA-RNA complex, PROT complex, peptidyl transferase reaction; HET: 1MA OMU OMG UR3 PSU SPS; 2.20A {Haloarcula marismortui} SCOP: d.79.3.1 PDB: 1vq4_F* 1vq5_F* 1vq6_F* 1vq7_F* 1s72_F* 1vq9_F* 1vqk_F* 1vql_F* 1vqm_F* 1vqn_F* 1vqo_F* 1vqp_F* 1yhq_F* 1yi2_F* 1yij_F* 1yit_F* 1yj9_F* 1yjn_F* 1yjw_F* 2otj_F* ... Back     alignment and structure
>1rlg_A 50S ribosomal protein L7AE; protein-RNA, structural protein/RNA complex; HET: 5BU; 2.70A {Archaeoglobus fulgidus} SCOP: d.79.3.1 Back     alignment and structure
>3o85_A Ribosomal protein L7AE; alpha beta sandwich fold, K-turn RNA binding protein, KINK T ribosomal protein; 1.81A {Giardia lamblia} Back     alignment and structure
>3u5c_M 40S ribosomal protein S12, 40S ribosomal protein S11-A; translation, ribosome, ribosomal, ribosomal R ribosomal protein, eukaryotic ribosome, RNA-protein C; 3.00A {Saccharomyces cerevisiae} PDB: 3u5g_M Back     alignment and structure
>1xbi_A 50S ribosomal protein L7AE; alpha-beta-alpha sandwich fold, RNA binding protein/structural protein complex; HET: EPE; 1.45A {Methanocaldococcus jannaschii} SCOP: d.79.3.1 PDB: 1ra4_A* 1sds_A 3paf_A Back     alignment and structure
>2zkr_f 60S ribosomal protein L7A; protein-RNA complex, 60S ribosomal subunit, ribosomal protein/RNA complex; 8.70A {Canis familiaris} Back     alignment and structure
>2kg4_A Growth arrest and DNA-damage-inducible protein GA alpha; GADD45, flexible regions, monomer cycle; NMR {Homo sapiens} Back     alignment and structure
>3jyw_G 60S ribosomal protein L8(A); eukaryotic ribosome, RACK1 protein, flexible fitting; 8.90A {Thermomyces lanuginosus} PDB: 1s1i_G Back     alignment and structure
>4a17_F RPL7A, 60S ribosomal protein L9; eukaryotic ribosome, ribosome, eukaryotic initiation factor 60S, translation, large ribosomal subunit; 3.52A {Tetrahymena thermophila} PDB: 4a1a_F 4a1c_F 4a1e_F Back     alignment and structure
>2bjq_A MFP2A; motility, nematode, MSP; 1.75A {Ascaris suum} SCOP: b.169.1.1 b.169.1.1 Back     alignment and structure
>3ir9_A Peptide chain release factor subunit 1; structural genomics, APC36528.1, C-terminal domain, PSI-2, protein structure initiative; 2.21A {Methanosarcina mazei} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 75
d1t0kb_97 d.79.3.1 (B:) Eukaryotic ribosomal protein L30 (L3 2e-14
d2bo1a1100 d.79.3.1 (A:1-100) Eukaryotic ribosomal protein L3 2e-12
d1w3ex198 d.79.3.1 (X:1-98) Eukaryotic ribosomal protein L30 2e-10
d1vqof1119 d.79.3.1 (F:1-119) Ribosomal protein L7ae {Archaeo 9e-06
d2fc3a1124 d.79.3.1 (A:4-127) Ribosomal protein L7ae {Aeropyr 1e-05
d1xbia1115 d.79.3.1 (A:2-116) Ribosomal protein L7ae {Archaeo 1e-04
d1rlga_113 d.79.3.1 (A:) Ribosomal protein L7ae {Archaeon Arc 0.001
>d1t0kb_ d.79.3.1 (B:) Eukaryotic ribosomal protein L30 (L30e) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 97 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Bacillus chorismate mutase-like
superfamily: L30e-like
family: L30e/L7ae ribosomal proteins
domain: Eukaryotic ribosomal protein L30 (L30e)
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]
 Score = 59.8 bits (145), Expect = 2e-14
 Identities = 32/50 (64%), Positives = 42/50 (84%), Gaps = 3/50 (6%)

Query: 29 SINNRLALVMKSGKYTLGYKAAIRSLRRN---LIILSSNCPPLRKSEIEY 75
          SIN +LALV+KSGKYTLGYK+ ++SLR+    LII+++N P LRKSE+EY
Sbjct: 1  SINQKLALVIKSGKYTLGYKSTVKSLRQGKSKLIIIAANTPVLRKSELEY 50


