Citrus Sinensis ID: 037081
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 75 | ||||||
| 255576194 | 112 | 60S ribosomal protein L30, putative [Ric | 0.693 | 0.464 | 0.818 | 2e-16 | |
| 224081200 | 112 | predicted protein [Populus trichocarpa] | 0.693 | 0.464 | 0.8 | 3e-16 | |
| 224104913 | 112 | predicted protein [Populus trichocarpa] | 0.693 | 0.464 | 0.8 | 4e-16 | |
| 217073834 | 112 | unknown [Medicago truncatula] gi|3884965 | 0.693 | 0.464 | 0.781 | 4e-16 | |
| 449445100 | 112 | PREDICTED: 60S ribosomal protein L30-lik | 0.693 | 0.464 | 0.8 | 6e-16 | |
| 282848250 | 112 | 60S ribosomal protein L30 [Jatropha curc | 0.693 | 0.464 | 0.781 | 6e-16 | |
| 224093800 | 112 | predicted protein [Populus trichocarpa] | 0.693 | 0.464 | 0.781 | 6e-16 | |
| 357502689 | 112 | 60S ribosomal protein L30 [Medicago trun | 0.693 | 0.464 | 0.781 | 7e-16 | |
| 6094048 | 112 | RecName: Full=60S ribosomal protein L30 | 0.693 | 0.464 | 0.781 | 7e-16 | |
| 225438619 | 112 | PREDICTED: 60S ribosomal protein L30 [Vi | 0.693 | 0.464 | 0.781 | 7e-16 |
| >gi|255576194|ref|XP_002528991.1| 60S ribosomal protein L30, putative [Ricinus communis] gi|223531581|gb|EEF33410.1| 60S ribosomal protein L30, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
Score = 89.7 bits (221), Expect = 2e-16, Method: Compositional matrix adjust.
Identities = 45/55 (81%), Positives = 49/55 (89%), Gaps = 3/55 (5%)
Query: 24 KKTHESINNRLALVMKSGKYTLGYKAAIRSLRRN---LIILSSNCPPLRKSEIEY 75
KKTHESINNRLALVMKSGKYTLGYK +RSLR + LII+S+NCPPLRKSEIEY
Sbjct: 8 KKTHESINNRLALVMKSGKYTLGYKTVLRSLRTSKGKLIIISNNCPPLRKSEIEY 62
|
Source: Ricinus communis Species: Ricinus communis Genus: Ricinus Family: Euphorbiaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|224081200|ref|XP_002306331.1| predicted protein [Populus trichocarpa] gi|118484057|gb|ABK93914.1| unknown [Populus trichocarpa] gi|118485363|gb|ABK94539.1| unknown [Populus trichocarpa] gi|222855780|gb|EEE93327.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|224104913|ref|XP_002313617.1| predicted protein [Populus trichocarpa] gi|224131730|ref|XP_002328094.1| predicted protein [Populus trichocarpa] gi|118483895|gb|ABK93838.1| unknown [Populus trichocarpa] gi|222837609|gb|EEE75974.1| predicted protein [Populus trichocarpa] gi|222850025|gb|EEE87572.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|217073834|gb|ACJ85277.1| unknown [Medicago truncatula] gi|388496542|gb|AFK36337.1| unknown [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|449445100|ref|XP_004140311.1| PREDICTED: 60S ribosomal protein L30-like isoform 1 [Cucumis sativus] gi|449445102|ref|XP_004140312.1| PREDICTED: 60S ribosomal protein L30-like isoform 2 [Cucumis sativus] gi|449479854|ref|XP_004155728.1| PREDICTED: 60S ribosomal protein L30-like isoform 1 [Cucumis sativus] gi|449479857|ref|XP_004155729.1| PREDICTED: 60S ribosomal protein L30-like isoform 2 [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|282848250|gb|ADB02906.1| 60S ribosomal protein L30 [Jatropha curcas] | Back alignment and taxonomy information |
|---|
| >gi|224093800|ref|XP_002309997.1| predicted protein [Populus trichocarpa] gi|118481493|gb|ABK92689.1| unknown [Populus trichocarpa] gi|118483057|gb|ABK93438.1| unknown [Populus trichocarpa] gi|222852900|gb|EEE90447.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|357502689|ref|XP_003621633.1| 60S ribosomal protein L30 [Medicago truncatula] gi|355496648|gb|AES77851.1| 60S ribosomal protein L30 [Medicago truncatula] gi|388504426|gb|AFK40279.1| unknown [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|6094048|sp|O49884.1|RL30_LUPLU RecName: Full=60S ribosomal protein L30 gi|2879811|emb|CAA11256.1| ribosomal protein L30 [Lupinus luteus] | Back alignment and taxonomy information |
|---|
| >gi|225438619|ref|XP_002281037.1| PREDICTED: 60S ribosomal protein L30 [Vitis vinifera] gi|296082469|emb|CBI21474.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 75 | ||||||
| TAIR|locus:2013205 | 112 | AT1G36240 [Arabidopsis thalian | 0.693 | 0.464 | 0.727 | 1.4e-16 | |
| TAIR|locus:2093984 | 112 | RLK902 "receptor-like kinase 9 | 0.693 | 0.464 | 0.727 | 1.4e-16 | |
| TAIR|locus:2029401 | 112 | AT1G77940 [Arabidopsis thalian | 0.693 | 0.464 | 0.709 | 3.7e-16 | |
| UNIPROTKB|G1K316 | 108 | RPL30 "60S ribosomal protein L | 0.693 | 0.481 | 0.636 | 4.4e-13 | |
| UNIPROTKB|P67883 | 115 | RPL30 "60S ribosomal protein L | 0.693 | 0.452 | 0.636 | 4.4e-13 | |
| UNIPROTKB|Q3T0D5 | 115 | RPL30 "60S ribosomal protein L | 0.693 | 0.452 | 0.636 | 4.4e-13 | |
| UNIPROTKB|E5RI99 | 114 | RPL30 "60S ribosomal protein L | 0.693 | 0.456 | 0.636 | 4.4e-13 | |
| UNIPROTKB|P62888 | 115 | RPL30 "60S ribosomal protein L | 0.693 | 0.452 | 0.636 | 4.4e-13 | |
| UNIPROTKB|F2Z554 | 115 | RPL30 "Uncharacterized protein | 0.693 | 0.452 | 0.636 | 4.4e-13 | |
| MGI|MGI:98037 | 115 | Rpl30 "ribosomal protein L30" | 0.693 | 0.452 | 0.636 | 4.4e-13 |
| TAIR|locus:2013205 AT1G36240 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 205 (77.2 bits), Expect = 1.4e-16, P = 1.4e-16
Identities = 40/55 (72%), Positives = 49/55 (89%)
Query: 24 KKTHESINNRLALVMKSGKYTLGYKAAIRSLRRN---LIILSSNCPPLRKSEIEY 75
KK+HE IN+RLALVMKSGKYTLGYK+ ++SLR + LI++SSNCPPLR+SEIEY
Sbjct: 8 KKSHEGINSRLALVMKSGKYTLGYKSVLKSLRSSKGKLILISSNCPPLRRSEIEY 62
|
|
| TAIR|locus:2093984 RLK902 "receptor-like kinase 902" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2029401 AT1G77940 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|G1K316 RPL30 "60S ribosomal protein L30" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P67883 RPL30 "60S ribosomal protein L30" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q3T0D5 RPL30 "60S ribosomal protein L30" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E5RI99 RPL30 "60S ribosomal protein L30" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P62888 RPL30 "60S ribosomal protein L30" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F2Z554 RPL30 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:98037 Rpl30 "ribosomal protein L30" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| GSVIVG00015281001 | SubName- Full=Chromosome chr18 scaffold_1, whole genome shotgun sequence; (112 aa) | ||||||||||
(Vitis vinifera) | |||||||||||
| GSVIVG00023139001 | • | • | • | • | 0.941 | ||||||
| GSVIVG00018552001 | • | • | • | • | 0.854 | ||||||
| GSVIVG00026857001 | • | • | • | 0.850 | |||||||
| GSVIVG00029522001 | • | • | • | 0.821 | |||||||
| GSVIVG00019318001 | • | • | • | • | 0.807 | ||||||
| GSVIVG00031140001 | • | • | • | • | 0.790 | ||||||
| GSVIVG00005647001 | • | • | • | • | • | 0.786 | |||||
| GSVIVG00019030001 | • | • | • | • | 0.780 | ||||||
| GSVIVG00025458001 | • | • | • | • | 0.767 | ||||||
| Rps5 | • | • | • | • | 0.766 |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 75 | |||
| PTZ00106 | 108 | PTZ00106, PTZ00106, 60S ribosomal protein L30; Pro | 3e-25 | |
| COG1911 | 100 | COG1911, RPL30, Ribosomal protein L30E [Translatio | 6e-15 | |
| pfam01248 | 95 | pfam01248, Ribosomal_L7Ae, Ribosomal protein L7Ae/ | 7e-09 | |
| PRK01018 | 99 | PRK01018, PRK01018, 50S ribosomal protein L30e; Re | 5e-05 |
| >gnl|CDD|185450 PTZ00106, PTZ00106, 60S ribosomal protein L30; Provisional | Back alignment and domain information |
|---|
Score = 89.8 bits (223), Expect = 3e-25
Identities = 34/55 (61%), Positives = 45/55 (81%), Gaps = 3/55 (5%)
Query: 24 KKTHESINNRLALVMKSGKYTLGYKAAIRSLRR---NLIILSSNCPPLRKSEIEY 75
KK ESIN++L LVMKSGKYTLG K+ +++LR L+I+S+NCPP+R+SEIEY
Sbjct: 7 KKAQESINSKLQLVMKSGKYTLGTKSTLKALRNGKAKLVIISNNCPPIRRSEIEY 61
|
Length = 108 |
| >gnl|CDD|224823 COG1911, RPL30, Ribosomal protein L30E [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|216387 pfam01248, Ribosomal_L7Ae, Ribosomal protein L7Ae/L30e/S12e/Gadd45 family | Back alignment and domain information |
|---|
| >gnl|CDD|179205 PRK01018, PRK01018, 50S ribosomal protein L30e; Reviewed | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 75 | |||
| COG1911 | 100 | RPL30 Ribosomal protein L30E [Translation, ribosom | 99.85 | |
| KOG2988 | 112 | consensus 60S ribosomal protein L30 [Translation, | 99.8 | |
| PTZ00106 | 108 | 60S ribosomal protein L30; Provisional | 99.61 | |
| PRK01018 | 99 | 50S ribosomal protein L30e; Reviewed | 99.41 | |
| PRK06683 | 82 | hypothetical protein; Provisional | 99.04 | |
| PRK07714 | 100 | hypothetical protein; Provisional | 98.97 | |
| PRK05583 | 104 | ribosomal protein L7Ae family protein; Provisional | 98.93 | |
| PRK13602 | 82 | putative ribosomal protein L7Ae-like; Provisional | 98.87 | |
| PRK07283 | 98 | hypothetical protein; Provisional | 98.83 | |
| TIGR03677 | 117 | rpl7ae 50S ribosomal protein L7Ae. Multifunctional | 98.7 | |
| PF01248 | 95 | Ribosomal_L7Ae: Ribosomal protein L7Ae/L30e/S12e/G | 98.7 | |
| PRK13601 | 82 | putative L7Ae-like ribosomal protein; Provisional | 98.67 | |
| PRK04175 | 122 | rpl7ae 50S ribosomal protein L7Ae; Validated | 98.61 | |
| COG1358 | 116 | RPL8A Ribosomal protein HS6-type (S12/L30/L7a) [Tr | 97.47 | |
| PRK09190 | 220 | hypothetical protein; Provisional | 97.16 | |
| PRK13600 | 84 | putative ribosomal protein L7Ae-like; Provisional | 96.0 | |
| KOG3406 | 134 | consensus 40S ribosomal protein S12 [Translation, | 91.02 | |
| PTZ00222 | 263 | 60S ribosomal protein L7a; Provisional | 86.6 |
| >COG1911 RPL30 Ribosomal protein L30E [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
Probab=99.85 E-value=5.2e-22 Score=133.35 Aligned_cols=50 Identities=44% Similarity=0.743 Sum_probs=48.7
Q ss_pred hHHhHHHHHHHHHHhcceEeehHHHHHHHhh---ceeeeeCCCChhhhhhhcC
Q 037081 26 THESINNRLALVMKSGKYTLGYKAAIRSLRR---NLIILSSNCPPLRKSEIEY 75 (75)
Q Consensus 26 ~~~~i~~~L~la~KTGK~~LG~KqTlK~l~~---KLVIiA~NcP~~~K~eIEY 75 (75)
..+||+++|+++||||||+||+|+|||++++ ||||||+|||+++|+||||
T Consensus 3 ~~~~v~~~L~~avkTGkvilG~k~tiK~lk~gkaKliiiAsN~P~~~k~~iey 55 (100)
T COG1911 3 MGDDVEKELKLAVKTGKVILGSKRTIKSLKLGKAKLIIIASNCPKELKEDIEY 55 (100)
T ss_pred ccchHHHHHHHHHhcCCEEEehHHHHHHHHcCCCcEEEEecCCCHHHHHHHHH
Confidence 5689999999999999999999999999999 9999999999999999998
|
|
| >KOG2988 consensus 60S ribosomal protein L30 [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PTZ00106 60S ribosomal protein L30; Provisional | Back alignment and domain information |
|---|
| >PRK01018 50S ribosomal protein L30e; Reviewed | Back alignment and domain information |
|---|
| >PRK06683 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK07714 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK05583 ribosomal protein L7Ae family protein; Provisional | Back alignment and domain information |
|---|
| >PRK13602 putative ribosomal protein L7Ae-like; Provisional | Back alignment and domain information |
|---|
| >PRK07283 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03677 rpl7ae 50S ribosomal protein L7Ae | Back alignment and domain information |
|---|
| >PF01248 Ribosomal_L7Ae: Ribosomal protein L7Ae/L30e/S12e/Gadd45 family; InterPro: IPR004038 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms | Back alignment and domain information |
|---|
| >PRK13601 putative L7Ae-like ribosomal protein; Provisional | Back alignment and domain information |
|---|
| >PRK04175 rpl7ae 50S ribosomal protein L7Ae; Validated | Back alignment and domain information |
|---|
| >COG1358 RPL8A Ribosomal protein HS6-type (S12/L30/L7a) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PRK09190 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK13600 putative ribosomal protein L7Ae-like; Provisional | Back alignment and domain information |
|---|
| >KOG3406 consensus 40S ribosomal protein S12 [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PTZ00222 60S ribosomal protein L7a; Provisional | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 75 | ||||
| 1ysh_C | 104 | Localization And Dynamic Behavior Of Ribosomal Prot | 1e-15 | ||
| 3izr_f | 112 | Localization Of The Large Subunit Ribosomal Protein | 1e-14 | ||
| 1t0k_B | 105 | Joint X-ray And Nmr Refinement Of Yeast L30e-mrna C | 9e-14 | ||
| 1ck2_A | 104 | Yeast (Saccharomyces Cerevisiae) Ribosomal Protein | 1e-13 | ||
| 2zkr_6 | 115 | Structure Of A Mammalian Ribosomal 60s Subunit With | 2e-13 | ||
| 3vi6_A | 125 | Crystal Structure Of Human L30e Length = 125 | 2e-13 | ||
| 3jyw_2 | 98 | Structure Of The 60s Proteins For Eukaryotic Riboso | 6e-13 | ||
| 4a18_G | 104 | T.Thermophila 60s Ribosomal Subunit In Complex With | 6e-12 | ||
| 3zf7_g | 105 | High-resolution Cryo-electron Microscopy Structure | 2e-11 | ||
| 2bo1_A | 101 | Crystal Structure Of A Hybrid Ribosomal Protein L30 | 1e-04 |
| >pdb|1YSH|C Chain C, Localization And Dynamic Behavior Of Ribosomal Protein L30e Length = 104 | Back alignment and structure |
|
| >pdb|3IZR|FF Chain f, Localization Of The Large Subunit Ribosomal Proteins Into A 5.5 A Cryo-Em Map Of Triticum Aestivum Translating 80s Ribosome Length = 112 | Back alignment and structure |
| >pdb|1T0K|B Chain B, Joint X-ray And Nmr Refinement Of Yeast L30e-mrna Complex Length = 105 | Back alignment and structure |
| >pdb|1CK2|A Chain A, Yeast (Saccharomyces Cerevisiae) Ribosomal Protein L30 Length = 104 | Back alignment and structure |
| >pdb|2ZKR|6 Chain 6, Structure Of A Mammalian Ribosomal 60s Subunit Within An 80s Complex Obtained By Docking Homology Models Of The Rna And Proteins Into An 8.7 A Cryo-Em Map Length = 115 | Back alignment and structure |
| >pdb|3VI6|A Chain A, Crystal Structure Of Human L30e Length = 125 | Back alignment and structure |
| >pdb|3JYW|2 Chain 2, Structure Of The 60s Proteins For Eukaryotic Ribosome Based On Cryo-Em Map Of Thermomyces Lanuginosus Ribosome At 8.9a Resolution Length = 98 | Back alignment and structure |
| >pdb|4A18|G Chain G, T.Thermophila 60s Ribosomal Subunit In Complex With Initiation Factor 6. This File Contains 26s Rrna And Proteins Of Molecule 1 Length = 104 | Back alignment and structure |
| >pdb|3ZF7|GG Chain g, High-resolution Cryo-electron Microscopy Structure Of The Trypanosoma Brucei Ribosome Length = 105 | Back alignment and structure |
| >pdb|2BO1|A Chain A, Crystal Structure Of A Hybrid Ribosomal Protein L30e With Surface Residues From T. Celer, And Core Residues From Yeast Length = 101 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 75 | |||
| 3cpq_A | 110 | 50S ribosomal protein L30E; RNA-protein, elongatio | 3e-17 | |
| 3iz5_F | 190 | 60S ribosomal protein L9 (L6P); eukaryotic ribosom | 3e-17 | |
| 3u5e_c | 105 | L32, RP73, YL38, 60S ribosomal protein L30; transl | 3e-17 | |
| 4a18_G | 104 | RPL30; ribosome, eukaryotic initiation factor 6, E | 6e-17 | |
| 3vi6_A | 125 | 60S ribosomal protein L30; three-layer alpha/beta/ | 7e-17 | |
| 1w41_A | 101 | 50S ribosomal protein L30E; electrostatic interact | 6e-15 | |
| 3v7q_A | 101 | Probable ribosomal protein YLXQ; L7AE superfamily, | 2e-10 | |
| 3on1_A | 101 | BH2414 protein; structural genomics, PSI-2, protei | 3e-10 |
| >3cpq_A 50S ribosomal protein L30E; RNA-protein, elongation factor, ribonucleoprotein, structural genomics, NPPSFA; 1.90A {Methanocaldococcus jannaschii} Length = 110 | Back alignment and structure |
|---|
Score = 68.7 bits (168), Expect = 3e-17
Identities = 12/57 (21%), Positives = 30/57 (52%), Gaps = 3/57 (5%)
Query: 22 LEKKTHESINNRLALVMKSGKYTLGYKAAIRSLRRN---LIILSSNCPPLRKSEIEY 75
+ ++ + +N + + +GK LG K I+ ++ L++L+ N P + +++Y
Sbjct: 1 MRRRENMDVNKAIRTAVDTGKVILGSKRTIKFVKHGEGKLVVLAGNIPKDLEEDVKY 57
|
| >3u5e_c L32, RP73, YL38, 60S ribosomal protein L30; translation, ribosome, ribosomal R ribosomal protein, STM1, eukaryotic ribosome; 3.00A {Saccharomyces cerevisiae} PDB: 3izc_f 3izs_f 3o58_Z 3o5h_Z 1t0k_B 3u5i_c 1ck2_A 1cn7_A 1nmu_B* 3jyw_2 Length = 105 | Back alignment and structure |
|---|
| >4a18_G RPL30; ribosome, eukaryotic initiation factor 6, EIF6, transla large ribosomal subunit, rRNA; 3.52A {Tetrahymena thermophila} PDB: 4a19_G 4a1b_G 4a1d_G 4adx_6 Length = 104 | Back alignment and structure |
|---|
| >3vi6_A 60S ribosomal protein L30; three-layer alpha/beta/ALPA; 1.59A {Homo sapiens} PDB: 2zkr_6 1ysh_C Length = 125 | Back alignment and structure |
|---|
| >1w41_A 50S ribosomal protein L30E; electrostatic interactions, thermostability, protein engineering; 1.7A {Thermococcus celer} SCOP: d.79.3.1 PDB: 3n4y_A 3lfo_A 1w40_A 1go0_A 1go1_A 1h7m_A 1w42_A 1w3e_X 3ra6_A 3ra5_A 3n4z_A 2bo1_A Length = 101 | Back alignment and structure |
|---|
| >3v7q_A Probable ribosomal protein YLXQ; L7AE superfamily, K-turn binding, K-turn RNA, hypothetical R protein, RNA binding protein; HET: CIT; 1.55A {Bacillus subtilis} Length = 101 | Back alignment and structure |
|---|
| >3on1_A BH2414 protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG, unknown function; HET: MSE; 1.65A {Bacillus halodurans} Length = 101 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 75 | |||
| 3iz5_f | 112 | 60S ribosomal protein L30 (L30E); eukaryotic ribos | 99.64 | |
| 3vi6_A | 125 | 60S ribosomal protein L30; three-layer alpha/beta/ | 99.52 | |
| 3j21_Z | 99 | 50S ribosomal protein L30E; archaea, archaeal, KIN | 99.45 | |
| 3u5e_c | 105 | L32, RP73, YL38, 60S ribosomal protein L30; transl | 99.45 | |
| 4a18_G | 104 | RPL30; ribosome, eukaryotic initiation factor 6, E | 99.43 | |
| 3cpq_A | 110 | 50S ribosomal protein L30E; RNA-protein, elongatio | 99.31 | |
| 1w41_A | 101 | 50S ribosomal protein L30E; electrostatic interact | 99.3 | |
| 3v7q_A | 101 | Probable ribosomal protein YLXQ; L7AE superfamily, | 99.2 | |
| 3on1_A | 101 | BH2414 protein; structural genomics, PSI-2, protei | 99.2 | |
| 3v7e_A | 82 | Ribosome-associated protein L7AE-like; RNA-protein | 99.12 | |
| 2xzm_U | 126 | Ribosomal protein L7AE containing protein; ribosom | 99.08 | |
| 2jnb_A | 144 | NHP2-like protein 1; splicing, KINK-turn RNA-bindi | 98.99 | |
| 2ale_A | 134 | SNU13, NHP2/L7AE family protein YEL026W; splicing, | 98.98 | |
| 2lbw_A | 121 | H/ACA ribonucleoprotein complex subunit 2; L7AE, s | 98.94 | |
| 2fc3_A | 124 | 50S ribosomal protein L7AE; alpha-beta-alpha sandw | 98.85 | |
| 2aif_A | 135 | Ribosomal protein L7A; high-mobility like protein, | 98.84 | |
| 1vq8_F | 120 | 50S ribosomal protein L7AE; ribosome 50S, protein- | 98.83 | |
| 1rlg_A | 119 | 50S ribosomal protein L7AE; protein-RNA, structura | 98.81 | |
| 3o85_A | 122 | Ribosomal protein L7AE; alpha beta sandwich fold, | 98.77 | |
| 3u5c_M | 143 | 40S ribosomal protein S12, 40S ribosomal protein S | 98.46 | |
| 1xbi_A | 120 | 50S ribosomal protein L7AE; alpha-beta-alpha sandw | 98.32 | |
| 2zkr_f | 266 | 60S ribosomal protein L7A; protein-RNA complex, 60 | 97.18 | |
| 2kg4_A | 165 | Growth arrest and DNA-damage-inducible protein GA | 96.63 | |
| 3jyw_G | 113 | 60S ribosomal protein L8(A); eukaryotic ribosome, | 96.22 | |
| 3izc_H | 256 | 60S ribosomal protein RPL8 (L7AE); eukaryotic ribo | 95.73 | |
| 4a17_F | 255 | RPL7A, 60S ribosomal protein L9; eukaryotic riboso | 91.78 | |
| 2bjq_A | 345 | MFP2A; motility, nematode, MSP; 1.75A {Ascaris suu | 89.29 | |
| 3ir9_A | 166 | Peptide chain release factor subunit 1; structural | 81.22 |
| >3vi6_A 60S ribosomal protein L30; three-layer alpha/beta/ALPA; 1.59A {Homo sapiens} PDB: 2zkr_6 1ysh_C | Back alignment and structure |
|---|
| >3j21_Z 50S ribosomal protein L30E; archaea, archaeal, KINK-turn, protein synthe ribosome; 6.60A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >3u5e_c L32, RP73, YL38, 60S ribosomal protein L30; translation, ribosome, ribosomal R ribosomal protein, STM1, eukaryotic ribosome; 3.00A {Saccharomyces cerevisiae} PDB: 3izc_f 3izs_f 3o58_Z 3o5h_Z 1t0k_B 3u5i_c 4b6a_c 1ck2_A 1cn7_A 1nmu_B* 3jyw_2 | Back alignment and structure |
|---|
| >4a18_G RPL30; ribosome, eukaryotic initiation factor 6, EIF6, transla large ribosomal subunit, rRNA; 3.52A {Tetrahymena thermophila} PDB: 4a19_G 4a1b_G 4a1d_G 4adx_6 | Back alignment and structure |
|---|
| >3cpq_A 50S ribosomal protein L30E; RNA-protein, elongation factor, ribonucleoprotein, structural genomics, NPPSFA; 1.90A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >1w41_A 50S ribosomal protein L30E; electrostatic interactions, thermostability, protein engineering; 1.7A {Thermococcus celer} SCOP: d.79.3.1 PDB: 3n4y_A 3lfo_A 1w40_A 1go0_A 1go1_A 1h7m_A 1w42_A 1w3e_X 3ra6_A 3ra5_A 3n4z_A 2bo1_A | Back alignment and structure |
|---|
| >3v7q_A Probable ribosomal protein YLXQ; L7AE superfamily, K-turn binding, K-turn RNA, hypothetical R protein, RNA binding protein; HET: CIT; 1.55A {Bacillus subtilis} | Back alignment and structure |
|---|
| >3on1_A BH2414 protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG, unknown function; HET: MSE; 1.65A {Bacillus halodurans} | Back alignment and structure |
|---|
| >3v7e_A Ribosome-associated protein L7AE-like; RNA-protein complex, K-turn, L7AE-like, A member L7AE/L30E superfamily; HET: SAM; 2.80A {Bacillus subtilis} | Back alignment and structure |
|---|
| >2xzm_U Ribosomal protein L7AE containing protein; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_U | Back alignment and structure |
|---|
| >2jnb_A NHP2-like protein 1; splicing, KINK-turn RNA-binding protein, NHPX, RNA binding protein; NMR {Homo sapiens} SCOP: d.79.3.1 | Back alignment and structure |
|---|
| >2ale_A SNU13, NHP2/L7AE family protein YEL026W; splicing, RNA, yeast, His-TAG, RNA binding protein; 1.80A {Saccharomyces cerevisiae} SCOP: d.79.3.1 PDB: 1zwz_A 2ozb_A 3siu_A 3siv_A 1e7k_A | Back alignment and structure |
|---|
| >2lbw_A H/ACA ribonucleoprotein complex subunit 2; L7AE, snoRNP, scaRNP, RNA binding protein; NMR {Saccharomyces cerevisiae} PDB: 2lbx_A | Back alignment and structure |
|---|
| >2fc3_A 50S ribosomal protein L7AE; alpha-beta-alpha sandwich, ribosome, RNA binding protein; 1.56A {Aeropyrum pernix} SCOP: d.79.3.1 PDB: 3pla_C* 3id5_C* 3hax_D* 2hvy_D* 3hay_D* 3nvi_B 3nmu_C 3nvk_E* 3lwr_C 3lwo_C* 3lwq_C* 3lwp_C 3lwv_C 3hjw_C* 2czw_A 1pxw_A | Back alignment and structure |
|---|
| >2aif_A Ribosomal protein L7A; high-mobility like protein, transcription factor, structural genomics, structural genomics consortium, SGC; 1.90A {Cryptosporidium parvum} SCOP: d.79.3.1 | Back alignment and structure |
|---|
| >1vq8_F 50S ribosomal protein L7AE; ribosome 50S, protein-protein complex, RNA-RNA complex, PROT complex, peptidyl transferase reaction; HET: 1MA OMU OMG UR3 PSU SPS; 2.20A {Haloarcula marismortui} SCOP: d.79.3.1 PDB: 1vq4_F* 1vq5_F* 1vq6_F* 1vq7_F* 1s72_F* 1vq9_F* 1vqk_F* 1vql_F* 1vqm_F* 1vqn_F* 1vqo_F* 1vqp_F* 1yhq_F* 1yi2_F* 1yij_F* 1yit_F* 1yj9_F* 1yjn_F* 1yjw_F* 2otj_F* ... | Back alignment and structure |
|---|
| >1rlg_A 50S ribosomal protein L7AE; protein-RNA, structural protein/RNA complex; HET: 5BU; 2.70A {Archaeoglobus fulgidus} SCOP: d.79.3.1 | Back alignment and structure |
|---|
| >3o85_A Ribosomal protein L7AE; alpha beta sandwich fold, K-turn RNA binding protein, KINK T ribosomal protein; 1.81A {Giardia lamblia} | Back alignment and structure |
|---|
| >3u5c_M 40S ribosomal protein S12, 40S ribosomal protein S11-A; translation, ribosome, ribosomal, ribosomal R ribosomal protein, eukaryotic ribosome, RNA-protein C; 3.00A {Saccharomyces cerevisiae} PDB: 3u5g_M | Back alignment and structure |
|---|
| >1xbi_A 50S ribosomal protein L7AE; alpha-beta-alpha sandwich fold, RNA binding protein/structural protein complex; HET: EPE; 1.45A {Methanocaldococcus jannaschii} SCOP: d.79.3.1 PDB: 1ra4_A* 1sds_A 3paf_A | Back alignment and structure |
|---|
| >2zkr_f 60S ribosomal protein L7A; protein-RNA complex, 60S ribosomal subunit, ribosomal protein/RNA complex; 8.70A {Canis familiaris} | Back alignment and structure |
|---|
| >2kg4_A Growth arrest and DNA-damage-inducible protein GA alpha; GADD45, flexible regions, monomer cycle; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3jyw_G 60S ribosomal protein L8(A); eukaryotic ribosome, RACK1 protein, flexible fitting; 8.90A {Thermomyces lanuginosus} PDB: 1s1i_G | Back alignment and structure |
|---|
| >4a17_F RPL7A, 60S ribosomal protein L9; eukaryotic ribosome, ribosome, eukaryotic initiation factor 60S, translation, large ribosomal subunit; 3.52A {Tetrahymena thermophila} PDB: 4a1a_F 4a1c_F 4a1e_F | Back alignment and structure |
|---|
| >2bjq_A MFP2A; motility, nematode, MSP; 1.75A {Ascaris suum} SCOP: b.169.1.1 b.169.1.1 | Back alignment and structure |
|---|
| >3ir9_A Peptide chain release factor subunit 1; structural genomics, APC36528.1, C-terminal domain, PSI-2, protein structure initiative; 2.21A {Methanosarcina mazei} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 75 | ||||
| d1t0kb_ | 97 | d.79.3.1 (B:) Eukaryotic ribosomal protein L30 (L3 | 2e-14 | |
| d2bo1a1 | 100 | d.79.3.1 (A:1-100) Eukaryotic ribosomal protein L3 | 2e-12 | |
| d1w3ex1 | 98 | d.79.3.1 (X:1-98) Eukaryotic ribosomal protein L30 | 2e-10 | |
| d1vqof1 | 119 | d.79.3.1 (F:1-119) Ribosomal protein L7ae {Archaeo | 9e-06 | |
| d2fc3a1 | 124 | d.79.3.1 (A:4-127) Ribosomal protein L7ae {Aeropyr | 1e-05 | |
| d1xbia1 | 115 | d.79.3.1 (A:2-116) Ribosomal protein L7ae {Archaeo | 1e-04 | |
| d1rlga_ | 113 | d.79.3.1 (A:) Ribosomal protein L7ae {Archaeon Arc | 0.001 |
| >d1t0kb_ d.79.3.1 (B:) Eukaryotic ribosomal protein L30 (L30e) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 97 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Bacillus chorismate mutase-like superfamily: L30e-like family: L30e/L7ae ribosomal proteins domain: Eukaryotic ribosomal protein L30 (L30e) species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]
Score = 59.8 bits (145), Expect = 2e-14
Identities = 32/50 (64%), Positives = 42/50 (84%), Gaps = 3/50 (6%)
Query: 29 SINNRLALVMKSGKYTLGYKAAIRSLRRN---LIILSSNCPPLRKSEIEY 75
SIN +LALV+KSGKYTLGYK+ ++SLR+ LII+++N P LRKSE+EY
Sbjct: 1 SINQKLALVIKSGKYTLGYKSTVKSLRQGKSKLIIIAANTPVLRKSELEY 50
|
| >d2bo1a1 d.79.3.1 (A:1-100) Eukaryotic ribosomal protein L30 (L30e) {Archaeon Thermococcus celer [TaxId: 2264]} Length = 100 | Back information, alignment and structure |
|---|
| >d1w3ex1 d.79.3.1 (X:1-98) Eukaryotic ribosomal protein L30 (L30e) {Archaeon Thermococcus celer [TaxId: 2264]} Length = 98 | Back information, alignment and structure |
|---|
| >d1vqof1 d.79.3.1 (F:1-119) Ribosomal protein L7ae {Archaeon Haloarcula marismortui [TaxId: 2238]} Length = 119 | Back information, alignment and structure |
|---|
| >d2fc3a1 d.79.3.1 (A:4-127) Ribosomal protein L7ae {Aeropyrum pernix [TaxId: 56636]} Length = 124 | Back information, alignment and structure |
|---|
| >d1xbia1 d.79.3.1 (A:2-116) Ribosomal protein L7ae {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 115 | Back information, alignment and structure |
|---|
| >d1rlga_ d.79.3.1 (A:) Ribosomal protein L7ae {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 113 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 75 | |||
| d1w3ex1 | 98 | Eukaryotic ribosomal protein L30 (L30e) {Archaeon | 99.54 | |
| d2bo1a1 | 100 | Eukaryotic ribosomal protein L30 (L30e) {Archaeon | 99.5 | |
| d1t0kb_ | 97 | Eukaryotic ribosomal protein L30 (L30e) {Baker's y | 99.34 | |
| d2fc3a1 | 124 | Ribosomal protein L7ae {Aeropyrum pernix [TaxId: 5 | 98.79 | |
| d1vqof1 | 119 | Ribosomal protein L7ae {Archaeon Haloarcula marism | 98.77 | |
| d2aifa1 | 115 | Ribosomal protein L7ae {Cryptosporidium parvum [Ta | 98.76 | |
| d1rlga_ | 113 | Ribosomal protein L7ae {Archaeon Archaeoglobus ful | 98.73 | |
| d1xbia1 | 115 | Ribosomal protein L7ae {Archaeon Methanococcus jan | 98.48 | |
| d2ozba1 | 125 | Spliceosomal 15.5kd protein {Human (Homo sapiens) | 98.39 | |
| d2alea1 | 126 | Small nuclear ribonucleoprotein-associated protein | 98.1 | |
| d2vgna3 | 104 | Dom34 {Saccharomyces cerevisiae [TaxId: 4932]} | 81.75 | |
| d1x52a1 | 111 | Cell division protein pelota {Human (Homo sapiens) | 80.57 |
| >d1w3ex1 d.79.3.1 (X:1-98) Eukaryotic ribosomal protein L30 (L30e) {Archaeon Thermococcus celer [TaxId: 2264]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Bacillus chorismate mutase-like superfamily: L30e-like family: L30e/L7ae ribosomal proteins domain: Eukaryotic ribosomal protein L30 (L30e) species: Archaeon Thermococcus celer [TaxId: 2264]
Probab=99.54 E-value=1.9e-15 Score=95.43 Aligned_cols=48 Identities=29% Similarity=0.443 Sum_probs=46.0
Q ss_pred HhHHHHHHHHHHhcceEeehHHHHHHHhh---ceeeeeCCCChhhhhhhcC
Q 037081 28 ESINNRLALVMKSGKYTLGYKAAIRSLRR---NLIILSSNCPPLRKSEIEY 75 (75)
Q Consensus 28 ~~i~~~L~la~KTGK~~LG~KqTlK~l~~---KLVIiA~NcP~~~K~eIEY 75 (75)
+||+++|++|+|+||+++|+++++|+|+. ||||||+|||++.+++|+|
T Consensus 1 ~d~~~~L~~a~kaGklv~G~~~v~kal~~gkaklVilA~D~~~~~~~~i~~ 51 (98)
T d1w3ex1 1 VDFAFELRKAQDTGKIVMGARKSIQYAKMGGAKLIIVARNARPDIKEDIEY 51 (98)
T ss_dssp CCHHHHHHHHHHHSEEEESHHHHHHHHHHTCCSEEEEETTSCHHHHHHHHH
T ss_pred CCHHHHHHHHHHhCCEEEcHHHHHHHHHcCCccEEEEECCCCHHHHHHHHH
Confidence 58999999999999999999999999999 9999999999999999864
|
| >d2bo1a1 d.79.3.1 (A:1-100) Eukaryotic ribosomal protein L30 (L30e) {Archaeon Thermococcus celer [TaxId: 2264]} | Back information, alignment and structure |
|---|
| >d1t0kb_ d.79.3.1 (B:) Eukaryotic ribosomal protein L30 (L30e) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2fc3a1 d.79.3.1 (A:4-127) Ribosomal protein L7ae {Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d1vqof1 d.79.3.1 (F:1-119) Ribosomal protein L7ae {Archaeon Haloarcula marismortui [TaxId: 2238]} | Back information, alignment and structure |
|---|
| >d2aifa1 d.79.3.1 (A:16-130) Ribosomal protein L7ae {Cryptosporidium parvum [TaxId: 5807]} | Back information, alignment and structure |
|---|
| >d1rlga_ d.79.3.1 (A:) Ribosomal protein L7ae {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1xbia1 d.79.3.1 (A:2-116) Ribosomal protein L7ae {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d2ozba1 d.79.3.1 (A:4-128) Spliceosomal 15.5kd protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2alea1 d.79.3.1 (A:1-126) Small nuclear ribonucleoprotein-associated protein 1, Snu13p {Saccharomyces cerevisiae [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2vgna3 d.79.3.2 (A:278-381) Dom34 {Saccharomyces cerevisiae [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1x52a1 d.79.3.2 (A:8-118) Cell division protein pelota {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|