>d2bo1a1 d.79.3.1 (A:1-100) Eukaryotic ribosomal protein L30 (L30e) {Archaeon Thermococcus celer [TaxId: 2264]} Length = 100 Back     information, alignment and structure
>d1w3ex1 d.79.3.1 (X:1-98) Eukaryotic ribosomal protein L30 (L30e) {Archaeon Thermococcus celer [TaxId: 2264]} Length = 98 Back     information, alignment and structure
>d1vqof1 d.79.3.1 (F:1-119) Ribosomal protein L7ae {Archaeon Haloarcula marismortui [TaxId: 2238]} Length = 119 Back     information, alignment and structure
>d2fc3a1 d.79.3.1 (A:4-127) Ribosomal protein L7ae {Aeropyrum pernix [TaxId: 56636]} Length = 124 Back     information, alignment and structure
>d1xbia1 d.79.3.1 (A:2-116) Ribosomal protein L7ae {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 115 Back     information, alignment and structure
>d1rlga_ d.79.3.1 (A:) Ribosomal protein L7ae {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 113 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query75
d1w3ex198 Eukaryotic ribosomal protein L30 (L30e) {Archaeon 99.54
d2bo1a1100 Eukaryotic ribosomal protein L30 (L30e) {Archaeon 99.5
d1t0kb_97 Eukaryotic ribosomal protein L30 (L30e) {Baker's y 99.34
d2fc3a1124 Ribosomal protein L7ae {Aeropyrum pernix [TaxId: 5 98.79
d1vqof1119 Ribosomal protein L7ae {Archaeon Haloarcula marism 98.77
d2aifa1115 Ribosomal protein L7ae {Cryptosporidium parvum [Ta 98.76
d1rlga_113 Ribosomal protein L7ae {Archaeon Archaeoglobus ful 98.73
d1xbia1115 Ribosomal protein L7ae {Archaeon Methanococcus jan 98.48
d2ozba1125 Spliceosomal 15.5kd protein {Human (Homo sapiens) 98.39
d2alea1126 Small nuclear ribonucleoprotein-associated protein 98.1
d2vgna3104 Dom34 {Saccharomyces cerevisiae [TaxId: 4932]} 81.75
d1x52a1111 Cell division protein pelota {Human (Homo sapiens) 80.57
>d1w3ex1 d.79.3.1 (X:1-98) Eukaryotic ribosomal protein L30 (L30e) {Archaeon Thermococcus celer [TaxId: 2264]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Bacillus chorismate mutase-like
superfamily: L30e-like
family: L30e/L7ae ribosomal proteins
domain: Eukaryotic ribosomal protein L30 (L30e)
species: Archaeon Thermococcus celer [TaxId: 2264]
Probab=99.54  E-value=1.9e-15  Score=95.43  Aligned_cols=48  Identities=29%  Similarity=0.443  Sum_probs=46.0

Q ss_pred             HhHHHHHHHHHHhcceEeehHHHHHHHhh---ceeeeeCCCChhhhhhhcC
Q 037081           28 ESINNRLALVMKSGKYTLGYKAAIRSLRR---NLIILSSNCPPLRKSEIEY   75 (75)
Q Consensus        28 ~~i~~~L~la~KTGK~~LG~KqTlK~l~~---KLVIiA~NcP~~~K~eIEY   75 (75)
                      +||+++|++|+|+||+++|+++++|+|+.   ||||||+|||++.+++|+|
T Consensus         1 ~d~~~~L~~a~kaGklv~G~~~v~kal~~gkaklVilA~D~~~~~~~~i~~   51 (98)
T d1w3ex1           1 VDFAFELRKAQDTGKIVMGARKSIQYAKMGGAKLIIVARNARPDIKEDIEY   51 (98)
T ss_dssp             CCHHHHHHHHHHHSEEEESHHHHHHHHHHTCCSEEEEETTSCHHHHHHHHH
T ss_pred             CCHHHHHHHHHHhCCEEEcHHHHHHHHHcCCccEEEEECCCCHHHHHHHHH
Confidence            58999999999999999999999999999   9999999999999999864



>d2bo1a1 d.79.3.1 (A:1-100) Eukaryotic ribosomal protein L30 (L30e) {Archaeon Thermococcus celer [TaxId: 2264]} Back     information, alignment and structure
>d1t0kb_ d.79.3.1 (B:) Eukaryotic ribosomal protein L30 (L30e) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2fc3a1 d.79.3.1 (A:4-127) Ribosomal protein L7ae {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1vqof1 d.79.3.1 (F:1-119) Ribosomal protein L7ae {Archaeon Haloarcula marismortui [TaxId: 2238]} Back     information, alignment and structure
>d2aifa1 d.79.3.1 (A:16-130) Ribosomal protein L7ae {Cryptosporidium parvum [TaxId: 5807]} Back     information, alignment and structure
>d1rlga_ d.79.3.1 (A:) Ribosomal protein L7ae {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1xbia1 d.79.3.1 (A:2-116) Ribosomal protein L7ae {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2ozba1 d.79.3.1 (A:4-128) Spliceosomal 15.5kd protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2alea1 d.79.3.1 (A:1-126) Small nuclear ribonucleoprotein-associated protein 1, Snu13p {Saccharomyces cerevisiae [TaxId: 4932]} Back     information, alignment and structure
>d2vgna3 d.79.3.2 (A:278-381) Dom34 {Saccharomyces cerevisiae [TaxId: 4932]} Back     information, alignment and structure
>d1x52a1 d.79.3.2 (A:8-118) Cell division protein pelota {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure