Citrus Sinensis ID: 037090


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------18
MSSLQDDHQVMMKPARDEQDFLLAMELASGTILPMTIKSAIELDRSVQRLYGLAPVSKYFVPNEEGVSLAPTLLIIQDKVNMDSWSCVKDALLEGLVPFMKAHNGMDGFAVAAKDEKINNLFNQSMHNHTTIVMKEILETYKGFERLNQFVDVADGLGENKNILLTKISIISLNTIVT
cccccccccccccccccHHHHHHHHHHHHccccccEEEEcccccccEEEEEEccccccccccccccccHHHHHHHHccccccccccHHHHHHHHcccHHHHHHccccHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccEEEEEcccccHHHHHHHHHccccccccccc
cccHHHHHHccccccccccHHHHHHHHHcccHHHEEEEEEEcccccEEEEEEEcHHHccccccEccEccHHHHHHHccHHHHHHHccHHHHHHHcccHHHHHHccccHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccEEEEccccccHHHHHHccccccEEEEEcc
MSSLQDDHQVMMKPARDEQDFLLAMELASGTILPMTIKSAIELDRSVQrlyglapvskyfvpneegvslaptLLIIqdkvnmdswSCVKDALLEGLVPfmkahngmdgfavaaKDEKINNLFNQSMHNHTTIVMKEILETYKGFERLNQFVDVADGLGENKNILLTKISIISLNTIVT
msslqddhqvmMKPARDEQDFLLAMELASGTILPMTIKSAIELDRSVQRLYGLAPVSKYFVPNEEGVSLAPTLLIIQDKVNMDSWSCVKDALLEGLVPFMKAHNGMDGFAVAAKDEKINNLFNQSMHNHTTIVMKEILETYKGFERLNQFVDVADGlgenknilltkisiislntivt
MSSLQDDHQVMMKPARDEQDFLLAMELASGTILPMTIKSAIELDRSVQRLYGLAPVSKYFVPNEEGVSLAPTLLIIQDKVNMDSWSCVKDALLEGLVPFMKAHNGMDGFAVAAKDEKINNLFNQSMHNHTTIVMKEILETYKGFERLNQFVDVADGLGENKNILLTKISIISLNTIVT
********************FLLAMELASGTILPMTIKSAIELDRSVQRLYGLAPVSKYFVPNEEGVSLAPTLLIIQDKVNMDSWSCVKDALLEGLVPFMKAHNGMDGFAVAAKDEKINNLFNQSMHNHTTIVMKEILETYKGFERLNQFVDVADGLGENKNILLTKISIISLNTI**
******************QDFLLAMELASGTILPMTIKS*****RSVQRLYGLAPVSKYFVPNEEGVSLAPTLLIIQDKVNMDSWSCVKDALLEGLVPFMKAHNGMDGFAVAAKDEKINNLFNQSMHNHTTIVMKEILETYKGFERLNQFVDVADGLGENKNILLTKISIISLNTIVT
MSSLQDDHQVMMKPARDEQDFLLAMELASGTILPMTIKSAIELDRSVQRLYGLAPVSKYFVPNEEGVSLAPTLLIIQDKVNMDSWSCVKDALLEGLVPFMKAHNGMDGFAVAAKDEKINNLFNQSMHNHTTIVMKEILETYKGFERLNQFVDVADGLGENKNILLTKISIISLNTIVT
*****DDHQVMMKPARDEQDFLLAMELASGTILPMTIKSAIELDRSVQRLYGLAPVSKYFVPNEEGVSLAPTLLIIQDKVNMDSWSCVKDALLEGLVPFMKAHNGMDGFAVAAKDEKINNLFNQSMHNHTTIVMKEILETYKGFERLNQFVDVADGLGENKNILLTKISIISLNTIVT
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSSLQDDHQVMMKPARDEQDFLLAMELASGTILPMTIKSAIELDRSVQRLYGLAPVSKYFVPNEEGVSLAPTLLIIQDKVNMDSWSCVKDALLEGLVPFMKAHNGMDGFAVAAKDEKINNLFNQSMHNHTTIVMKEILETYKGFERLNQFVDVADGLGENKNILLTKISIISLNTIVT
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query178 2.2.26 [Sep-21-2011]
Q9XGV9 361 Caffeic acid 3-O-methyltr N/A no 0.938 0.462 0.383 2e-32
Q8LL87 350 Caffeic acid 3-O-methyltr N/A no 0.865 0.44 0.388 3e-32
Q43046 365 Caffeic acid 3-O-methyltr N/A no 0.797 0.389 0.496 4e-32
Q9FK25 363 Flavone 3'-O-methyltransf yes no 0.842 0.413 0.385 4e-32
Q9SWC2313 Caffeic acid 3-O-methyltr N/A no 0.797 0.453 0.496 5e-32
Q43609 365 Caffeic acid 3-O-methyltr N/A no 0.797 0.389 0.489 5e-32
Q8W013 363 Caffeic acid 3-O-methyltr N/A no 0.797 0.391 0.489 1e-31
Q00763 365 Caffeic acid 3-O-methyltr N/A no 0.797 0.389 0.489 1e-31
Q6T1F5 365 Caffeic acid 3-O-methyltr N/A no 0.876 0.427 0.449 5e-31
Q6T1F6 354 Bergaptol O-methyltransfe N/A no 0.882 0.443 0.373 6e-31
>sp|Q9XGV9|COMT2_OCIBA Caffeic acid 3-O-methyltransferase 2 OS=Ocimum basilicum GN=COMT2 PE=2 SV=1 Back     alignment and function desciption
 Score =  138 bits (348), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 87/227 (38%), Positives = 117/227 (51%), Gaps = 60/227 (26%)

Query: 1   MSSLQDDHQVMMKPARDEQDFLLAMELASGTILPMT------------IKSA-------- 40
           MSS  ++ Q+    + +E++FL AM+LAS ++LPM             IK A        
Sbjct: 1   MSSTANNPQIN---SDEEENFLFAMQLASASVLPMVLKSAIELDLLELIKKAGAGAFVSP 57

Query: 41  ---------------IELDR---------------------SVQRLYGLAPVSKYFVPNE 64
                          + LDR                      VQRLYGLAPV K+   NE
Sbjct: 58  AELAAQLLTTNAEAHVMLDRILRLLTSYAILECRLKTLPDGGVQRLYGLAPVCKFLTKNE 117

Query: 65  EGVSLAPTLLIIQDKVNMDSWSCVKDALLEGLVPFMKAHNGMDGFAVAAKDEKINNLFNQ 124
           +GVS+AP  L+ QDKV M+SW  +KDA+L+G +PF KA+ GM  F     D + N +FNQ
Sbjct: 118 DGVSMAPLALMNQDKVLMESWYHLKDAVLDGGIPFNKAY-GMTAFEYHGTDPRFNKVFNQ 176

Query: 125 SMHNHTTIVMKEILETYKGFERLNQFVDVADGLGENKNILLTKISII 171
            M NH+TI MK+ILETY GF+ L   VDV  G G   N++++K   I
Sbjct: 177 GMSNHSTITMKKILETYTGFDGLKTVVDVGGGTGATLNMIISKYPSI 223




Catalyzes the conversion of caffeic acid to ferulic acid and of 5-hydroxyferulic acid to sinapic acid. The resulting products may subsequently be converted to the corresponding alcohols that are incorporated into lignins.
Ocimum basilicum (taxid: 39350)
EC: 2EC: .EC: 1EC: .EC: 1EC: .EC: 6EC: 8
>sp|Q8LL87|COMT1_COFCA Caffeic acid 3-O-methyltransferase OS=Coffea canephora PE=2 SV=1 Back     alignment and function description
>sp|Q43046|COMT1_POPKI Caffeic acid 3-O-methyltransferase 1 OS=Populus kitakamiensis GN=HOMT1 PE=3 SV=1 Back     alignment and function description
>sp|Q9FK25|OMT1_ARATH Flavone 3'-O-methyltransferase 1 OS=Arabidopsis thaliana GN=OMT1 PE=1 SV=1 Back     alignment and function description
>sp|Q9SWC2|COMT1_EUCGL Caffeic acid 3-O-methyltransferase (Fragment) OS=Eucalyptus globulus GN=COMT1 PE=3 SV=1 Back     alignment and function description
>sp|Q43609|COMT1_PRUDU Caffeic acid 3-O-methyltransferase OS=Prunus dulcis GN=COMT1 PE=2 SV=1 Back     alignment and function description
>sp|Q8W013|COMT1_CATRO Caffeic acid 3-O-methyltransferase OS=Catharanthus roseus GN=COMT1 PE=2 SV=1 Back     alignment and function description
>sp|Q00763|COMT1_POPTM Caffeic acid 3-O-methyltransferase 1 OS=Populus tremuloides GN=OMT1 PE=1 SV=1 Back     alignment and function description
>sp|Q6T1F5|COMT1_AMMMJ Caffeic acid 3-O-methyltransferase OS=Ammi majus GN=COMT PE=1 SV=1 Back     alignment and function description
>sp|Q6T1F6|BMT_AMMMJ Bergaptol O-methyltransferase OS=Ammi majus GN=BMT PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query178
345651711 364 caffeic acid O-methyltransferase [Salvia 0.955 0.467 0.374 4e-32
345651709 364 caffeic acid O-methyltransferase [Salvia 0.955 0.467 0.374 4e-32
338899427 355 caffeic acid O-methylltransferase [Chrys 0.848 0.425 0.395 9e-32
449438857 359 PREDICTED: caffeic acid 3-O-methyltransf 0.797 0.395 0.510 1e-31
449483224 359 PREDICTED: caffeic acid 3-O-methyltransf 0.797 0.395 0.510 1e-31
302171551 366 putative caffeic acid O-methyltransferas 0.955 0.464 0.378 2e-31
312283309 364 unnamed protein product [Thellungiella h 0.842 0.412 0.398 2e-31
154091348 365 caffeic acid O-methyl transferase [Leuca 0.915 0.446 0.386 2e-31
4808530 362 O-methyltransferase [Thalictrum tuberosu 0.921 0.453 0.376 3e-31
56605372 364 caffeate O-methyltransferase [Picea abie 0.870 0.425 0.372 3e-31
>gi|345651711|gb|AEO14871.1| caffeic acid O-methyltransferase [Salvia miltiorrhiza] Back     alignment and taxonomy information
 Score =  143 bits (360), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 85/227 (37%), Positives = 116/227 (51%), Gaps = 57/227 (25%)

Query: 1   MSSLQDDHQVMMKPARDEQDFLLAMELASGTILPMTIKS--------------------- 39
           M S   + Q     + +E+ FL AM+LAS ++LPM +KS                     
Sbjct: 1   MGSTTKNPQTAAVNSDEEESFLFAMQLASASVLPMVLKSAIELDLLEIIKKAGAGAFVSP 60

Query: 40  --------------AIELDR---------------------SVQRLYGLAPVSKYFVPNE 64
                         A+ LDR                      VQRLYGLAPV K+   N+
Sbjct: 61  AEVAAQLPTTNEGAAVMLDRILRLLASYAILECRLKTLPDGGVQRLYGLAPVCKFLTKND 120

Query: 65  EGVSLAPTLLIIQDKVNMDSWSCVKDALLEGLVPFMKAHNGMDGFAVAAKDEKINNLFNQ 124
           +GVS+AP  L+ QDKV M+SW  +KDA+L+G +PF KA+ GM  F     D + N +FNQ
Sbjct: 121 DGVSVAPLALMNQDKVLMESWYHLKDAVLDGEIPFNKAY-GMSAFEYHGTDPRFNKVFNQ 179

Query: 125 SMHNHTTIVMKEILETYKGFERLNQFVDVADGLGENKNILLTKISII 171
            M  H+TI MK+ILETYKGF+ LN  VDV  G+G   +++++K   I
Sbjct: 180 GMSGHSTITMKKILETYKGFDGLNSVVDVGGGIGATLHMIVSKYPSI 226




Source: Salvia miltiorrhiza

Species: Salvia miltiorrhiza

Genus: Salvia

Family: Lamiaceae

Order: Lamiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|345651709|gb|AEO14870.1| caffeic acid O-methyltransferase [Salvia miltiorrhiza] Back     alignment and taxonomy information
>gi|338899427|dbj|BAK42963.1| caffeic acid O-methylltransferase [Chrysanthemum x morifolium] Back     alignment and taxonomy information
>gi|449438857|ref|XP_004137204.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449483224|ref|XP_004156527.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|302171551|gb|ADK97702.1| putative caffeic acid O-methyltransferase [Citrus aurantium] Back     alignment and taxonomy information
>gi|312283309|dbj|BAJ34520.1| unnamed protein product [Thellungiella halophila] Back     alignment and taxonomy information
>gi|154091348|gb|ABS57468.1| caffeic acid O-methyl transferase [Leucaena leucocephala] gi|155966780|gb|ABU41320.1| caffeic acid o-methyl transferase [Leucaena leucocephala] Back     alignment and taxonomy information
>gi|4808530|gb|AAD29845.1|AF064697_1 O-methyltransferase [Thalictrum tuberosum] Back     alignment and taxonomy information
>gi|56605372|emb|CAI30878.1| caffeate O-methyltransferase [Picea abies] gi|116785470|gb|ABK23738.1| unknown [Picea sitchensis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query178
TAIR|locus:2153423 363 OMT1 "AT5G54160" [Arabidopsis 0.674 0.330 0.512 5.7e-36
UNIPROTKB|Q84N28 360 OMT1 "Flavone O-methyltransfer 0.786 0.388 0.444 3.2e-26
UNIPROTKB|Q6ZD89 368 ROMT-9 "Flavone 3'-O-methyltra 0.786 0.380 0.409 5.3e-24
TAIR|locus:2038026 352 AT1G33030 [Arabidopsis thalian 0.657 0.332 0.378 3.9e-22
TAIR|locus:2015223 381 AT1G63140 [Arabidopsis thalian 0.814 0.380 0.368 7.7e-20
UNIPROTKB|A8QW52 376 EOMT "Eugenol O-methyltransfer 0.691 0.327 0.346 3.7e-19
TAIR|locus:2204695 381 AT1G77530 [Arabidopsis thalian 0.865 0.404 0.335 4.9e-19
TAIR|locus:2204680 381 AT1G77520 [Arabidopsis thalian 0.865 0.404 0.341 2.4e-18
TAIR|locus:2034016 363 AT1G51990 [Arabidopsis thalian 0.668 0.327 0.411 1.2e-17
UNIPROTKB|P93324 372 P93324 "Isoliquiritigenin 2'-O 0.837 0.400 0.335 1.4e-16
TAIR|locus:2153423 OMT1 "AT5G54160" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 319 (117.4 bits), Expect = 5.7e-36, Sum P(2) = 5.7e-36
 Identities = 62/121 (51%), Positives = 82/121 (67%)

Query:    47 VQRLYGLAPVSKYFVPNEEGVSLAPTLLIIQDKVNMDSWSCVKDALLEGLVPFMKAHNGM 106
             V+R+YGL PV KY   NE+GVS+A   L+ QDKV M+SW  +KDA+L+G +PF KA+ GM
Sbjct:   100 VERIYGLGPVCKYLTKNEDGVSIAALCLMNQDKVLMESWYHLKDAILDGGIPFNKAY-GM 158

Query:   107 DGFAVAAKDEKINNLFNQSMHNHTTIVMKEILETYKGFERLNQFVDVADGLGENKNILLT 166
               F     D + N +FN  M NH+TI MK+ILETYKGFE L   VDV  G+G    ++++
Sbjct:   159 SAFEYHGTDPRFNKVFNNGMSNHSTITMKKILETYKGFEGLTSLVDVGGGIGATLKMIVS 218

Query:   167 K 167
             K
Sbjct:   219 K 219


GO:0030744 "luteolin O-methyltransferase activity" evidence=IDA
GO:0030755 "quercetin 3-O-methyltransferase activity" evidence=IDA
GO:0033799 "myricetin 3'-O-methyltransferase activity" evidence=IDA
GO:0047763 "caffeate O-methyltransferase activity" evidence=ISS;IMP
GO:0051555 "flavonol biosynthetic process" evidence=IDA
GO:0009809 "lignin biosynthetic process" evidence=IMP
GO:0005634 "nucleus" evidence=IDA
GO:0005737 "cytoplasm" evidence=IDA
GO:0005886 "plasma membrane" evidence=IDA
GO:0009506 "plasmodesma" evidence=IDA
GO:0006598 "polyamine catabolic process" evidence=RCA
GO:0009611 "response to wounding" evidence=RCA
GO:0009698 "phenylpropanoid metabolic process" evidence=RCA
GO:0009805 "coumarin biosynthetic process" evidence=RCA
GO:0009963 "positive regulation of flavonoid biosynthetic process" evidence=RCA
GO:0016126 "sterol biosynthetic process" evidence=RCA
GO:0042398 "cellular modified amino acid biosynthetic process" evidence=RCA
GO:0005829 "cytosol" evidence=TAS
UNIPROTKB|Q84N28 OMT1 "Flavone O-methyltransferase 1" [Triticum aestivum (taxid:4565)] Back     alignment and assigned GO terms
UNIPROTKB|Q6ZD89 ROMT-9 "Flavone 3'-O-methyltransferase 1" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
TAIR|locus:2038026 AT1G33030 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2015223 AT1G63140 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|A8QW52 EOMT "Eugenol O-methyltransferase" [Sorghum bicolor (taxid:4558)] Back     alignment and assigned GO terms
TAIR|locus:2204695 AT1G77530 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2204680 AT1G77520 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2034016 AT1G51990 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|P93324 P93324 "Isoliquiritigenin 2'-O-methyltransferase" [Medicago sativa (taxid:3879)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer2.1.1LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
fgenesh2_kg.8__1313__AT5G54160.1
annotation not avaliable (363 aa)
(Arabidopsis lyrata)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query178
pfam00891 239 pfam00891, Methyltransf_2, O-methyltransferase 3e-31
>gnl|CDD|216177 pfam00891, Methyltransf_2, O-methyltransferase Back     alignment and domain information
 Score =  112 bits (282), Expect = 3e-31
 Identities = 48/111 (43%), Positives = 64/111 (57%), Gaps = 1/111 (0%)

Query: 48  QRLYGLAPVSKYFVPNEEGVSLAPTLLIIQDKVNMDSWSCVKDALLEGLVPFMKAHNGMD 107
              YGL P SK  V  E+  SLAP LL+  D   ++SW+ +KDA+ EG  PF +A  GM 
Sbjct: 4   GEDYGLTPASKLLVKGEDSPSLAPLLLMYADPTLLESWAHLKDAVREGGPPFERAF-GMP 62

Query: 108 GFAVAAKDEKINNLFNQSMHNHTTIVMKEILETYKGFERLNQFVDVADGLG 158
            F     D + N +FN++M  H+ +VMK+ILET   F  L+  VDV  G G
Sbjct: 63  FFEYLGADPEFNRVFNRAMAAHSRLVMKKILETAFDFSGLSSLVDVGGGTG 113


This family includes a range of O-methyltransferases. These enzymes utilise S-adenosyl methionine. Length = 239

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 178
PF00891 241 Methyltransf_2: O-methyltransferase; InterPro: IPR 99.93
KOG3178 342 consensus Hydroxyindole-O-methyltransferase and re 99.85
TIGR02716 306 C20_methyl_CrtF C-20 methyltransferase BchU. Membe 99.54
PRK06922 677 hypothetical protein; Provisional 97.82
PRK14103 255 trans-aconitate 2-methyltransferase; Provisional 97.33
PRK08287 187 cobalt-precorrin-6Y C(15)-methyltransferase; Valid 97.28
TIGR02469124 CbiT precorrin-6Y C5,15-methyltransferase (decarbo 97.1
PRK01683 258 trans-aconitate 2-methyltransferase; Provisional 97.03
TIGR02021 219 BchM-ChlM magnesium protoporphyrin O-methyltransfe 96.91
COG2813 300 RsmC 16S RNA G1207 methylase RsmC [Translation, ri 96.86
PRK15001 378 SAM-dependent 23S ribosomal RNA mG1835 methyltrans 96.78
COG4106 257 Tam Trans-aconitate methyltransferase [General fun 96.77
PRK00107 187 gidB 16S rRNA methyltransferase GidB; Reviewed 96.43
PRK00274 272 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 96.39
PF05175 170 MTS: Methyltransferase small domain; InterPro: IPR 96.26
PRK07402 196 precorrin-6B methylase; Provisional 96.24
PRK09489 342 rsmC 16S ribosomal RNA m2G1207 methyltransferase; 96.2
PF02353 273 CMAS: Mycolic acid cyclopropane synthetase; InterP 96.09
PRK00121 202 trmB tRNA (guanine-N(7)-)-methyltransferase; Revie 96.07
TIGR00755 253 ksgA dimethyladenosine transferase. Alternate name 96.03
PRK07580 230 Mg-protoporphyrin IX methyl transferase; Validated 96.02
TIGR00138 181 gidB 16S rRNA methyltransferase GidB. GidB (glucos 95.99
COG2230 283 Cfa Cyclopropane fatty acid synthase and related m 95.98
PRK11036 255 putative S-adenosyl-L-methionine-dependent methylt 95.96
TIGR02752 231 MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone me 95.94
PRK14121 390 tRNA (guanine-N(7)-)-methyltransferase; Provisiona 95.93
PRK10258 251 biotin biosynthesis protein BioC; Provisional 95.81
PRK11207 197 tellurite resistance protein TehB; Provisional 95.8
TIGR02072 240 BioC biotin biosynthesis protein BioC. This enzyme 95.76
PRK00216 239 ubiE ubiquinone/menaquinone biosynthesis methyltra 95.69
COG2242 187 CobL Precorrin-6B methylase 2 [Coenzyme metabolism 95.69
PRK04457 262 spermidine synthase; Provisional 95.58
TIGR03587 204 Pse_Me-ase pseudaminic acid biosynthesis-associate 95.57
PRK14896 258 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 95.56
PF13679141 Methyltransf_32: Methyltransferase domain 95.52
PRK15451 247 tRNA cmo(5)U34 methyltransferase; Provisional 95.43
PRK06202 232 hypothetical protein; Provisional 95.42
TIGR00438 188 rrmJ cell division protein FtsJ. 95.41
TIGR03534 251 RF_mod_PrmC protein-(glutamine-N5) methyltransfera 95.39
TIGR00740 239 methyltransferase, putative. A simple BLAST search 95.35
COG4123 248 Predicted O-methyltransferase [General function pr 95.18
TIGR01934 223 MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis 95.17
PRK15068 322 tRNA mo(5)U34 methyltransferase; Provisional 95.13
COG2226 238 UbiE Methylase involved in ubiquinone/menaquinone 95.08
TIGR00477 195 tehB tellurite resistance protein TehB. Part of a 95.05
PLN02244 340 tocopherol O-methyltransferase 95.01
TIGR03704 251 PrmC_rel_meth putative protein-(glutamine-N5) meth 95.0
TIGR03533 284 L3_gln_methyl protein-(glutamine-N5) methyltransfe 94.99
TIGR00080 215 pimt protein-L-isoaspartate(D-aspartate) O-methylt 94.97
PRK09328 275 N5-glutamine S-adenosyl-L-methionine-dependent met 94.95
PRK11805 307 N5-glutamine S-adenosyl-L-methionine-dependent met 94.9
PF13489 161 Methyltransf_23: Methyltransferase domain; PDB: 3J 94.86
PTZ00098 263 phosphoethanolamine N-methyltransferase; Provision 94.8
PRK04266 226 fibrillarin; Provisional 94.69
PF05148 219 Methyltransf_8: Hypothetical methyltransferase; In 94.62
TIGR00452 314 methyltransferase, putative. Known examples to dat 94.62
COG4976 287 Predicted methyltransferase (contains TPR repeat) 94.6
COG0220 227 Predicted S-adenosylmethionine-dependent methyltra 94.5
PRK11705 383 cyclopropane fatty acyl phospholipid synthase; Pro 94.47
PTZ00338 294 dimethyladenosine transferase-like protein; Provis 94.46
TIGR00536 284 hemK_fam HemK family putative methylases. The gene 94.43
PLN02336 475 phosphoethanolamine N-methyltransferase 94.37
PRK14966 423 unknown domain/N5-glutamine S-adenosyl-L-methionin 94.36
PRK11188 209 rrmJ 23S rRNA methyltransferase J; Provisional 94.32
KOG3115 249 consensus Methyltransferase-like protein [General 94.26
PRK11088 272 rrmA 23S rRNA methyltransferase A; Provisional 94.13
PRK01544 506 bifunctional N5-glutamine S-adenosyl-L-methionine- 94.09
COG2890 280 HemK Methylase of polypeptide chain release factor 94.09
PLN02336 475 phosphoethanolamine N-methyltransferase 94.0
PLN02490 340 MPBQ/MSBQ methyltransferase 93.97
PF05185 448 PRMT5: PRMT5 arginine-N-methyltransferase; InterPr 93.89
PRK13944 205 protein-L-isoaspartate O-methyltransferase; Provis 93.84
COG2264 300 PrmA Ribosomal protein L11 methylase [Translation, 93.76
PRK12335 287 tellurite resistance protein TehB; Provisional 93.71
PLN02233 261 ubiquinone biosynthesis methyltransferase 93.68
smart00138 264 MeTrc Methyltransferase, chemotaxis proteins. Meth 93.59
PRK00377 198 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; 93.5
PF06325 295 PrmA: Ribosomal protein L11 methyltransferase (Prm 93.47
PRK13942 212 protein-L-isoaspartate O-methyltransferase; Provis 93.4
PRK05785 226 hypothetical protein; Provisional 93.32
PLN02366 308 spermidine synthase 93.13
TIGR03438 301 probable methyltransferase. This model represents 93.07
COG2227 243 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4- 93.02
TIGR00406288 prmA ribosomal protein L11 methyltransferase. Ribo 93.0
KOG2904 328 consensus Predicted methyltransferase [General fun 92.98
PRK00811 283 spermidine synthase; Provisional 92.57
PF07757112 AdoMet_MTase: Predicted AdoMet-dependent methyltra 92.49
PF03848 192 TehB: Tellurite resistance protein TehB; InterPro: 92.46
PRK05134 233 bifunctional 3-demethylubiquinone-9 3-methyltransf 92.38
PRK13168 443 rumA 23S rRNA m(5)U1939 methyltransferase; Reviewe 92.37
PHA03411 279 putative methyltransferase; Provisional 92.33
PRK00312 212 pcm protein-L-isoaspartate O-methyltransferase; Re 92.08
TIGR00478 228 tly hemolysin TlyA family protein. Hemolysins are 92.04
PRK00517250 prmA ribosomal protein L11 methyltransferase; Revi 91.88
PF01209 233 Ubie_methyltran: ubiE/COQ5 methyltransferase famil 91.8
PF08003 315 Methyltransf_9: Protein of unknown function (DUF16 91.8
PLN02396 322 hexaprenyldihydroxybenzoate methyltransferase 91.74
PRK01544 506 bifunctional N5-glutamine S-adenosyl-L-methionine- 91.56
PRK14967 223 putative methyltransferase; Provisional 91.41
PF00398 262 RrnaAD: Ribosomal RNA adenine dimethylase; InterPr 91.37
PRK13943 322 protein-L-isoaspartate O-methyltransferase; Provis 91.33
PLN02585 315 magnesium protoporphyrin IX methyltransferase 90.92
COG0030 259 KsgA Dimethyladenosine transferase (rRNA methylati 90.64
PRK01581 374 speE spermidine synthase; Validated 90.44
PLN02672 1082 methionine S-methyltransferase 90.25
KOG1500 517 consensus Protein arginine N-methyltransferase CAR 90.24
PRK11873 272 arsM arsenite S-adenosylmethyltransferase; Reviewe 90.18
KOG1271 227 consensus Methyltransferases [General function pre 90.07
KOG1270 282 consensus Methyltransferases [Coenzyme transport a 90.05
KOG1540 296 consensus Ubiquinone biosynthesis methyltransferas 89.86
PHA03412 241 putative methyltransferase; Provisional 89.81
TIGR01983 224 UbiG ubiquinone biosynthesis O-methyltransferase. 89.72
KOG3010 261 consensus Methyltransferase [General function pred 89.59
PF08123 205 DOT1: Histone methylation protein DOT1 ; InterPro: 89.52
TIGR00417 270 speE spermidine synthase. the SpeE subunit of sper 89.43
TIGR00479 431 rumA 23S rRNA (uracil-5-)-methyltransferase RumA. 89.22
PRK10901 427 16S rRNA methyltransferase B; Provisional 88.91
PF01135 209 PCMT: Protein-L-isoaspartate(D-aspartate) O-methyl 88.68
KOG1499 346 consensus Protein arginine N-methyltransferase PRM 88.66
PRK03522 315 rumB 23S rRNA methyluridine methyltransferase; Rev 88.61
TIGR03840 213 TMPT_Se_Te thiopurine S-methyltransferase, Se/Te d 88.44
PRK04148134 hypothetical protein; Provisional 87.72
PRK11727 321 23S rRNA mA1618 methyltransferase; Provisional 87.64
PRK14902 444 16S rRNA methyltransferase B; Provisional 87.45
TIGR02085 374 meth_trns_rumB 23S rRNA (uracil-5-)-methyltransfer 87.29
TIGR00095 189 RNA methyltransferase, RsmD family. This model rep 87.19
PRK13255 218 thiopurine S-methyltransferase; Reviewed 86.97
PLN03075 296 nicotianamine synthase; Provisional 86.73
COG0357 215 GidB Predicted S-adenosylmethionine-dependent meth 86.73
PRK03612 521 spermidine synthase; Provisional 86.63
COG2263 198 Predicted RNA methylase [Translation, ribosomal st 86.36
PF05219 265 DREV: DREV methyltransferase; InterPro: IPR007884 86.16
TIGR02143 353 trmA_only tRNA (uracil-5-)-methyltransferase. This 86.14
PF03141 506 Methyltransf_29: Putative S-adenosyl-L-methionine- 86.01
PRK10909 199 rsmD 16S rRNA m(2)G966-methyltransferase; Provisio 85.92
PF02527 184 GidB: rRNA small subunit methyltransferase G; Inte 85.65
COG2518 209 Pcm Protein-L-isoaspartate carboxylmethyltransfera 85.25
TIGR00563 426 rsmB ribosomal RNA small subunit methyltransferase 85.14
PF09243 274 Rsm22: Mitochondrial small ribosomal subunit Rsm22 84.84
TIGR01177 329 conserved hypothetical protein TIGR01177. This fam 84.68
PF12147 311 Methyltransf_20: Putative methyltransferase; Inter 84.6
KOG3045 325 consensus Predicted RNA methylase involved in rRNA 84.34
KOG2899 288 consensus Predicted methyltransferase [General fun 84.19
PRK05031 362 tRNA (uracil-5-)-methyltransferase; Validated 83.1
KOG1541 270 consensus Predicted protein carboxyl methylase [Ge 82.85
PF10294173 Methyltransf_16: Putative methyltransferase; Inter 82.14
KOG2651 476 consensus rRNA adenine N-6-methyltransferase [RNA 82.14
PTZ00146 293 fibrillarin; Provisional 81.2
>PF00891 Methyltransf_2: O-methyltransferase; InterPro: IPR001077 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
Probab=99.93  E-value=2.1e-25  Score=175.77  Aligned_cols=129  Identities=22%  Similarity=0.351  Sum_probs=114.0

Q ss_pred             CCCCceecchhccccCCCCCCCChHHHHHHhcChhhhhhhhhHHHHHhcCCcchhhhccCCchhhhhccChHHHHHHHHH
Q 037090           46 SVQRLYGLAPVSKYFVPNEEGVSLAPTLLIIQDKVNMDSWSCVKDALLEGLVPFMKAHNGMDGFAVAAKDEKINNLFNQS  125 (178)
Q Consensus        46 ~~~~~y~~t~~s~~L~~~~~~~~~~~~v~~~~~~~~~~~~~~L~~~l~~g~~~f~~a~~g~~~~e~~~~~p~~~~~F~~~  125 (178)
                      |++++|+||++|+.|+.+++..++..++.+...+..+++|.+|.+++++|.++|+.++ |.++|+|+.++|+..+.|+.+
T Consensus         1 ~~~~~y~~t~~s~~ll~~~~~~~~~~~~~~~~~~~~~~~~~~L~~~v~~g~~~~~~~~-g~~~~~~~~~~~~~~~~f~~~   79 (241)
T PF00891_consen    1 KEGDRYSLTPLSELLLSDHSSPSMRGFVLFMISPELYPAWFRLTEAVRTGKPPFEKAF-GTPFFEYLEEDPELAKRFNAA   79 (241)
T ss_dssp             SSTEEEEE-HHHHGGSTTTTTTHHHHHHHHHTCHHHHHGGGGHHHHHHHSS-HHHHHH-SS-HHHHHHCSHHHHHHHHHH
T ss_pred             CCCCEEeChHHHHHHhCCCCcCcHHHHHHHhcCHHHHHHHHHHHhhhccCCCHHHHhc-CCcHHHhhhhChHHHHHHHHH
Confidence            4678999999999887766423688888887788899999999999999999999999 888999999999999999999


Q ss_pred             HHhhhHHhH-HHHHHhcCCCCCCCeEEEecCCccHHHHHHHHhcCCCeEEEe
Q 037090          126 MHNHTTIVM-KEILETYKGFERLNQFVDVADGLGENKNILLTKISIISLNTI  176 (178)
Q Consensus       126 M~~~~~~~~-~~~~~~~~~~~~~~~vVDVGGg~G~~~~~i~~~~P~l~~~v~  176 (178)
                      |...+.... +.+++.+| |++.++|||||||+|+++.+++++||+++++|+
T Consensus        80 m~~~~~~~~~~~~~~~~d-~~~~~~vvDvGGG~G~~~~~l~~~~P~l~~~v~  130 (241)
T PF00891_consen   80 MAEYSRLNAFDILLEAFD-FSGFKTVVDVGGGSGHFAIALARAYPNLRATVF  130 (241)
T ss_dssp             HHHHHHHHHHHHHHHHST-TTTSSEEEEET-TTSHHHHHHHHHSTTSEEEEE
T ss_pred             HHhhhhcchhhhhhcccc-ccCccEEEeccCcchHHHHHHHHHCCCCcceee
Confidence            999998887 88899999 999999999999999999999999999999885



The reaction is catalysed by methyltransferases (Mtases) and modifies DNA, RNA, proteins and small molecules, such as catechol for regulatory purposes. The various aspects of the role of DNA methylation in prokaryotic restriction-modification systems and in a number of cellular processes in eukaryotes including gene regulation and differentiation is well documented. Three classes of DNA Mtases transfer the methyl group from AdoMet to the target base to form either N-6-methyladenine, or N-4-methylcytosine, or C-5- methylcytosine. In C-5-cytosine Mtases, ten conserved motifs are arranged in the same order []. Motif I (a glycine-rich or closely related consensus sequence; FAGxGG in M.HhaI []), shared by other AdoMet-Mtases [], is part of the cofactor binding site and motif IV (PCQ) is part of the catalytic site. In contrast, sequence comparison among N-6-adenine and N-4-cytosine Mtases indicated two of the conserved segments [], although more conserved segments may be present. One of them corresponds to motif I in C-5-cytosine Mtases, and the other is named (D/N/S)PP(Y/F). Crystal structures are known for a number of Mtases [, , , ]. The cofactor binding sites are almost identical and the essential catalytic amino acids coincide. The comparable protein folding and the existence of equivalent amino acids in similar secondary and tertiary positions indicate that many (if not all) AdoMet-Mtases have a common catalytic domain structure. This permits tertiary structure prediction of other DNA, RNA, protein, and small-molecule AdoMet-Mtases from their amino acid sequences []. This domain includes a range of O-methyltransferases some of which utilise S-adenosyl methionine as substrate []. In prokaryotes, the major role of DNA methylation is to protect host DNA against degradation by restriction enzymes. In eukaryotes, DNA methylation has been implicated in the control of several cellular processes, including differentiation, gene regulation, and embryonic development. O-methyltransferases have a common catalytic domain structure, which might be universal among S-adenosyl-L-methionine (AdoMet)-dependent methyltransferases []. Comparative analysis of the predicted amino acid sequences of a number of plant O-methyltransferase cDNA clones show that they share some 32-71% sequence identity, and can be grouped according to the different compounds they utilise as substrates [].; GO: 0008171 O-methyltransferase activity; PDB: 1FPQ_A 1FP1_D 3P9K_B 3P9I_D 3P9C_A 3I53_A 3I5U_A 3I64_A 3I58_A 1ZG3_A ....

>KOG3178 consensus Hydroxyindole-O-methyltransferase and related SAM-dependent methyltransferases [General function prediction only] Back     alignment and domain information
>TIGR02716 C20_methyl_CrtF C-20 methyltransferase BchU Back     alignment and domain information
>PRK06922 hypothetical protein; Provisional Back     alignment and domain information
>PRK14103 trans-aconitate 2-methyltransferase; Provisional Back     alignment and domain information
>PRK08287 cobalt-precorrin-6Y C(15)-methyltransferase; Validated Back     alignment and domain information
>TIGR02469 CbiT precorrin-6Y C5,15-methyltransferase (decarboxylating), CbiT subunit Back     alignment and domain information
>PRK01683 trans-aconitate 2-methyltransferase; Provisional Back     alignment and domain information
>TIGR02021 BchM-ChlM magnesium protoporphyrin O-methyltransferase Back     alignment and domain information
>COG2813 RsmC 16S RNA G1207 methylase RsmC [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK15001 SAM-dependent 23S ribosomal RNA mG1835 methyltransferase; Provisional Back     alignment and domain information
>COG4106 Tam Trans-aconitate methyltransferase [General function prediction only] Back     alignment and domain information
>PRK00107 gidB 16S rRNA methyltransferase GidB; Reviewed Back     alignment and domain information
>PRK00274 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 family protein; Reviewed Back     alignment and domain information
>PF05175 MTS: Methyltransferase small domain; InterPro: IPR007848 This domain is found in ribosomal RNA small subunit methyltransferase C and in other methyltransferases Back     alignment and domain information
>PRK07402 precorrin-6B methylase; Provisional Back     alignment and domain information
>PRK09489 rsmC 16S ribosomal RNA m2G1207 methyltransferase; Provisional Back     alignment and domain information
>PF02353 CMAS: Mycolic acid cyclopropane synthetase; InterPro: IPR003333 This entry represents mycolic acid cyclopropane synthases and related enzymes, including CmaA1, CmaA2 (cyclopropane mycolic acid synthase A1 and A2) and MmaA1-4 (methoxymycolic acid synthase A1-4) Back     alignment and domain information
>PRK00121 trmB tRNA (guanine-N(7)-)-methyltransferase; Reviewed Back     alignment and domain information
>TIGR00755 ksgA dimethyladenosine transferase Back     alignment and domain information
>PRK07580 Mg-protoporphyrin IX methyl transferase; Validated Back     alignment and domain information
>TIGR00138 gidB 16S rRNA methyltransferase GidB Back     alignment and domain information
>COG2230 Cfa Cyclopropane fatty acid synthase and related methyltransferases [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK11036 putative S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>TIGR02752 MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone methyltransferase Back     alignment and domain information
>PRK14121 tRNA (guanine-N(7)-)-methyltransferase; Provisional Back     alignment and domain information
>PRK10258 biotin biosynthesis protein BioC; Provisional Back     alignment and domain information
>PRK11207 tellurite resistance protein TehB; Provisional Back     alignment and domain information
>TIGR02072 BioC biotin biosynthesis protein BioC Back     alignment and domain information
>PRK00216 ubiE ubiquinone/menaquinone biosynthesis methyltransferase; Reviewed Back     alignment and domain information
>COG2242 CobL Precorrin-6B methylase 2 [Coenzyme metabolism] Back     alignment and domain information
>PRK04457 spermidine synthase; Provisional Back     alignment and domain information
>TIGR03587 Pse_Me-ase pseudaminic acid biosynthesis-associated methylase Back     alignment and domain information
>PRK14896 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 family protein; Provisional Back     alignment and domain information
>PF13679 Methyltransf_32: Methyltransferase domain Back     alignment and domain information
>PRK15451 tRNA cmo(5)U34 methyltransferase; Provisional Back     alignment and domain information
>PRK06202 hypothetical protein; Provisional Back     alignment and domain information
>TIGR00438 rrmJ cell division protein FtsJ Back     alignment and domain information
>TIGR03534 RF_mod_PrmC protein-(glutamine-N5) methyltransferase, release factor-specific Back     alignment and domain information
>TIGR00740 methyltransferase, putative Back     alignment and domain information
>COG4123 Predicted O-methyltransferase [General function prediction only] Back     alignment and domain information
>TIGR01934 MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis methyltransferases Back     alignment and domain information
>PRK15068 tRNA mo(5)U34 methyltransferase; Provisional Back     alignment and domain information
>COG2226 UbiE Methylase involved in ubiquinone/menaquinone biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>TIGR00477 tehB tellurite resistance protein TehB Back     alignment and domain information
>PLN02244 tocopherol O-methyltransferase Back     alignment and domain information
>TIGR03704 PrmC_rel_meth putative protein-(glutamine-N5) methyltransferase, unknown substrate-specific Back     alignment and domain information
>TIGR03533 L3_gln_methyl protein-(glutamine-N5) methyltransferase, ribosomal protein L3-specific Back     alignment and domain information
>TIGR00080 pimt protein-L-isoaspartate(D-aspartate) O-methyltransferase Back     alignment and domain information
>PRK09328 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>PRK11805 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>PF13489 Methyltransf_23: Methyltransferase domain; PDB: 3JWJ_A 3JWH_B 2AOV_B 2AOT_A 1JQD_B 2AOX_A 1JQE_A 2AOU_B 2AOW_A 3DLI_C Back     alignment and domain information
>PTZ00098 phosphoethanolamine N-methyltransferase; Provisional Back     alignment and domain information
>PRK04266 fibrillarin; Provisional Back     alignment and domain information
>PF05148 Methyltransf_8: Hypothetical methyltransferase; InterPro: IPR007823 This family consists of uncharacterised eukaryotic proteins which are related to S-adenosyl-L-methionine-dependent methyltransferases Back     alignment and domain information
>TIGR00452 methyltransferase, putative Back     alignment and domain information
>COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only] Back     alignment and domain information
>COG0220 Predicted S-adenosylmethionine-dependent methyltransferase [General function prediction only] Back     alignment and domain information
>PRK11705 cyclopropane fatty acyl phospholipid synthase; Provisional Back     alignment and domain information
>PTZ00338 dimethyladenosine transferase-like protein; Provisional Back     alignment and domain information
>TIGR00536 hemK_fam HemK family putative methylases Back     alignment and domain information
>PLN02336 phosphoethanolamine N-methyltransferase Back     alignment and domain information
>PRK14966 unknown domain/N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase fusion protein; Provisional Back     alignment and domain information
>PRK11188 rrmJ 23S rRNA methyltransferase J; Provisional Back     alignment and domain information
>KOG3115 consensus Methyltransferase-like protein [General function prediction only] Back     alignment and domain information
>PRK11088 rrmA 23S rRNA methyltransferase A; Provisional Back     alignment and domain information
>PRK01544 bifunctional N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase/tRNA (m7G46) methyltransferase; Reviewed Back     alignment and domain information
>COG2890 HemK Methylase of polypeptide chain release factors [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PLN02336 phosphoethanolamine N-methyltransferase Back     alignment and domain information
>PLN02490 MPBQ/MSBQ methyltransferase Back     alignment and domain information
>PF05185 PRMT5: PRMT5 arginine-N-methyltransferase; InterPro: IPR007857 The human homologue of Saccharomyces cerevisiae Skb1 (Shk1 kinase-binding protein 1) is a protein methyltransferase [] Back     alignment and domain information
>PRK13944 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>COG2264 PrmA Ribosomal protein L11 methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK12335 tellurite resistance protein TehB; Provisional Back     alignment and domain information
>PLN02233 ubiquinone biosynthesis methyltransferase Back     alignment and domain information
>smart00138 MeTrc Methyltransferase, chemotaxis proteins Back     alignment and domain information
>PRK00377 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; Provisional Back     alignment and domain information
>PF06325 PrmA: Ribosomal protein L11 methyltransferase (PrmA); InterPro: IPR010456 This family consists of several Ribosomal protein L11 methyltransferase sequences Back     alignment and domain information
>PRK13942 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>PRK05785 hypothetical protein; Provisional Back     alignment and domain information
>PLN02366 spermidine synthase Back     alignment and domain information
>TIGR03438 probable methyltransferase Back     alignment and domain information
>COG2227 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase [Coenzyme metabolism] Back     alignment and domain information
>TIGR00406 prmA ribosomal protein L11 methyltransferase Back     alignment and domain information
>KOG2904 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>PRK00811 spermidine synthase; Provisional Back     alignment and domain information
>PF07757 AdoMet_MTase: Predicted AdoMet-dependent methyltransferase; InterPro: IPR011671 tRNA (uracil-O(2)-)-methyltransferase catalyses the formation of O(2)-methyl-uracil at position 44 (m2U44) in tRNA(Ser) [] Back     alignment and domain information
>PF03848 TehB: Tellurite resistance protein TehB; InterPro: IPR015985 Tellurite resistance protein TehB is part of a tellurite-reducing operon tehA and tehB Back     alignment and domain information
>PRK05134 bifunctional 3-demethylubiquinone-9 3-methyltransferase/ 2-octaprenyl-6-hydroxy phenol methylase; Provisional Back     alignment and domain information
>PRK13168 rumA 23S rRNA m(5)U1939 methyltransferase; Reviewed Back     alignment and domain information
>PHA03411 putative methyltransferase; Provisional Back     alignment and domain information
>PRK00312 pcm protein-L-isoaspartate O-methyltransferase; Reviewed Back     alignment and domain information
>TIGR00478 tly hemolysin TlyA family protein Back     alignment and domain information
>PRK00517 prmA ribosomal protein L11 methyltransferase; Reviewed Back     alignment and domain information
>PF01209 Ubie_methyltran: ubiE/COQ5 methyltransferase family; InterPro: IPR004033 A number of methyltransferases have been shown to share regions of similarities [] Back     alignment and domain information
>PF08003 Methyltransf_9: Protein of unknown function (DUF1698); InterPro: IPR010017 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>PLN02396 hexaprenyldihydroxybenzoate methyltransferase Back     alignment and domain information
>PRK01544 bifunctional N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase/tRNA (m7G46) methyltransferase; Reviewed Back     alignment and domain information
>PRK14967 putative methyltransferase; Provisional Back     alignment and domain information
>PF00398 RrnaAD: Ribosomal RNA adenine dimethylase; InterPro: IPR001737 This family of proteins include rRNA adenine dimethylases (e Back     alignment and domain information
>PRK13943 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>PLN02585 magnesium protoporphyrin IX methyltransferase Back     alignment and domain information
>COG0030 KsgA Dimethyladenosine transferase (rRNA methylation) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK01581 speE spermidine synthase; Validated Back     alignment and domain information
>PLN02672 methionine S-methyltransferase Back     alignment and domain information
>KOG1500 consensus Protein arginine N-methyltransferase CARM1 [Posttranslational modification, protein turnover, chaperones; Transcription] Back     alignment and domain information
>PRK11873 arsM arsenite S-adenosylmethyltransferase; Reviewed Back     alignment and domain information
>KOG1271 consensus Methyltransferases [General function prediction only] Back     alignment and domain information
>KOG1270 consensus Methyltransferases [Coenzyme transport and metabolism] Back     alignment and domain information
>KOG1540 consensus Ubiquinone biosynthesis methyltransferase COQ5 [Coenzyme transport and metabolism] Back     alignment and domain information
>PHA03412 putative methyltransferase; Provisional Back     alignment and domain information
>TIGR01983 UbiG ubiquinone biosynthesis O-methyltransferase Back     alignment and domain information
>KOG3010 consensus Methyltransferase [General function prediction only] Back     alignment and domain information
>PF08123 DOT1: Histone methylation protein DOT1 ; InterPro: IPR013110 The DOT1 domain regulates gene expression by methylating histone H3 [] Back     alignment and domain information
>TIGR00417 speE spermidine synthase Back     alignment and domain information
>TIGR00479 rumA 23S rRNA (uracil-5-)-methyltransferase RumA Back     alignment and domain information
>PRK10901 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>PF01135 PCMT: Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT); InterPro: IPR000682 Protein-L-isoaspartate(D-aspartate) O-methyltransferase (2 Back     alignment and domain information
>KOG1499 consensus Protein arginine N-methyltransferase PRMT1 and related enzymes [Posttranslational modification, protein turnover, chaperones; Transcription; Signal transduction mechanisms] Back     alignment and domain information
>PRK03522 rumB 23S rRNA methyluridine methyltransferase; Reviewed Back     alignment and domain information
>TIGR03840 TMPT_Se_Te thiopurine S-methyltransferase, Se/Te detoxification family Back     alignment and domain information
>PRK04148 hypothetical protein; Provisional Back     alignment and domain information
>PRK11727 23S rRNA mA1618 methyltransferase; Provisional Back     alignment and domain information
>PRK14902 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>TIGR02085 meth_trns_rumB 23S rRNA (uracil-5-)-methyltransferase RumB Back     alignment and domain information
>TIGR00095 RNA methyltransferase, RsmD family Back     alignment and domain information
>PRK13255 thiopurine S-methyltransferase; Reviewed Back     alignment and domain information
>PLN03075 nicotianamine synthase; Provisional Back     alignment and domain information
>COG0357 GidB Predicted S-adenosylmethionine-dependent methyltransferase involved in bacterial cell division [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK03612 spermidine synthase; Provisional Back     alignment and domain information
>COG2263 Predicted RNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF05219 DREV: DREV methyltransferase; InterPro: IPR007884 This family contains DREV protein homologues from several eukaryotes Back     alignment and domain information
>TIGR02143 trmA_only tRNA (uracil-5-)-methyltransferase Back     alignment and domain information
>PF03141 Methyltransf_29: Putative S-adenosyl-L-methionine-dependent methyltransferase; InterPro: IPR004159 Members of this family of hypothetical plant proteins are putative methyltransferases Back     alignment and domain information
>PRK10909 rsmD 16S rRNA m(2)G966-methyltransferase; Provisional Back     alignment and domain information
>PF02527 GidB: rRNA small subunit methyltransferase G; InterPro: IPR003682 This entry represents a rRNA small subunit methyltransferase G Back     alignment and domain information
>COG2518 Pcm Protein-L-isoaspartate carboxylmethyltransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00563 rsmB ribosomal RNA small subunit methyltransferase RsmB Back     alignment and domain information
>PF09243 Rsm22: Mitochondrial small ribosomal subunit Rsm22; InterPro: IPR015324 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>TIGR01177 conserved hypothetical protein TIGR01177 Back     alignment and domain information
>PF12147 Methyltransf_20: Putative methyltransferase; InterPro: IPR022744 This C-terminal region is found in bacteria and eukaryotes and is approximately 110 amino acids in length Back     alignment and domain information
>KOG3045 consensus Predicted RNA methylase involved in rRNA processing [RNA processing and modification] Back     alignment and domain information
>KOG2899 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>PRK05031 tRNA (uracil-5-)-methyltransferase; Validated Back     alignment and domain information
>KOG1541 consensus Predicted protein carboxyl methylase [General function prediction only] Back     alignment and domain information
>PF10294 Methyltransf_16: Putative methyltransferase; InterPro: IPR019410 There are a number of unidentified genes that have a high probability of coding for methyltransferases Back     alignment and domain information
>KOG2651 consensus rRNA adenine N-6-methyltransferase [RNA processing and modification] Back     alignment and domain information
>PTZ00146 fibrillarin; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query178
3reo_A 368 Monolignol O-Methyltransferase (Momt) Length = 368 2e-31
1kyw_A 365 Crystal Structure Analysis Of Caffeic Acid5-Hydroxy 7e-31
3p9c_A 364 Crystal Structure Of Perennial Ryegrass Lpomt1 Boun 1e-28
1fp1_D 372 Crystal Structure Analysis Of Chalcone O-Methyltran 1e-16
1fpq_A 372 Crystal Structure Analysis Of Selenomethionine Subs 1e-14
>pdb|3REO|A Chain A, Monolignol O-Methyltransferase (Momt) Length = 368 Back     alignment and structure

Iteration: 1

Score = 131 bits (330), Expect = 2e-31, Method: Compositional matrix adjust. Identities = 83/225 (36%), Positives = 114/225 (50%), Gaps = 60/225 (26%) Query: 9 QVMMKPARDEQDFLLAMELASGTILPMTIKSAIE-------------------------- 42 Q++ + DE+ L AM+LAS +LPM +K+AIE Sbjct: 10 QIIPTHSSDEEANLFAMQLASAAVLPMALKAAIELDVLEIMAKSVPPSGYISPAEIAAQL 69 Query: 43 ----------LDR---------------------SVQRLYGLAPVSKYFVPNEEGVSLAP 71 LDR V+RLYGLAPV K+ NE+GVSLAP Sbjct: 70 PTTNPEAPVMLDRVLRLLASYSVVTYTLRELPSGKVERLYGLAPVCKFLTKNEDGVSLAP 129 Query: 72 TLLIIQDKVNMDSWSCVKDALLEGLVPFMKAHNGMDGFAVAAKDEKINNLFNQSMHNHTT 131 LL+ DKV ++ W +KDA+LEG +PF KA+ GM+ F D +IN +FN+ M +++T Sbjct: 130 FLLLATDKVLLEPWFYLKDAILEGGIPFNKAY-GMNIFDYHGTDHRINKVFNKGMSSNST 188 Query: 132 IVMKEILETYKGFERLNQFVDVADGLGENKNILLTKISIISLNTI 176 I MK+ILE Y GFE L VDV G G ++++ K S+N I Sbjct: 189 ITMKKILEMYNGFEGLTTIVDVGGGTGAVASMIVAKYP--SINAI 231
>pdb|1KYW|A Chain A, Crystal Structure Analysis Of Caffeic Acid5-Hydroxyferulic Acid 35-O-Methyltransferase In Complex With 5- Hydroxyconiferaldehyde Length = 365 Back     alignment and structure
>pdb|3P9C|A Chain A, Crystal Structure Of Perennial Ryegrass Lpomt1 Bound To Sah Length = 364 Back     alignment and structure
>pdb|1FP1|D Chain D, Crystal Structure Analysis Of Chalcone O-Methyltransferase Length = 372 Back     alignment and structure
>pdb|1FPQ|A Chain A, Crystal Structure Analysis Of Selenomethionine Substituted Chalcone O- Methyltransferase Length = 372 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query178
3reo_A 368 (ISO)eugenol O-methyltransferase; directed evoluti 5e-35
3p9c_A 364 Caffeic acid O-methyltransferase; S-adenosylmethio 9e-31
3p9c_A 364 Caffeic acid O-methyltransferase; S-adenosylmethio 2e-04
3lst_A 348 CALO1 methyltransferase; calicheamicin, enediyne, 6e-29
3gwz_A 369 MMCR; methyltransferase, mitomycin, S-adenosyl met 6e-28
1fp2_A 352 Isoflavone O-methyltransferase; protein-product co 8e-28
1qzz_A 374 RDMB, aclacinomycin-10-hydroxylase; anthracycline, 8e-28
1tw3_A 360 COMT, carminomycin 4-O-methyltransferase; anthracy 1e-27
3i53_A 332 O-methyltransferase; CO-complex, rossmann-like fol 7e-27
1fp1_D 372 Isoliquiritigenin 2'-O-methyltransferase; protein- 2e-26
1fp1_D 372 Isoliquiritigenin 2'-O-methyltransferase; protein- 9e-04
1zg3_A 358 Isoflavanone 4'-O-methyltransferase; rossman fold, 5e-26
2ip2_A 334 Probable phenazine-specific methyltransferase; pyo 5e-21
3dp7_A 363 SAM-dependent methyltransferase; structural genomi 2e-16
2r3s_A 335 Uncharacterized protein; methyltransferase domain, 2e-15
1x19_A 359 CRTF-related protein; methyltransferase, bacterioc 4e-15
3mcz_A 352 O-methyltransferase; adomet_mtases, S-adenosylmeth 6e-14
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-05
>3reo_A (ISO)eugenol O-methyltransferase; directed evolution, saturation mutagenesis, regioselectivity transferase; HET: SAH EUG; 1.90A {Clarkia breweri} PDB: 1kyz_A* 1kyw_A* Length = 368 Back     alignment and structure
 Score =  124 bits (314), Expect = 5e-35
 Identities = 78/223 (34%), Positives = 111/223 (49%), Gaps = 58/223 (26%)

Query: 2   SSLQDDHQVMMKPARDEQDFLLAMELASGTILPMTIKSAIELD----------------- 44
           S+   + Q++   + DE+  L AM+LAS  +LPM +K+AIELD                 
Sbjct: 3   STGNAEIQIIPTHSSDEEANLFAMQLASAAVLPMALKAAIELDVLEIMAKSVPPSGYISP 62

Query: 45  ---------------RSVQRL-------------------------YGLAPVSKYFVPNE 64
                            + R+                         YGLAPV K+   NE
Sbjct: 63  AEIAAQLPTTNPEAPVMLDRVLRLLASYSVVTYTLRELPSGKVERLYGLAPVCKFLTKNE 122

Query: 65  EGVSLAPTLLIIQDKVNMDSWSCVKDALLEGLVPFMKAHNGMDGFAVAAKDEKINNLFNQ 124
           +GVSLAP LL+  DKV ++ W  +KDA+LEG +PF KA+ GM+ F     D +IN +FN+
Sbjct: 123 DGVSLAPFLLLATDKVLLEPWFYLKDAILEGGIPFNKAY-GMNIFDYHGTDHRINKVFNK 181

Query: 125 SMHNHTTIVMKEILETYKGFERLNQFVDVADGLGENKNILLTK 167
            M +++TI MK+ILE Y GFE L   VDV  G G   ++++ K
Sbjct: 182 GMSSNSTITMKKILEMYNGFEGLTTIVDVGGGTGAVASMIVAK 224


>3p9c_A Caffeic acid O-methyltransferase; S-adenosylmethionine dependent O-methyltransferase; HET: SAH; 1.80A {Lolium perenne} PDB: 3p9i_A* 3p9k_A* Length = 364 Back     alignment and structure
>3p9c_A Caffeic acid O-methyltransferase; S-adenosylmethionine dependent O-methyltransferase; HET: SAH; 1.80A {Lolium perenne} PDB: 3p9i_A* 3p9k_A* Length = 364 Back     alignment and structure
>3lst_A CALO1 methyltransferase; calicheamicin, enediyne, SAH, STRU genomics, PSI-2, protein structure initiative; HET: SAH; 2.40A {Micromonospora echinospora} Length = 348 Back     alignment and structure
>3gwz_A MMCR; methyltransferase, mitomycin, S-adenosyl methionine, transferase; HET: MSE SAH; 1.91A {Streptomyces lavendulae} PDB: 3gxo_A* Length = 369 Back     alignment and structure
>1fp2_A Isoflavone O-methyltransferase; protein-product complex; HET: SAH HMO; 1.40A {Medicago sativa} SCOP: a.4.5.29 c.66.1.12 PDB: 1fpx_A* 2qyo_A* Length = 352 Back     alignment and structure
>1qzz_A RDMB, aclacinomycin-10-hydroxylase; anthracycline, methyltransferase, polyketide, tailoring enzymes, structural proteomics in E spine; HET: SAM; 2.10A {Streptomyces purpurascens} SCOP: a.4.5.29 c.66.1.12 PDB: 1r00_A* 1xds_A* 1xdu_A* Length = 374 Back     alignment and structure
>1tw3_A COMT, carminomycin 4-O-methyltransferase; anthracycline, methylate, tailoring enzyme, polyketide, S-adenosyl-L-homocystein; HET: SAH ERT; 2.35A {Streptomyces peucetius} SCOP: a.4.5.29 c.66.1.12 PDB: 1tw2_A* Length = 360 Back     alignment and structure
>3i53_A O-methyltransferase; CO-complex, rossmann-like fold; HET: SAH; 2.08A {Streptomyces carzinostaticus subsp} PDB: 3i58_A* 3i5u_A* 3i64_A* Length = 332 Back     alignment and structure
>1fp1_D Isoliquiritigenin 2'-O-methyltransferase; protein-substrate, protein-product complex; HET: SAH HCC; 1.82A {Medicago sativa} SCOP: a.4.5.29 c.66.1.12 PDB: 1fpq_A* Length = 372 Back     alignment and structure
>1fp1_D Isoliquiritigenin 2'-O-methyltransferase; protein-substrate, protein-product complex; HET: SAH HCC; 1.82A {Medicago sativa} SCOP: a.4.5.29 c.66.1.12 PDB: 1fpq_A* Length = 372 Back     alignment and structure
>1zg3_A Isoflavanone 4'-O-methyltransferase; rossman fold, plant Pro transferase; HET: 2HI SAH; 2.35A {Medicago truncatula} PDB: 1zga_A* 1zhf_A* 1zgj_A* Length = 358 Back     alignment and structure
>2ip2_A Probable phenazine-specific methyltransferase; pyocyanin, phenazine-1-carboxy PHZM; 1.80A {Pseudomonas aeruginosa} Length = 334 Back     alignment and structure
>3dp7_A SAM-dependent methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research; 2.33A {Bacteroides vulgatus} Length = 363 Back     alignment and structure
>2r3s_A Uncharacterized protein; methyltransferase domain, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE; 2.15A {Nostoc punctiforme} Length = 335 Back     alignment and structure
>1x19_A CRTF-related protein; methyltransferase, bacteriochllochlorophyll, BCHU, SAM, SAH, adenosylmethyonine, S-adenosylhomocysteine, ADO-Met; 2.27A {Chlorobium tepidum} PDB: 1x1a_A* 1x1b_A* 1x1c_A* 1x1d_A* Length = 359 Back     alignment and structure
>3mcz_A O-methyltransferase; adomet_mtases, S-adenosylmethionine-dependent methyltransfer structural genomics, PSI-2; HET: MSE; 1.90A {Burkholderia thailandensis} Length = 352 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query178
4a6d_A 353 Hydroxyindole O-methyltransferase; melatonin, circ 99.94
3p9c_A 364 Caffeic acid O-methyltransferase; S-adenosylmethio 99.93
3lst_A 348 CALO1 methyltransferase; calicheamicin, enediyne, 99.93
3reo_A 368 (ISO)eugenol O-methyltransferase; directed evoluti 99.92
3gwz_A 369 MMCR; methyltransferase, mitomycin, S-adenosyl met 99.91
2ip2_A 334 Probable phenazine-specific methyltransferase; pyo 99.9
1fp2_A 352 Isoflavone O-methyltransferase; protein-product co 99.9
1zg3_A 358 Isoflavanone 4'-O-methyltransferase; rossman fold, 99.9
3i53_A 332 O-methyltransferase; CO-complex, rossmann-like fol 99.9
1fp1_D 372 Isoliquiritigenin 2'-O-methyltransferase; protein- 99.88
1qzz_A 374 RDMB, aclacinomycin-10-hydroxylase; anthracycline, 99.87
1tw3_A 360 COMT, carminomycin 4-O-methyltransferase; anthracy 99.85
3dp7_A 363 SAM-dependent methyltransferase; structural genomi 99.83
1x19_A 359 CRTF-related protein; methyltransferase, bacterioc 99.8
2r3s_A 335 Uncharacterized protein; methyltransferase domain, 99.8
3mcz_A 352 O-methyltransferase; adomet_mtases, S-adenosylmeth 99.75
1ve3_A 227 Hypothetical protein PH0226; dimer, riken structur 97.34
1jg1_A 235 PIMT;, protein-L-isoaspartate O-methyltransferase; 96.99
3dtn_A 234 Putative methyltransferase MM_2633; structural gen 96.95
3e05_A 204 Precorrin-6Y C5,15-methyltransferase (decarboxyla; 96.91
3vc1_A 312 Geranyl diphosphate 2-C-methyltransferase; rossman 96.76
1yb2_A 275 Hypothetical protein TA0852; structural genomics, 96.75
1jsx_A 207 Glucose-inhibited division protein B; methyltransf 96.71
4dzr_A 215 Protein-(glutamine-N5) methyltransferase, release 96.62
3hem_A 302 Cyclopropane-fatty-acyl-phospholipid synthase 2; p 96.6
3mb5_A 255 SAM-dependent methyltransferase; RNA methyltransfe 96.59
2p35_A 259 Trans-aconitate 2-methyltransferase; SAM dependent 96.58
2fca_A 213 TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bac 96.58
3bkx_A 275 SAM-dependent methyltransferase; YP_807781.1, cycl 96.58
3dlc_A 219 Putative S-adenosyl-L-methionine-dependent methylt 96.57
1yzh_A 214 TRNA (guanine-N(7)-)-methyltransferase; alpha-beta 96.56
3jwh_A 217 HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena 96.56
3dli_A 240 Methyltransferase; PSI-II, NYSGXRC, structural gen 96.54
1vl5_A 260 Unknown conserved protein BH2331; putative methylt 96.48
3dh0_A 219 SAM dependent methyltransferase; cystal structure, 96.47
2qe6_A 274 Uncharacterized protein TFU_2867; putative methylt 96.44
3bus_A 273 REBM, methyltransferase; rebeccamycin synthesis; H 96.43
3dxy_A 218 TRNA (guanine-N(7)-)-methyltransferase; rossmann f 96.43
3bkw_A 243 MLL3908 protein, S-adenosylmethionine dependent me 96.37
3mgg_A 276 Methyltransferase; NYSGXRC, PSI-II, protein struct 96.31
3jwg_A 219 HEN1, methyltransferase type 12; 1.90A {Clostridiu 96.31
3g5l_A 253 Putative S-adenosylmethionine dependent methyltran 96.3
1nkv_A 256 Hypothetical protein YJHP; structural genomics, PS 96.27
4gek_A 261 TRNA (CMO5U34)-methyltransferase; structural genom 96.24
1xtp_A 254 LMAJ004091AAA; SGPP, structural genomics, PSI, pro 96.23
4dcm_A 375 Ribosomal RNA large subunit methyltransferase G; 2 96.23
2pwy_A 258 TRNA (adenine-N(1)-)-methyltransferase; mtase, ado 96.23
3b3j_A 480 Histone-arginine methyltransferase CARM1; protein 96.22
3ckk_A 235 TRNA (guanine-N(7)-)-methyltransferase; mettl1, S- 96.22
3g5t_A 299 Trans-aconitate 3-methyltransferase; structural ge 96.19
3ou2_A 218 SAM-dependent methyltransferase; O-methyltransfera 96.18
1kpg_A 287 CFA synthase;, cyclopropane-fatty-acyl-phospholipi 96.17
3g07_A 292 7SK snRNA methylphosphate capping enzyme; structur 96.14
3pfg_A 263 N-methyltransferase; N,N-dimethyltransferase, SAM 96.13
2vdv_E 246 TRNA (guanine-N(7)-)-methyltransferase; S-adenosyl 96.12
3ujc_A 266 Phosphoethanolamine N-methyltransferase; parasite; 96.09
2o57_A 297 Putative sarcosine dimethylglycine methyltransfera 96.08
3f4k_A 257 Putative methyltransferase; structural genomics, P 96.08
3g89_A 249 Ribosomal RNA small subunit methyltransferase G; 1 96.07
3iv6_A 261 Putative Zn-dependent alcohol dehydrogenase; alpha 96.06
3fzg_A 200 16S rRNA methylase; methyltransferase, plasmid, tr 96.06
2yxd_A 183 Probable cobalt-precorrin-6Y C(15)-methyltransfer 96.0
1fbn_A 230 MJ fibrillarin homologue; MJ proteins, ribosomal R 95.99
2pjd_A 343 Ribosomal RNA small subunit methyltransferase C; g 95.99
1qam_A 244 ERMC' methyltransferase; rRNA methyltransferase ER 95.99
2fk8_A 318 Methoxy mycolic acid synthase 4; S-adenosylmethion 95.93
3cc8_A 230 Putative methyltransferase; structural genomics, j 95.92
2yxe_A 215 Protein-L-isoaspartate O-methyltransferase; rossma 95.88
1o54_A 277 SAM-dependent O-methyltransferase; TM0748, structu 95.86
2b3t_A 276 Protein methyltransferase HEMK; translation termin 95.86
3gjy_A 317 Spermidine synthase; APC62791, structural genomics 95.85
3ofk_A 216 Nodulation protein S; NODS, N-methyltransferase, S 95.83
3uzu_A 279 Ribosomal RNA small subunit methyltransferase A; s 95.8
1u2z_A 433 Histone-lysine N-methyltransferase, H3 lysine-79 s 95.8
3kkz_A 267 Uncharacterized protein Q5LES9; putative methyltra 95.79
1i9g_A 280 Hypothetical protein RV2118C; mtase, adoMet, cryst 95.79
3ege_A 261 Putative methyltransferase from antibiotic biosyn 95.75
2ozv_A 260 Hypothetical protein ATU0636; structural genomics, 95.75
1zq9_A 285 Probable dimethyladenosine transferase; SGC, struc 95.73
3ggd_A 245 SAM-dependent methyltransferase; YP_325210.1, stru 95.72
3cgg_A 195 SAM-dependent methyltransferase; NP_600671.1, meth 95.66
2p7i_A 250 Hypothetical protein; putative methyltransferase, 95.64
4e2x_A 416 TCAB9; kijanose, tetronitrose, tetradeoxy sugar, s 95.63
1nv8_A 284 HEMK protein; class I adoMet-dependent methyltrans 95.63
2yqz_A 263 Hypothetical protein TTHA0223; RNA methyltransfera 95.62
2esr_A 177 Methyltransferase; structural genomics, hypothetic 95.61
2ipx_A 233 RRNA 2'-O-methyltransferase fibrillarin; FBL, stru 95.6
1nt2_A 210 Fibrillarin-like PRE-rRNA processing protein; adeM 95.6
2avd_A 229 Catechol-O-methyltransferase; structural genomics, 95.6
3thr_A 293 Glycine N-methyltransferase; GNMT, folate, methylt 95.59
2y1w_A 348 Histone-arginine methyltransferase CARM1; histone 95.57
3uwp_A 438 Histone-lysine N-methyltransferase, H3 lysine-79; 95.55
2fyt_A 340 Protein arginine N-methyltransferase 3; structural 95.54
1xdz_A 240 Methyltransferase GIDB; MCSG, protein structure in 95.54
3fut_A 271 Dimethyladenosine transferase; methyltransferase, 95.5
1ws6_A171 Methyltransferase; structural genomics, riken stru 95.49
3njr_A 204 Precorrin-6Y methylase; methyltransferase, decarbo 95.46
3ftd_A 249 Dimethyladenosine transferase; KSGA, rossmann-like 95.45
1dus_A 194 MJ0882; hypothetical protein, methanococcus jannas 95.44
2gpy_A 233 O-methyltransferase; structural genomics, PSI, pro 95.44
3orh_A 236 Guanidinoacetate N-methyltransferase; structura ge 95.37
3ccf_A 279 Cyclopropane-fatty-acyl-phospholipid synthase; YP_ 95.35
3adn_A 294 Spermidine synthase; aminopropyltransferase, polya 95.3
2h00_A 254 Methyltransferase 10 domain containing protein; st 95.29
3hnr_A 220 Probable methyltransferase BT9727_4108; structural 95.26
2xvm_A 199 Tellurite resistance protein TEHB; antibiotic resi 95.24
3opn_A 232 Putative hemolysin; structural genomics, PSI-2, pr 95.24
1vbf_A 231 231AA long hypothetical protein-L-isoaspartate O- 95.23
3duw_A 223 OMT, O-methyltransferase, putative; alternating of 95.22
3tr6_A 225 O-methyltransferase; cellular processes; HET: SAH; 95.19
3ntv_A 232 MW1564 protein; rossmann fold, putative methyltran 95.19
3lbf_A 210 Protein-L-isoaspartate O-methyltransferase; modifi 95.18
1dl5_A 317 Protein-L-isoaspartate O-methyltransferase; isoasp 95.12
1l3i_A 192 Precorrin-6Y methyltransferase/putative decarboxyl 95.12
3tqs_A 255 Ribosomal RNA small subunit methyltransferase A; p 95.1
3bxo_A 239 N,N-dimethyltransferase; desosamine, sugar, carboh 95.07
4hg2_A 257 Methyltransferase type 11; structural genomics, PS 95.05
2fhp_A 187 Methylase, putative; alpha-beta-alpha sandwich, st 95.04
2nxc_A 254 L11 mtase, ribosomal protein L11 methyltransferase 95.01
3gru_A 295 Dimethyladenosine transferase; rossman fold, ribos 94.99
3c3p_A 210 Methyltransferase; NP_951602.1, structural genomic 94.96
3tfw_A 248 Putative O-methyltransferase; PSI-biology, nysgrc, 94.96
4htf_A 285 S-adenosylmethionine-dependent methyltransferase; 94.95
1o9g_A 250 RRNA methyltransferase; antibiotic resistance, Se- 94.94
1g8a_A 227 Fibrillarin-like PRE-rRNA processing protein; rRNA 94.87
1iy9_A 275 Spermidine synthase; rossmann fold, structural gen 94.87
3g2m_A 299 PCZA361.24; SAM-dependent methyltransferase, glyco 94.85
3lpm_A 259 Putative methyltransferase; structural genomics, p 94.83
1wzn_A 252 SAM-dependent methyltransferase; structural genomi 94.79
3bwc_A 304 Spermidine synthase; SAM, SGPP, structura genomics 94.75
3e8s_A 227 Putative SAM dependent methyltransferase; NP_74470 94.75
2hnk_A 239 SAM-dependent O-methyltransferase; modified rossma 94.72
1p91_A 269 Ribosomal RNA large subunit methyltransferase A; R 94.69
3e23_A 211 Uncharacterized protein RPA2492; alpha-beta protei 94.67
1yub_A 245 Ermam, rRNA methyltransferase; MLS antibiotics; NM 94.66
2yvl_A 248 TRMI protein, hypothetical protein; tRNA, methyltr 94.66
1y8c_A 246 S-adenosylmethionine-dependent methyltransferase; 94.61
1xj5_A 334 Spermidine synthase 1; structural genomics, protei 94.58
3grz_A 205 L11 mtase, ribosomal protein L11 methyltransferase 94.55
2zfu_A 215 Nucleomethylin, cerebral protein 1; nucleolar prot 94.55
2h1r_A 299 Dimethyladenosine transferase, putative; SGC toron 94.53
2aot_A 292 HMT, histamine N-methyltransferase; classic methyl 94.51
2o07_A 304 Spermidine synthase; structural genomics, structur 94.47
1sui_A 247 Caffeoyl-COA O-methyltransferase; rossmann fold, p 94.46
1inl_A 296 Spermidine synthase; beta-barrel, rossman fold, st 94.35
2pt6_A 321 Spermidine synthase; transferase, structural genom 94.35
2bm8_A 236 Cephalosporin hydroxylase CMCI; cephamycin biosynt 94.34
2b25_A 336 Hypothetical protein; structural genomics, methyl 94.33
2i7c_A 283 Spermidine synthase; transferase, structural genom 94.32
1uir_A 314 Polyamine aminopropyltransferase; spermidien synth 94.29
3dr5_A 221 Putative O-methyltransferase; Q8NRD3, CGL1119, PF0 94.28
3r3h_A 242 O-methyltransferase, SAM-dependent; structural gen 94.26
3h2b_A 203 SAM-dependent methyltransferase; alpha-beta protei 94.26
3bgv_A 313 MRNA CAP guanine-N7 methyltransferase; alternative 94.25
3ocj_A 305 Putative exported protein; structural genomics, PS 94.24
3tma_A 354 Methyltransferase; thump domain; 2.05A {Thermus th 94.23
3q7e_A 349 Protein arginine N-methyltransferase 1; HET: SAH; 94.21
1mjf_A 281 Spermidine synthase; spermidine synthetase, struct 94.19
2pxx_A 215 Uncharacterized protein MGC2408; structural genomi 94.17
2b2c_A 314 Spermidine synthase; beta-alpha, transferase; 2.50 94.16
3u81_A 221 Catechol O-methyltransferase; neurotransmitter deg 94.14
3m70_A 286 Tellurite resistance protein TEHB homolog; structu 94.11
3c3y_A 237 Pfomt, O-methyltransferase; plant secondary metabo 94.1
3sm3_A 235 SAM-dependent methyltransferases; NESG, structural 94.09
3d2l_A 243 SAM-dependent methyltransferase; ZP_00538691.1, st 94.09
4gqb_A 637 Protein arginine N-methyltransferase 5; TIM barrel 94.02
3cbg_A 232 O-methyltransferase; cyanobacterium; HET: SAH FER 94.02
3l8d_A 242 Methyltransferase; structural genomics, PSI, nysgr 94.01
2pbf_A 227 Protein-L-isoaspartate O-methyltransferase beta-A 94.0
4fsd_A 383 Arsenic methyltransferase; rossmann fold; 1.75A {C 93.95
2ex4_A 241 Adrenal gland protein AD-003; methyltransferase, s 93.91
2ih2_A 421 Modification methylase TAQI; DNA, DNA methyltransf 93.86
3a27_A 272 TYW2, uncharacterized protein MJ1557; wybutosine m 93.81
1g6q_1 328 HnRNP arginine N-methyltransferase; SAM-binding do 93.7
1zx0_A 236 Guanidinoacetate N-methyltransferase; structural g 93.65
2wa2_A 276 Non-structural protein 5; transferase, S-adenosyl- 93.61
1i1n_A 226 Protein-L-isoaspartate O-methyltransferase; S-aden 93.6
3r0q_C 376 Probable protein arginine N-methyltransferase 4.2; 93.57
2oxt_A 265 Nucleoside-2'-O-methyltransferase; flavivirus, vir 93.5
3bzb_A 281 Uncharacterized protein; RED ALGA, protein structu 93.46
3fpf_A 298 Mtnas, putative uncharacterized protein; thermonic 93.38
3hp7_A 291 Hemolysin, putative; structural genomics, APC64019 93.37
1wy7_A 207 Hypothetical protein PH1948; seven-stranded beta s 93.32
1ne2_A 200 Hypothetical protein TA1320; structural genomics, 93.26
3m33_A 226 Uncharacterized protein; structural genomics, PSI- 93.24
2ift_A 201 Putative methylase HI0767; NESG, Y767_haein, struc 93.16
3gdh_A 241 Trimethylguanosine synthase homolog; M7G, CAP, dim 93.12
3ua3_A 745 Protein arginine N-methyltransferase 5; TIM-barrel 93.06
3lcc_A 235 Putative methyl chloride transferase; halide methy 92.96
2cmg_A 262 Spermidine synthase; transferase, putrescine amino 92.96
3p9n_A 189 Possible methyltransferase (methylase); RV2966C, a 92.92
3evz_A 230 Methyltransferase; NYSGXRC, NEW YORK SGX research 92.86
2avn_A 260 Ubiquinone/menaquinone biosynthesis methyltransfe 92.79
2fpo_A 202 Methylase YHHF; structural genomics, putative meth 92.73
1r18_A 227 Protein-L-isoaspartate(D-aspartate)-O-methyltrans; 92.7
4azs_A 569 Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15 92.59
3id6_C 232 Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; 92.41
2gb4_A 252 Thiopurine S-methyltransferase; 18204406, thiopuri 92.4
2p41_A 305 Type II methyltransferase; vizier, viral enzymes i 92.34
4df3_A 233 Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; 92.22
1ixk_A 315 Methyltransferase; open beta sheet; 1.90A {Pyrococ 92.21
2kw5_A 202 SLR1183 protein; structural genomics, northeast st 92.19
1vlm_A 219 SAM-dependent methyltransferase; possible histamin 92.11
2frn_A 278 Hypothetical protein PH0793; structural genomics, 92.09
3tm4_A 373 TRNA (guanine N2-)-methyltransferase TRM14; rossma 91.9
2qm3_A 373 Predicted methyltransferase; putative methyltransf 91.83
4hc4_A 376 Protein arginine N-methyltransferase 6; HRMT1L6, S 91.71
1ri5_A 298 MRNA capping enzyme; methyltransferase, M7G, messe 91.64
3ajd_A 274 Putative methyltransferase MJ0026; tRNA, M5C, ross 91.5
1uwv_A 433 23S rRNA (uracil-5-)-methyltransferase RUMA; RNA m 90.86
2qfm_A 364 Spermine synthase; spermidine aminopropyltransfera 90.25
2r6z_A 258 UPF0341 protein in RSP 3' region; alpha-beta prote 90.01
3htx_A 950 HEN1; HEN1, small RNA methyltransferase, protein-R 89.79
3gcz_A 282 Polyprotein; flavivirus, RNA capping, methyltransf 89.44
2i62_A 265 Nicotinamide N-methyltransferase; structural genom 89.4
2yxl_A 450 PH0851 protein, 450AA long hypothetical FMU protei 89.31
3dmg_A 381 Probable ribosomal RNA small subunit methyltransf; 89.17
1sqg_A 429 SUN protein, FMU protein; rossmann-fold, mixed bet 89.07
2vdw_A 302 Vaccinia virus capping enzyme D1 subunit; nucleoti 88.81
3evf_A 277 RNA-directed RNA polymerase NS5; NS5 methyltransfe 88.73
2igt_A 332 SAM dependent methyltransferase; alpha-beta sandwi 88.68
3k0b_A 393 Predicted N6-adenine-specific DNA methylase; methy 88.12
3ldu_A 385 Putative methylase; structural genomics, PSI-2, pr 87.84
3lcv_B 281 Sisomicin-gentamicin resistance methylase SGM; ant 87.78
2g72_A 289 Phenylethanolamine N-methyltransferase; HET: SAM F 87.62
2gs9_A 211 Hypothetical protein TT1324; methyl transferase, s 87.43
2oyr_A 258 UPF0341 protein YHIQ; alpha-beta protein, structur 87.07
3bt7_A 369 TRNA (uracil-5-)-methyltransferase; methyluridine, 87.01
3giw_A 277 Protein of unknown function DUF574; rossmann-fold 86.77
3ldg_A 384 Putative uncharacterized protein SMU.472; YPSC, me 86.34
2jjq_A 425 Uncharacterized RNA methyltransferase pyrab10780; 86.32
3sso_A 419 Methyltransferase; macrolide, natural product, ros 85.96
2dul_A 378 N(2),N(2)-dimethylguanosine tRNA methyltransferas; 85.62
3ll7_A 410 Putative methyltransferase; methytransferase, stru 85.36
3frh_A 253 16S rRNA methylase; methyltransferase domain, heli 85.29
3b5i_A 374 S-adenosyl-L-methionine:salicylic acid carboxyl me 85.29
2f8l_A 344 Hypothetical protein LMO1582; structural genomics, 84.53
1af7_A 274 Chemotaxis receptor methyltransferase CHER; chemot 84.01
4dmg_A 393 Putative uncharacterized protein TTHA1493; rRNA, m 83.08
2okc_A 445 Type I restriction enzyme stysji M protein; NP_813 82.98
2a14_A 263 Indolethylamine N-methyltransferase; SGC,INMT, str 82.0
2py6_A 409 Methyltransferase FKBM; YP_546752.1, structural ge 81.7
2b78_A 385 Hypothetical protein SMU.776; structure genomics, 81.0
1i4w_A 353 Mitochondrial replication protein MTF1; mitochondr 80.51
3m6w_A 464 RRNA methylase; rRNA methyltransferase, 5-methylcy 80.2
3c0k_A 396 UPF0064 protein YCCW; PUA domain, adoMet dependent 80.16
>4a6d_A Hydroxyindole O-methyltransferase; melatonin, circadian clock; HET: SAM; 2.40A {Homo sapiens} PDB: 4a6e_A* Back     alignment and structure
Probab=99.94  E-value=6.4e-26  Score=186.65  Aligned_cols=156  Identities=16%  Similarity=0.273  Sum_probs=137.9

Q ss_pred             cHHHHHHHHHHHhhHHHHHHHHHHHhC-----------------------------C----------------CCCCcee
Q 037090           18 EQDFLLAMELASGTILPMTIKSAIELD-----------------------------R----------------SVQRLYG   52 (178)
Q Consensus        18 ~~~~~~l~~~~~g~~~s~~L~~a~elg-----------------------------R----------------~~~~~y~   52 (178)
                      ......|.+++.||+.|++|++|+|||                             |                ..+++|+
T Consensus         6 ~~~~~~L~~l~~Gf~~s~~L~aa~eLglfd~L~~~~~p~t~~eLA~~~g~~~~~l~rlLr~L~~~gll~~~~~~~~~~y~   85 (353)
T 4a6d_A            6 DQAYRLLNDYANGFMVSQVLFAACELGVFDLLAEAPGPLDVAAVAAGVRASAHGTELLLDICVSLKLLKVETRGGKAFYR   85 (353)
T ss_dssp             CHHHHHHHHHHHHHHHHHHHHHHHHHTHHHHHHHSSSCBCHHHHHHHHTCCHHHHHHHHHHHHHTTSEEEEEETTEEEEE
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHcCHHHHHhcCCCCCCHHHHHHhhCcCHHHHHHHHHHHHHCCCEEEeccCccceee
Confidence            467788999999999999999999999                             1                1245799


Q ss_pred             cchhcc-ccCCCCCCCChHHHHHHhcChhhhhhhhhHHHHHhcCCcchhhhcc--CCchhhhhccChHHHHHHHHHHHhh
Q 037090           53 LAPVSK-YFVPNEEGVSLAPTLLIIQDKVNMDSWSCVKDALLEGLVPFMKAHN--GMDGFAVAAKDEKINNLFNQSMHNH  129 (178)
Q Consensus        53 ~t~~s~-~L~~~~~~~~~~~~v~~~~~~~~~~~~~~L~~~l~~g~~~f~~a~~--g~~~~e~~~~~p~~~~~F~~~M~~~  129 (178)
                      +|++++ +|.+++|. ++++++.+. .+..++.|.+|.+++++|+++|+.+++  ..++|+++.++|+....|+++|...
T Consensus        86 ~t~~s~~~l~~~~~~-~~~~~~~~~-~~~~~~~~~~L~~~vr~g~~~~~~~~g~~~~~~~~~~~~~~~~~~~f~~aM~~~  163 (353)
T 4a6d_A           86 NTELSSDYLTTVSPT-SQCSMLKYM-GRTSYRCWGHLADAVREGRNQYLETFGVPAEELFTAIYRSEGERLQFMQALQEV  163 (353)
T ss_dssp             ECHHHHHHHSTTSTT-CCHHHHHHH-HHTHHHHHTTHHHHHHHTSCCHHHHHSCCCSSHHHHHTSSHHHHHHHHHHHHTT
T ss_pred             CCHHHHHHhhcCCch-HHHHHHHHh-CHHHHHHHHHHHHHHhcCCChhHHhcCCChHHHHHHHhhCHHHHHHHHHHHHHH
Confidence            999997 56677764 888888875 456789999999999999999999983  2578999999999999999999999


Q ss_pred             hHHhHHHHHHhcCCCCCCCeEEEecCCccHHHHHHHHhcCCCeEEEe
Q 037090          130 TTIVMKEILETYKGFERLNQFVDVADGLGENKNILLTKISIISLNTI  176 (178)
Q Consensus       130 ~~~~~~~~~~~~~~~~~~~~vVDVGGg~G~~~~~i~~~~P~l~~~v~  176 (178)
                      +....+.+++.+| |++..+|||||||+|.++.+++++||+++++++
T Consensus       164 ~~~~~~~~~~~~~-~~~~~~v~DvGgG~G~~~~~l~~~~p~~~~~~~  209 (353)
T 4a6d_A          164 WSVNGRSVLTAFD-LSVFPLMCDLGGGAGALAKECMSLYPGCKITVF  209 (353)
T ss_dssp             HHHHHHHHHHSSC-GGGCSEEEEETCTTSHHHHHHHHHCSSCEEEEE
T ss_pred             HHHHHHHHHHhcC-cccCCeEEeeCCCCCHHHHHHHHhCCCceeEec
Confidence            9888899999999 999999999999999999999999999999876



>3p9c_A Caffeic acid O-methyltransferase; S-adenosylmethionine dependent O-methyltransferase; HET: SAH; 1.80A {Lolium perenne} PDB: 3p9i_A* 3p9k_A* Back     alignment and structure
>3lst_A CALO1 methyltransferase; calicheamicin, enediyne, SAH, STRU genomics, PSI-2, protein structure initiative; HET: SAH; 2.40A {Micromonospora echinospora} Back     alignment and structure
>3reo_A (ISO)eugenol O-methyltransferase; directed evolution, saturation mutagenesis, regioselectivity transferase; HET: SAH EUG; 1.90A {Clarkia breweri} PDB: 3tky_A* 1kyz_A* 1kyw_A* Back     alignment and structure
>3gwz_A MMCR; methyltransferase, mitomycin, S-adenosyl methionine, transferase; HET: MSE SAH; 1.91A {Streptomyces lavendulae} PDB: 3gxo_A* Back     alignment and structure
>2ip2_A Probable phenazine-specific methyltransferase; pyocyanin, phenazine-1-carboxy PHZM; 1.80A {Pseudomonas aeruginosa} Back     alignment and structure
>1fp2_A Isoflavone O-methyltransferase; protein-product complex; HET: SAH HMO; 1.40A {Medicago sativa} SCOP: a.4.5.29 c.66.1.12 PDB: 1fpx_A* 2qyo_A* Back     alignment and structure
>1zg3_A Isoflavanone 4'-O-methyltransferase; rossman fold, plant Pro transferase; HET: 2HI SAH; 2.35A {Medicago truncatula} PDB: 1zga_A* 1zhf_A* 1zgj_A* Back     alignment and structure
>3i53_A O-methyltransferase; CO-complex, rossmann-like fold; HET: SAH; 2.08A {Streptomyces carzinostaticus subsp} PDB: 3i58_A* 3i5u_A* 3i64_A* Back     alignment and structure
>1fp1_D Isoliquiritigenin 2'-O-methyltransferase; protein-substrate, protein-product complex; HET: SAH HCC; 1.82A {Medicago sativa} SCOP: a.4.5.29 c.66.1.12 PDB: 1fpq_A* Back     alignment and structure
>1qzz_A RDMB, aclacinomycin-10-hydroxylase; anthracycline, methyltransferase, polyketide, tailoring enzymes, structural proteomics in E spine; HET: SAM; 2.10A {Streptomyces purpurascens} SCOP: a.4.5.29 c.66.1.12 PDB: 1r00_A* 1xds_A* 1xdu_A* Back     alignment and structure
>1tw3_A COMT, carminomycin 4-O-methyltransferase; anthracycline, methylate, tailoring enzyme, polyketide, S-adenosyl-L-homocystein; HET: SAH ERT; 2.35A {Streptomyces peucetius} SCOP: a.4.5.29 c.66.1.12 PDB: 1tw2_A* Back     alignment and structure
>3dp7_A SAM-dependent methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research; 2.33A {Bacteroides vulgatus} Back     alignment and structure
>1x19_A CRTF-related protein; methyltransferase, bacteriochllochlorophyll, BCHU, SAM, SAH, adenosylmethyonine, S-adenosylhomocysteine, ADO-Met; 2.27A {Chlorobium tepidum} PDB: 1x1a_A* 1x1b_A* 1x1c_A* 1x1d_A* Back     alignment and structure
>2r3s_A Uncharacterized protein; methyltransferase domain, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE; 2.15A {Nostoc punctiforme} Back     alignment and structure
>3mcz_A O-methyltransferase; adomet_mtases, S-adenosylmethionine-dependent methyltransfer structural genomics, PSI-2; HET: MSE; 1.90A {Burkholderia thailandensis} Back     alignment and structure
>1ve3_A Hypothetical protein PH0226; dimer, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function, NPPSFA; HET: SAM; 2.10A {Pyrococcus horikoshii} SCOP: c.66.1.43 Back     alignment and structure
>1jg1_A PIMT;, protein-L-isoaspartate O-methyltransferase; rossmann methyltransferase, protein repair isomerization; HET: SAH; 1.20A {Pyrococcus furiosus} SCOP: c.66.1.7 PDB: 1jg2_A* 1jg3_A* 1jg4_A* Back     alignment and structure
>3dtn_A Putative methyltransferase MM_2633; structural genomics, unknown function, PSI-2, protein structure initiative; 2.09A {Methanosarcina mazei} Back     alignment and structure
>3e05_A Precorrin-6Y C5,15-methyltransferase (decarboxyla; porphyrin metabolism, S-adenosyl-methionine; 1.80A {Geobacter metallireducens} SCOP: c.66.1.0 Back     alignment and structure
>3vc1_A Geranyl diphosphate 2-C-methyltransferase; rossmann fold, methyltransferase fold, SAM-dependent methyltransferase; HET: SAH GST GOL; 1.82A {Streptomyces coelicolor} PDB: 3vc2_A* 4f84_A* 4f85_A 4f86_A* Back     alignment and structure
>1yb2_A Hypothetical protein TA0852; structural genomics, methyltransferase, thermoplasma acidoph midwest center for structural genomics, MCSG; 2.01A {Thermoplasma acidophilum} SCOP: c.66.1.13 Back     alignment and structure
>1jsx_A Glucose-inhibited division protein B; methyltransferase fold, structural genomics, PSI, protein structure initiative; 2.40A {Escherichia coli} SCOP: c.66.1.20 Back     alignment and structure
>4dzr_A Protein-(glutamine-N5) methyltransferase, release specific; structural genomics, PSI-biology; 2.55A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>3hem_A Cyclopropane-fatty-acyl-phospholipid synthase 2; protein-ligand complex, cytoplasm, lipid synthesis, methyltransferase; HET: D22; 2.39A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kpi_A* Back     alignment and structure
>3mb5_A SAM-dependent methyltransferase; RNA methyltransferase, M1A, TRMI, intermolecular contacts, R specificity, tetramer, disulfide bond; HET: SAM; 1.60A {Pyrococcus abyssi} PDB: 3lga_A* 3lhd_C* Back     alignment and structure
>2p35_A Trans-aconitate 2-methyltransferase; SAM dependent methyltrans agrobacterium tumefaciens, structural genomics, PSI-2; HET: SAH; 1.95A {Agrobacterium tumefaciens str} Back     alignment and structure
>2fca_A TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bacillus subtilis} SCOP: c.66.1.53 Back     alignment and structure
>3bkx_A SAM-dependent methyltransferase; YP_807781.1, cyclopropane-fatty-acyl-phospholipid synthase-L protein, methyltransferase domain; 1.85A {Lactobacillus casei} Back     alignment and structure
>3dlc_A Putative S-adenosyl-L-methionine-dependent methyltransferase; structural genomics, joint center for structural genomics; HET: MSE SAM; 1.15A {Methanococcus maripaludis} Back     alignment and structure
>1yzh_A TRNA (guanine-N(7)-)-methyltransferase; alpha-beta-alpha sandwich, S-adenosylmeth dependent, structural genomics, PSI; 2.02A {Streptococcus pneumoniae} SCOP: c.66.1.53 Back     alignment and structure
>3jwh_A HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena variabilis} PDB: 3jwj_A Back     alignment and structure
>3dli_A Methyltransferase; PSI-II, NYSGXRC, structural genomics, protein structure initiative; 2.46A {Archaeoglobus fulgidus} Back     alignment and structure
>1vl5_A Unknown conserved protein BH2331; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; HET: MSE; 1.95A {Bacillus halodurans} SCOP: c.66.1.41 Back     alignment and structure
>3dh0_A SAM dependent methyltransferase; cystal structure, PSI-2, NYSGXRC, structural genomics, protein structure initiative; HET: SAM; 2.72A {Aquifex aeolicus} Back     alignment and structure
>2qe6_A Uncharacterized protein TFU_2867; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; HET: NEP SAM; 1.95A {Thermobifida fusca} Back     alignment and structure
>3bus_A REBM, methyltransferase; rebeccamycin synthesis; HET: SAH; 2.65A {Lechevalieria aerocolonigenes} Back     alignment and structure
>3dxy_A TRNA (guanine-N(7)-)-methyltransferase; rossmann fold methyltransferase, tRNA modification, S-adenosyl-L-methionine, TR processing; HET: SAM; 1.50A {Escherichia coli} PDB: 3dxx_A* 3dxz_A* Back     alignment and structure
>3bkw_A MLL3908 protein, S-adenosylmethionine dependent methyltransferase; NP_104914.1; HET: MSE; 1.60A {Mesorhizobium loti} Back     alignment and structure
>3mgg_A Methyltransferase; NYSGXRC, PSI-II, protein structure initiative, structural genomics, NEW YORK SGX research center for structural genomics; 1.86A {Methanosarcina mazei} Back     alignment and structure
>3jwg_A HEN1, methyltransferase type 12; 1.90A {Clostridium thermocellum} PDB: 3jwi_A Back     alignment and structure
>3g5l_A Putative S-adenosylmethionine dependent methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.35A {Listeria monocytogenes str} Back     alignment and structure
>1nkv_A Hypothetical protein YJHP; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.90A {Escherichia coli} SCOP: c.66.1.21 Back     alignment and structure
>4gek_A TRNA (CMO5U34)-methyltransferase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, rossmann fold; HET: GEK; 1.50A {Escherichia coli} PDB: 1im8_A* Back     alignment and structure
>1xtp_A LMAJ004091AAA; SGPP, structural genomics, PSI, protein structure initiative dependent methyltransferase; HET: SAI; 1.94A {Leishmania major} SCOP: c.66.1.42 Back     alignment and structure
>4dcm_A Ribosomal RNA large subunit methyltransferase G; 23S rRNA (guanine1835-N2)-methyltransferase; HET: SAM; 2.30A {Escherichia coli} Back     alignment and structure
>2pwy_A TRNA (adenine-N(1)-)-methyltransferase; mtase, adoMet, TRMI, tRNA-M1A58; HET: SAH; 1.70A {Thermus thermophilus} Back     alignment and structure
>3b3j_A Histone-arginine methyltransferase CARM1; protein arginine methyltransferase 4, APO catalytic domain, regulator, mRNA processing; 2.55A {Rattus norvegicus} Back     alignment and structure
>3ckk_A TRNA (guanine-N(7)-)-methyltransferase; mettl1, S-adenosyl-L-methionine, tRNA Pro structural genomics, structural genomics consortium, SGC; HET: SAM; 1.55A {Homo sapiens} Back     alignment and structure
>3g5t_A Trans-aconitate 3-methyltransferase; structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; HET: MSE SAH T8N; 1.12A {Saccharomyces cerevisiae} Back     alignment and structure
>3ou2_A SAM-dependent methyltransferase; O-methyltransferase, SAH; HET: SAH; 1.50A {Streptomyces luridus} PDB: 3ou6_A* 3ou7_A* Back     alignment and structure
>1kpg_A CFA synthase;, cyclopropane-fatty-acyl-phospholipid synthase 1; mixed alpha beta fold, structural genomics, PSI; HET: SAH 16A; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kp9_A* 1kph_A* 1tpy_A* 1l1e_A* Back     alignment and structure
>3g07_A 7SK snRNA methylphosphate capping enzyme; structural genomics consortium (SGC), methyltransferase, phosphoprotein, S-adenosyl-L-methionine; HET: SAM; 2.65A {Homo sapiens} Back     alignment and structure
>3pfg_A N-methyltransferase; N,N-dimethyltransferase, SAM binding, DTDP-linked sugar BIND transferase; HET: SAM TLO; 1.35A {Streptomyces fradiae} PDB: 3pfh_A* 3px3_A* 3px2_A* Back     alignment and structure
>2vdv_E TRNA (guanine-N(7)-)-methyltransferase; S-adenosyl-L-methionine, phosphorylation, M7G, spout MT, tRNA processing; HET: SAM; 2.30A {Saccharomyces cerevisiae} PDB: 2vdu_E Back     alignment and structure
>3ujc_A Phosphoethanolamine N-methyltransferase; parasite; HET: PC; 1.19A {Plasmodium falciparum} PDB: 3uj9_A* 3uj6_A* 3uj7_A* 3uj8_A* 3uja_A 3ujb_A* 4fgz_A* 3ujd_A* Back     alignment and structure
>2o57_A Putative sarcosine dimethylglycine methyltransferase; structural genomics, protein structure initiative, PSI-2; 1.95A {Galdieria sulphuraria} SCOP: c.66.1.18 Back     alignment and structure
>3f4k_A Putative methyltransferase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacteroides thetaiotaomicron} PDB: 3t0i_A* 3svz_A* 3sxj_A* Back     alignment and structure
>3g89_A Ribosomal RNA small subunit methyltransferase G; 16S rRNA methyltransferase, translation, cytoplasm, rRNA processing; HET: HIC SAM AMP; 1.50A {Thermus thermophilus} PDB: 3g88_A* 3g8a_A* 3g8b_A* Back     alignment and structure
>3iv6_A Putative Zn-dependent alcohol dehydrogenase; alpha/beta fold, rossmann-fold, structural genomics, PSI-2, structure initiative; HET: SAM; 2.70A {Rhodobacter sphaeroides} Back     alignment and structure
>3fzg_A 16S rRNA methylase; methyltransferase, plasmid, transferase; HET: SAM; 2.00A {Escherichia coli} Back     alignment and structure
>2yxd_A Probable cobalt-precorrin-6Y C(15)-methyltransfer [decarboxylating]; alpha and beta protein (A/B) class; HET: MES; 2.30A {Methanocaldococcus jannaschii} Back     alignment and structure
>1fbn_A MJ fibrillarin homologue; MJ proteins, ribosomal RNA processing, snoRNP, structural genomics, BSGC structure funded by NIH; 1.60A {Methanocaldococcus jannaschii} SCOP: c.66.1.3 PDB: 1g8s_A Back     alignment and structure
>2pjd_A Ribosomal RNA small subunit methyltransferase C; gene duplication, RNA modification, SAM binding; 2.10A {Escherichia coli} Back     alignment and structure
>1qam_A ERMC' methyltransferase; rRNA methyltransferase ERMC', cofactor analogs; 2.20A {Bacillus subtilis} SCOP: c.66.1.24 PDB: 1qan_A* 1qao_A* 1qaq_A* 2erc_A Back     alignment and structure
>2fk8_A Methoxy mycolic acid synthase 4; S-adenosylmethionine-dependent methyltransferase fold, trans; HET: SAM; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 2fk7_A* 3ha3_A* 3ha5_A* 3ha7_A* Back     alignment and structure
>3cc8_A Putative methyltransferase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS transferase; 1.64A {Bacillus cereus} Back     alignment and structure
>2yxe_A Protein-L-isoaspartate O-methyltransferase; rossman-type fold, alpha/beta/alpha sandwich structure, STRU genomics, NPPSFA; 2.00A {Methanocaldococcus jannaschii} Back     alignment and structure
>1o54_A SAM-dependent O-methyltransferase; TM0748, structural genomi PSI, protein structure initiative, joint center for structu genomics; 1.65A {Thermotoga maritima} SCOP: c.66.1.13 Back     alignment and structure
>2b3t_A Protein methyltransferase HEMK; translation termination, methylation, conformational changes; HET: SAH; 3.10A {Escherichia coli} SCOP: c.66.1.30 PDB: 1t43_A* Back     alignment and structure
>3gjy_A Spermidine synthase; APC62791, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.47A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3ofk_A Nodulation protein S; NODS, N-methyltransferase, SAH, SAM, NOD factor, fixation, symbiosis, alpha/beta structure; HET: SAH; 1.85A {Bradyrhizobium SP} PDB: 3ofj_A* Back     alignment and structure
>3uzu_A Ribosomal RNA small subunit methyltransferase A; ssgcid, seattle structural genomics center for infectio disease; 1.75A {Burkholderia pseudomallei} Back     alignment and structure
>1u2z_A Histone-lysine N-methyltransferase, H3 lysine-79 specific; histone methyltransferase, nucleosome; HET: SAH; 2.20A {Saccharomyces cerevisiae} SCOP: c.66.1.31 Back     alignment and structure
>3kkz_A Uncharacterized protein Q5LES9; putative methyltransferase, BFR250, NESG, structural genomics, PSI-2; HET: SAM; 1.68A {Bacteroides fragilis nctc 9343} PDB: 3e7p_A 3t7s_A* 3t7r_A* 3t7t_A* Back     alignment and structure
>1i9g_A Hypothetical protein RV2118C; mtase, adoMet, crystal, structural genomics, protein structure initiative; HET: SAM; 1.98A {Mycobacterium tuberculosis} SCOP: c.66.1.13 Back     alignment and structure
>3ege_A Putative methyltransferase from antibiotic biosyn pathway; YP_324569.1, putative methyltransferase from antibiotic BIOS pathway; 2.40A {Anabaena variabilis atcc 29413} Back     alignment and structure
>2ozv_A Hypothetical protein ATU0636; structural genomics, predicted transferase, predicted O-methyltransferase, PFAM PF05175; HET: MSE; 1.70A {Agrobacterium tumefaciens str} Back     alignment and structure
>1zq9_A Probable dimethyladenosine transferase; SGC, structural genomics, structural genomics consortium; HET: SAM; 1.90A {Homo sapiens} SCOP: c.66.1.24 Back     alignment and structure
>3ggd_A SAM-dependent methyltransferase; YP_325210.1, structural GEN joint center for structural genomics, JCSG; HET: SAH; 2.11A {Anabaena variabilis atcc 29413} Back     alignment and structure
>3cgg_A SAM-dependent methyltransferase; NP_600671.1, methyltransferase domain, structural genomics; HET: NHE CIT; 2.00A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>2p7i_A Hypothetical protein; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; 1.74A {Pectobacterium atrosepticum SCRI1043} SCOP: c.66.1.41 PDB: 2p7h_A Back     alignment and structure
>4e2x_A TCAB9; kijanose, tetronitrose, tetradeoxy sugar, sugar methylation, transferase; HET: SAH TYD; 1.40A {Micromonospora chalcea} PDB: 3ndi_A* 3ndj_A* 4e32_A* 4e33_A* 4e2y_A* 4e31_A* 4e2w_A* 4e2z_A* 4e30_A* Back     alignment and structure
>1nv8_A HEMK protein; class I adoMet-dependent methyltransferase; HET: SAM MEQ; 2.20A {Thermotoga maritima} SCOP: c.66.1.30 PDB: 1nv9_A* 1vq1_A* 1sg9_A* Back     alignment and structure
>2yqz_A Hypothetical protein TTHA0223; RNA methyltransferase, SAM, structural genomics, NPPSFA; HET: SAM; 1.80A {Thermus thermophilus} PDB: 2yr0_A Back     alignment and structure
>2esr_A Methyltransferase; structural genomics, hypothetical protein, streptococcus PYO PSI, protein structure initiative; HET: GLC; 1.80A {Streptococcus pyogenes} SCOP: c.66.1.46 Back     alignment and structure
>2ipx_A RRNA 2'-O-methyltransferase fibrillarin; FBL, structural genomics, structural genomics consortium, SGC; HET: MTA; 1.82A {Homo sapiens} Back     alignment and structure
>1nt2_A Fibrillarin-like PRE-rRNA processing protein; adeMet, binding motif, RNA binding protein; HET: SAM; 2.90A {Archaeoglobus fulgidus} SCOP: c.66.1.3 Back     alignment and structure
>2avd_A Catechol-O-methyltransferase; structural genomics, structural genomics consortium, SGC; HET: SAM; 1.70A {Homo sapiens} SCOP: c.66.1.1 Back     alignment and structure
>3thr_A Glycine N-methyltransferase; GNMT, folate, methyltransferase binding, liver cytosol, transferase-transferase inhibitor C; HET: C2F TAM; 2.00A {Rattus norvegicus} SCOP: c.66.1.5 PDB: 3ths_A* 1xva_A* 1d2c_A 1kia_A* 1nbh_A* 1bhj_A* 2idj_A 2idk_A* 1d2g_A 1d2h_A* 1nbi_A* 1r8x_A 1r8y_A 1r74_A* 2azt_A* Back     alignment and structure
>2y1w_A Histone-arginine methyltransferase CARM1; histone modification; HET: SFG 849; 2.10A {Homo sapiens} PDB: 2y1x_A* 3b3f_A* 3b3g_A 2v74_B* 2v7e_A Back     alignment and structure
>3uwp_A Histone-lysine N-methyltransferase, H3 lysine-79; epigenetics, tubercidin, structu genomics, structural genomics consortium, SGC; HET: 5ID; 2.05A {Homo sapiens} PDB: 4eqz_A* 3sx0_A* 4er0_A* 4er7_A* 1nw3_A* 4er6_A* 4er5_A* 3qow_A* 3qox_A* 4ek9_A* 4ekg_A* 4eki_A* 4er3_A* 3sr4_A* Back     alignment and structure
>2fyt_A Protein arginine N-methyltransferase 3; structural genomics, structural genomics consortium, SGC; HET: SAH; 2.00A {Homo sapiens} SCOP: c.66.1.6 PDB: 3smq_A* 1f3l_A* Back     alignment and structure
>1xdz_A Methyltransferase GIDB; MCSG, protein structure initiative, structural genomics, methyltransferase fold, PSI; 1.60A {Bacillus subtilis} SCOP: c.66.1.20 Back     alignment and structure
>3fut_A Dimethyladenosine transferase; methyltransferase, dimethyltransferase, dual-specific methyltransferase, 16S rRNA methyltransferase; 1.52A {Thermus thermophilus} PDB: 3fuu_A* 3fuv_A 3fuw_A* 3fux_A* Back     alignment and structure
>1ws6_A Methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.50A {Thermus thermophilus} SCOP: c.66.1.46 Back     alignment and structure
>3njr_A Precorrin-6Y methylase; methyltransferase, decarboxylase, transferase; HET: SAH PG4; 2.70A {Rhodobacter capsulatus} Back     alignment and structure
>3ftd_A Dimethyladenosine transferase; KSGA, rossmann-like fold, RNA methyltransferase, mtase, anti resistance, methyltransferase, RNA-binding; 1.44A {Aquifex aeolicus} PDB: 3ftc_A 3fte_A 3ftf_A* 3r9x_B* Back     alignment and structure
>1dus_A MJ0882; hypothetical protein, methanococcus jannaschii, structural genomics, BSGC structure funded by NIH; 1.80A {Methanocaldococcus jannaschii} SCOP: c.66.1.4 Back     alignment and structure
>2gpy_A O-methyltransferase; structural genomics, PSI, protein structure initiative, NEW research center for structural genomics, nysgxrc; HET: MSE; 1.90A {Bacillus halodurans} Back     alignment and structure
>3orh_A Guanidinoacetate N-methyltransferase; structura genomics, structural genomics consortium, SGC; HET: SAH; 1.86A {Homo sapiens} PDB: 1xcj_A* 1xcl_A* 1p1c_A* 1p1b_A* 1khh_A* Back     alignment and structure
>3ccf_A Cyclopropane-fatty-acyl-phospholipid synthase; YP_321342.1, putative methyltransferase; 1.90A {Anabaena variabilis atcc 29413} Back     alignment and structure
>2h00_A Methyltransferase 10 domain containing protein; structural genomics, structural genomics consortium, SGC; HET: SAH; 2.00A {Homo sapiens} SCOP: c.66.1.54 Back     alignment and structure
>3hnr_A Probable methyltransferase BT9727_4108; structural genomics, PSI-2, protein structure initiative; 2.80A {Bacillus thuringiensis serovarkonkukian} Back     alignment and structure
>2xvm_A Tellurite resistance protein TEHB; antibiotic resistance, transferase; HET: SAH; 1.48A {Escherichia coli} PDB: 2xva_A* 4dq0_A* 2i6g_A* Back     alignment and structure
>3opn_A Putative hemolysin; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics, nysgxrc; 2.05A {Lactococcus lactis subsp} Back     alignment and structure
>1vbf_A 231AA long hypothetical protein-L-isoaspartate O- methyltransferase; trimeric coiled coil assembly; 2.80A {Sulfolobus tokodaii} SCOP: c.66.1.7 Back     alignment and structure
>3duw_A OMT, O-methyltransferase, putative; alternating of alpha and beta with complex SAH; HET: SAH; 1.20A {Bacillus cereus} PDB: 3dul_A* Back     alignment and structure
>3tr6_A O-methyltransferase; cellular processes; HET: SAH; 2.70A {Coxiella burnetii} SCOP: c.66.1.0 Back     alignment and structure
>3ntv_A MW1564 protein; rossmann fold, putative methyltransferase, transferase; HET: MSE; 1.55A {Staphylococcus aureus} Back     alignment and structure
>3lbf_A Protein-L-isoaspartate O-methyltransferase; modified rossman-type fold, S-adenosyl-L- methionine; HET: SAH; 1.80A {Escherichia coli} Back     alignment and structure
>1dl5_A Protein-L-isoaspartate O-methyltransferase; isoaspartyl residues, protein repair, deamidation, post-translational modification; HET: SAH; 1.80A {Thermotoga maritima} SCOP: c.66.1.7 d.197.1.1 Back     alignment and structure
>1l3i_A Precorrin-6Y methyltransferase/putative decarboxylase; structural genomics, beta barrel, rossmann fold, tetramer; HET: SAH; 1.95A {Methanothermobacterthermautotrophicus} SCOP: c.66.1.22 PDB: 1kxz_A 1l3b_A 1f38_A 1l3c_A* Back     alignment and structure
>3tqs_A Ribosomal RNA small subunit methyltransferase A; protein synthesis; 1.98A {Coxiella burnetii} SCOP: c.66.1.0 Back     alignment and structure
>3bxo_A N,N-dimethyltransferase; desosamine, sugar, carbohydrate, antibiotic, SAM, adoMet; HET: SAM UPP; 2.00A {Streptomyces venezuelae} Back     alignment and structure
>4hg2_A Methyltransferase type 11; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MES; 1.60A {Anaeromyxobacter dehalogenans} Back     alignment and structure
>2fhp_A Methylase, putative; alpha-beta-alpha sandwich, structural genomics, PSI, protein structure initiative; HET: MSE; 1.60A {Enterococcus faecalis} SCOP: c.66.1.46 Back     alignment and structure
>2nxc_A L11 mtase, ribosomal protein L11 methyltransferase; transferase S-adenosly-L-methionine dependent methyltransfer posttranslational modification; 1.59A {Thermus thermophilus} SCOP: c.66.1.39 PDB: 1ufk_A 2nxe_A* 2nxj_A 2nxn_A 2zbp_A* 2zbq_A* 2zbr_A* 3cjq_A* 3cjr_A* 3cju_A* 3egv_A* 3cjt_A* Back     alignment and structure
>3gru_A Dimethyladenosine transferase; rossman fold, ribosomal assem adenosyl-L-methionine, rRNA, methyltransferase, RNA-binding processing; HET: AMP; 1.60A {Methanocaldococcus jannaschii} PDB: 3grr_A* 3grv_A* 3gry_A* 3fyd_A 3fyc_A* Back     alignment and structure
>3c3p_A Methyltransferase; NP_951602.1, structural genomics, joint for structural genomics, JCSG, protein structure initiative transferase; 1.90A {Geobacter sulfurreducens pca} Back     alignment and structure
>3tfw_A Putative O-methyltransferase; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium; 1.88A {Klebsiella pneumoniae subsp} Back     alignment and structure
>4htf_A S-adenosylmethionine-dependent methyltransferase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE SAM; 1.60A {Escherichia coli} Back     alignment and structure
>1o9g_A RRNA methyltransferase; antibiotic resistance, Se-MAD; 1.5A {Streptomyces viridochromogenes} SCOP: c.66.1.29 PDB: 1o9h_A Back     alignment and structure
>1g8a_A Fibrillarin-like PRE-rRNA processing protein; rRNA binding, RNA binding, structural genomics, BSGC structure funded by NIH; 1.40A {Pyrococcus horikoshii} SCOP: c.66.1.3 PDB: 2nnw_B 3nmu_F* 3nvk_I* 3nvm_B 1pry_A Back     alignment and structure
>1iy9_A Spermidine synthase; rossmann fold, structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacillus subtilis} SCOP: c.66.1.17 Back     alignment and structure
>3g2m_A PCZA361.24; SAM-dependent methyltransferase, glycopeptide antibiotics biosynthesis, structural genomics; 2.00A {Amycolatopsis orientalis} PDB: 3g2o_A* 3g2p_A* 3g2q_A* Back     alignment and structure
>3lpm_A Putative methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium, nysgxrc; 2.40A {Listeria monocytogenes} Back     alignment and structure
>1wzn_A SAM-dependent methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: SAH; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.43 Back     alignment and structure
>3bwc_A Spermidine synthase; SAM, SGPP, structura genomics, PSI, protein structure initiative, structural GEN pathogenic protozoa consortium; HET: MSE SAM; 2.30A {Trypanosoma cruzi} PDB: 3bwb_A* Back     alignment and structure
>3e8s_A Putative SAM dependent methyltransferase; NP_744700.1, structural genomics, joint center for structural genom JCSG; HET: SAH; 2.10A {Pseudomonas putida KT2440} Back     alignment and structure
>2hnk_A SAM-dependent O-methyltransferase; modified rossman fold; HET: SAH; 2.30A {Leptospira interrogans} Back     alignment and structure
>1p91_A Ribosomal RNA large subunit methyltransferase A; RLMA, RRMA, 23S rRNA, NESG, structural genomics, PSI, protein structure initiative; HET: SAM; 2.80A {Escherichia coli} SCOP: c.66.1.33 Back     alignment and structure
>3e23_A Uncharacterized protein RPA2492; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAM; 1.60A {Rhodopseudomonas palustris} Back     alignment and structure
>1yub_A Ermam, rRNA methyltransferase; MLS antibiotics; NMR {Streptococcus pneumoniae} SCOP: c.66.1.24 Back     alignment and structure
>2yvl_A TRMI protein, hypothetical protein; tRNA, methyltransferase, S-adenosylmethionine, structural GE NPPSFA; HET: SAM; 2.20A {Aquifex aeolicus} Back     alignment and structure
>1y8c_A S-adenosylmethionine-dependent methyltransferase; structural genomics, protein structure initiative, PSI; 2.50A {Clostridium acetobutylicum} SCOP: c.66.1.43 Back     alignment and structure
>1xj5_A Spermidine synthase 1; structural genomics, protein structure initiative, CESG, AT1G23820, putrescine aminopropyl transferase, SPDS1; 2.70A {Arabidopsis thaliana} SCOP: c.66.1.17 PDB: 2q41_A Back     alignment and structure
>3grz_A L11 mtase, ribosomal protein L11 methyltransferase; methylase, SAM-binding domain, PSI-2, nysgxrc; 2.00A {Lactobacillus delbrueckii subsp} Back     alignment and structure
>2zfu_A Nucleomethylin, cerebral protein 1; nucleolar protein, SAM-binding protein, protein structure, N phosphoprotein, nuclear protein; HET: SAH; 2.00A {Homo sapiens} Back     alignment and structure
>2h1r_A Dimethyladenosine transferase, putative; SGC toronto dimethyladenosine transferase, structural genomics, structural genomics consortium; 1.89A {Plasmodium falciparum} Back     alignment and structure
>2aot_A HMT, histamine N-methyltransferase; classic methyltransferase fold, protein-drug complex; HET: CSO 2PM SAH; 1.90A {Homo sapiens} SCOP: c.66.1.19 PDB: 1jqd_A* 2aou_A* 2aov_A* 2aox_A* 1jqe_A* 2aow_A* Back     alignment and structure
>2o07_A Spermidine synthase; structural genomics, structural genomics consortium, SGC, transferase; HET: SPD MTA; 1.89A {Homo sapiens} SCOP: c.66.1.17 PDB: 2o06_A* 2o05_A* 2o0l_A* 3rw9_A* Back     alignment and structure
>1sui_A Caffeoyl-COA O-methyltransferase; rossmann fold, protein-cofactor-substrate complex; HET: SAH FRE; 2.70A {Medicago sativa} SCOP: c.66.1.1 PDB: 1sus_A* Back     alignment and structure
>1inl_A Spermidine synthase; beta-barrel, rossman fold, structural genomics, PSI, protein structure initiative; 1.50A {Thermotoga maritima} SCOP: c.66.1.17 PDB: 1jq3_A* Back     alignment and structure
>2pt6_A Spermidine synthase; transferase, structural genomics consor SGC,dcadoMet complex; HET: S4M 1PG; 2.00A {Plasmodium falciparum} PDB: 2pss_A* 2pt9_A* Back     alignment and structure
>2bm8_A Cephalosporin hydroxylase CMCI; cephamycin biosynthesis; 2.5A {Streptomyces clavuligerus} SCOP: c.66.1.50 PDB: 2bm9_A* 2br5_A* 2br4_A* 2br3_A* Back     alignment and structure
>2b25_A Hypothetical protein; structural genomics, methyl transferase, SAM, structural GEN consortium, SGC, transferase; HET: SAM; 2.50A {Homo sapiens} SCOP: c.66.1.13 Back     alignment and structure
>2i7c_A Spermidine synthase; transferase, structural genomics consor; HET: AAT 1PG; 1.71A {Plasmodium falciparum} PDB: 2hte_A* 3b7p_A* 3rie_A* 2pwp_A* Back     alignment and structure
>1uir_A Polyamine aminopropyltransferase; spermidien synthase, spermine synthase, riken STR genomics/proteomics initiative, RSGI; 2.00A {Thermus thermophilus} SCOP: c.66.1.17 PDB: 3anx_A* Back     alignment and structure
>3dr5_A Putative O-methyltransferase; Q8NRD3, CGL1119, PF01596, CGR117, NESG, structural genomics, PSI-2, protein structure initiative; 2.25A {Corynebacterium glutamicum} Back     alignment and structure
>3r3h_A O-methyltransferase, SAM-dependent; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.65A {Legionella pneumophila subsp} Back     alignment and structure
>3h2b_A SAM-dependent methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAH; 2.00A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3bgv_A MRNA CAP guanine-N7 methyltransferase; alternative splicing, mRNA capping, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: SAH; 2.30A {Homo sapiens} PDB: 3epp_A* Back     alignment and structure
>3ocj_A Putative exported protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: PLM; 1.39A {Bordetella parapertussis} Back     alignment and structure
>3tma_A Methyltransferase; thump domain; 2.05A {Thermus thermophilus} Back     alignment and structure
>3q7e_A Protein arginine N-methyltransferase 1; HET: SAH; 2.20A {Rattus norvegicus} PDB: 1orh_A* 1ori_A* 1or8_A* Back     alignment and structure
>1mjf_A Spermidine synthase; spermidine synthetase, structural genomics, PSI, protein structure initiative; 1.80A {Pyrococcus furiosus} SCOP: c.66.1.17 PDB: 2e5w_A* 2zsu_A* Back     alignment and structure
>2pxx_A Uncharacterized protein MGC2408; structural genomics consortium, SGC, methyltransferase, LOC84291, transferase; HET: SAH; 1.30A {Homo sapiens} Back     alignment and structure
>2b2c_A Spermidine synthase; beta-alpha, transferase; 2.50A {Caenorhabditis elegans} SCOP: c.66.1.17 Back     alignment and structure
>3u81_A Catechol O-methyltransferase; neurotransmitter degradation, transferase transferase inhibitor complex; HET: SAH; 1.13A {Rattus norvegicus} SCOP: c.66.1.1 PDB: 3nwe_A* 3oe5_A* 3ozr_A* 3oe4_A* 3ozt_A* 3ozs_A* 3r6t_A* 3hvi_A* 1jr4_A* 1vid_A* 1h1d_A* 2cl5_A* 3hvh_A* 3hvj_A* 3hvk_A* 3nw9_A* 3nwb_A* 3s68_A* 2zlb_A 2zth_A* ... Back     alignment and structure
>3m70_A Tellurite resistance protein TEHB homolog; structural genomics, PSI-2, protein ST initiative; 1.95A {Haemophilus influenzae} Back     alignment and structure
>3c3y_A Pfomt, O-methyltransferase; plant secondary metabolism; HET: SAH; 1.37A {Mesembryanthemum crystallinum} Back     alignment and structure
>3sm3_A SAM-dependent methyltransferases; NESG, structural genomics, PSI-biology, protein structure in northeast structural genomics; 2.20A {Methanosarcina mazei} Back     alignment and structure
>3d2l_A SAM-dependent methyltransferase; ZP_00538691.1, structural G joint center for structural genomics, JCSG; HET: MSE; 1.90A {Exiguobacterium sibiricum 255-15} Back     alignment and structure
>4gqb_A Protein arginine N-methyltransferase 5; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} PDB: 4g56_A* Back     alignment and structure
>3cbg_A O-methyltransferase; cyanobacterium; HET: SAH FER 4FE; 2.00A {Synechocystis SP} Back     alignment and structure
>3l8d_A Methyltransferase; structural genomics, PSI, nysgrc, protein structure initiative, NEW YORK SGX research center for STRU genomics; 1.70A {Bacillus thuringiensis} Back     alignment and structure
>2pbf_A Protein-L-isoaspartate O-methyltransferase beta-A methyltransferase; protein repair, isoaspartyl formation, P. falciparum; HET: SAH; 2.00A {Plasmodium falciparum} Back     alignment and structure
>4fsd_A Arsenic methyltransferase; rossmann fold; 1.75A {Cyanidioschyzon SP} PDB: 4fr0_A* 4fs8_A 3p7e_A 3qnh_A 3qhu_A Back     alignment and structure
>2ex4_A Adrenal gland protein AD-003; methyltransferase, structural genomics, SGC, structural genomics consortium; HET: SAH; 1.75A {Homo sapiens} SCOP: c.66.1.42 Back     alignment and structure
>2ih2_A Modification methylase TAQI; DNA, DNA methyltransferase, target base partner, 5-methylpyr 2(1H)-ONE, base flipping; HET: 5PY 6MA NEA; 1.61A {Thermus aquaticus} SCOP: c.66.1.27 d.287.1.1 PDB: 2ibs_A* 2ibt_A* 2ih4_A* 2ih5_A* 2jg3_A* 2np6_A* 2np7_A* 1aqj_A* 1aqi_A* 2adm_A* 1g38_A* Back     alignment and structure
>3a27_A TYW2, uncharacterized protein MJ1557; wybutosine modification, transferase; HET: SAM; 2.00A {Methanocaldococcus jannaschii} Back     alignment and structure
>1g6q_1 HnRNP arginine N-methyltransferase; SAM-binding domain, beta-barrel, mixed alpha-beta, hexamer; 2.90A {Saccharomyces cerevisiae} SCOP: c.66.1.6 Back     alignment and structure
>1zx0_A Guanidinoacetate N-methyltransferase; structural genomics, structural genomics consortium; HET: SAH; 1.86A {Homo sapiens} PDB: 3orh_A* 1xcj_A* 1xcl_A* 1p1c_A* 1p1b_A* 1khh_A* Back     alignment and structure
>2wa2_A Non-structural protein 5; transferase, S-adenosyl-L- methionine, virion, membrane, flavivirus, N7-methyltransferase, 2'-O-methyltransferase; HET: SAM; 1.80A {Modoc virus} PDB: 2wa1_A* Back     alignment and structure
>1i1n_A Protein-L-isoaspartate O-methyltransferase; S-adenosyl homocysteine, protein repair; HET: SAH; 1.50A {Homo sapiens} SCOP: c.66.1.7 PDB: 1kr5_A* Back     alignment and structure
>3r0q_C Probable protein arginine N-methyltransferase 4.2; arginine methyltransferase, methylation; HET: SAH; 2.61A {Arabidopsis thaliana} Back     alignment and structure
>2oxt_A Nucleoside-2'-O-methyltransferase; flavivirus, viral enzyme, RNA capping, S-adenosyl-L-methionine, viral protein; HET: SAM; 2.90A {Meaban virus} Back     alignment and structure
>3bzb_A Uncharacterized protein; RED ALGA, protein structure initiat center for eukaryotic structural genomics, CESG, structural genomics; 2.79A {Cyanidioschyzon merolae} Back     alignment and structure
>3fpf_A Mtnas, putative uncharacterized protein; thermonicotianamine, nicotianamine, biosynthetic protein; HET: TNA MTA; 1.66A {Methanothermobacter thermautotrophicusorganism_taxid} PDB: 3fpe_A* 3fph_A* 3fpg_A* 3fpj_A* 3o31_A* Back     alignment and structure
>3hp7_A Hemolysin, putative; structural genomics, APC64019, PSI-2, protein STR initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.53A {Streptococcus thermophilus} Back     alignment and structure
>1wy7_A Hypothetical protein PH1948; seven-stranded beta sheet, methyltransferase fold, structura genomics, transferase; HET: SAH; 2.20A {Pyrococcus horikoshii} SCOP: c.66.1.32 Back     alignment and structure
>1ne2_A Hypothetical protein TA1320; structural genomics, conserved hypothetical protein, PSI, protein structure initiative; 1.75A {Thermoplasma acidophilum} SCOP: c.66.1.32 Back     alignment and structure
>3m33_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, MCSG, midwest center for structural genomics; 2.19A {Deinococcus radiodurans} Back     alignment and structure
>2ift_A Putative methylase HI0767; NESG, Y767_haein, structural genomics, PSI-2, protein structure initiative; 2.30A {Haemophilus influenzae} SCOP: c.66.1.46 Back     alignment and structure
>3gdh_A Trimethylguanosine synthase homolog; M7G, CAP, dimethyltransferase, usnRNA, snoRNA, telomerase, cytoplasm, methyltransferase, nucleus; HET: MGP SAH; 2.00A {Homo sapiens} PDB: 3egi_A* Back     alignment and structure
>3ua3_A Protein arginine N-methyltransferase 5; TIM-barrel, rossmann fold, beta-barrel, symmetric arginine dimethylase, SAM binding; HET: SAH; 3.00A {Caenorhabditis elegans} PDB: 3ua4_A Back     alignment and structure
>3lcc_A Putative methyl chloride transferase; halide methyltransferase; HET: SAH; 1.80A {Arabidopsis thaliana} Back     alignment and structure
>2cmg_A Spermidine synthase; transferase, putrescine aminopropyltransferase, spermidine biosynthesis, polyamine biosynthesis, SPEE; 2.0A {Helicobacter pylori} PDB: 2cmh_A Back     alignment and structure
>3p9n_A Possible methyltransferase (methylase); RV2966C, adoMet binding, RNA methylase, RSMD, SAM-fold, RNA methyltransferase; 1.90A {Mycobacterium tuberculosis} Back     alignment and structure
>3evz_A Methyltransferase; NYSGXRC, NEW YORK SGX research CE structural genomics, protein structure initiative, pyrococc furiosus, PSI-2; 2.20A {Pyrococcus furiosus} Back     alignment and structure
>2avn_A Ubiquinone/menaquinone biosynthesis methyltransfe related protein; ubiquinone/menaquinone biosynthesis methyltransferase-relate protein; HET: SAI; 2.35A {Thermotoga maritima} SCOP: c.66.1.41 Back     alignment and structure
>2fpo_A Methylase YHHF; structural genomics, putative methyltransferase, PSI, protei structure initiative; HET: MSE; 2.05A {Escherichia coli} SCOP: c.66.1.46 Back     alignment and structure
>1r18_A Protein-L-isoaspartate(D-aspartate)-O-methyltrans; methyltransferase, isomerization, protein repair, S-adenosyl homocysteine; HET: SAH; 2.20A {Drosophila melanogaster} SCOP: c.66.1.7 Back     alignment and structure
>4azs_A Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15A {Escherichia coli} PDB: 4azt_A* 4azv_A* 4azw_A* Back     alignment and structure
>3id6_C Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; C/D guide RNA, 2'-O-methylation, coiled-coil, methyltransfer binding, rRNA processing; HET: SAM; 2.60A {Sulfolobus solfataricus} SCOP: c.66.1.0 PDB: 3id5_B* 3pla_E* Back     alignment and structure
>2gb4_A Thiopurine S-methyltransferase; 18204406, thiopurine methyltransferase, structural genomics, PSI, protein structure initiative; HET: SAH; 1.25A {Mus musculus} PDB: 3bgi_A* 3bgd_A* 2bzg_A* 2h11_A* Back     alignment and structure
>2p41_A Type II methyltransferase; vizier, viral enzymes involved in replication, dengue virus methyltransferase, structural genomics; HET: G1G SAH CIT; 1.80A {Dengue virus 2} SCOP: c.66.1.25 PDB: 2p1d_A* 1l9k_A* 2p3o_A* 2p3q_A* 2p40_A* 2p3l_A* 1r6a_A* Back     alignment and structure
>4df3_A Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; NADP rossmann superfamily, S-adenosyl-L-M (SAM) binding, nucleolus; HET: SAM; 1.73A {Aeropyrum pernix} Back     alignment and structure
>1ixk_A Methyltransferase; open beta sheet; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.38 Back     alignment and structure
>2kw5_A SLR1183 protein; structural genomics, northeast structural genomics consortium (NESG), PSI-2, protein structure initiative, unknown function; NMR {Synechocystis} PDB: 3mer_A Back     alignment and structure
>1vlm_A SAM-dependent methyltransferase; possible histamine methyltransferase, structural genomics, JCSG, protein struc initiative, PSI; 2.20A {Thermotoga maritima} SCOP: c.66.1.41 Back     alignment and structure
>2frn_A Hypothetical protein PH0793; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 2.10A {Pyrococcus horikoshii OT3} PDB: 3k6r_A 3a25_A* 3a26_A* Back     alignment and structure
>3tm4_A TRNA (guanine N2-)-methyltransferase TRM14; rossmann fold, thump domain, tRNA methyltransferase; HET: SAM; 1.95A {Pyrococcus furiosus} PDB: 3tlj_A* 3tm5_A* Back     alignment and structure
>2qm3_A Predicted methyltransferase; putative methyltransferase, structural genomics, pyrococcus PSI-2, protein structure initiative; HET: MSE; 2.05A {Pyrococcus furiosus dsm 3638} Back     alignment and structure
>4hc4_A Protein arginine N-methyltransferase 6; HRMT1L6, S-adenosyl-L-homocysteine, struc genomics, structural genomics consortium, SGC; HET: SAH; 1.97A {Homo sapiens} Back     alignment and structure
>1ri5_A MRNA capping enzyme; methyltransferase, M7G, messenger RNA CAP, structural genomics, PSI, protein structure initiative; 2.10A {Encephalitozoon cuniculi} SCOP: c.66.1.34 PDB: 1ri2_A* 1ri3_A* 1ri1_A* 1ri4_A 1z3c_A* 2hv9_A* Back     alignment and structure
>3ajd_A Putative methyltransferase MJ0026; tRNA, M5C, rossmann fold, structural genomics, riken structu genomics/proteomics initiative; 1.27A {Methanocaldococcus jannaschii} PDB: 3a4t_A Back     alignment and structure
>1uwv_A 23S rRNA (uracil-5-)-methyltransferase RUMA; RNA modification, iron-sulfur cluster, RNA processing; 1.95A {Escherichia coli} SCOP: b.40.4.12 c.66.1.40 PDB: 2bh2_A* Back     alignment and structure
>2r6z_A UPF0341 protein in RSP 3' region; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 1.80A {Neisseria gonorrhoeae} Back     alignment and structure
>3htx_A HEN1; HEN1, small RNA methyltransferase, protein-RNA complex; HET: SAH; 3.10A {Arabidopsis thaliana} Back     alignment and structure
>3gcz_A Polyprotein; flavivirus, RNA capping, methyltransferase, viral enzyme STR ATP-binding, nucleotide-binding, RNA replication, structura genomics; HET: SAM; 1.70A {Yokose virus} Back     alignment and structure
>2i62_A Nicotinamide N-methyltransferase; structural genomics, structural genomics consortium, SGC; HET: SAH; 1.80A {Mus musculus} PDB: 2iip_A* 3rod_A* Back     alignment and structure
>2yxl_A PH0851 protein, 450AA long hypothetical FMU protein; FMU-homolog, methyltransferase, structural genomics, NPPSFA; HET: SFG; 2.55A {Pyrococcus horikoshii} Back     alignment and structure
>3dmg_A Probable ribosomal RNA small subunit methyltransf; monomethyltranserase, 16S rRNA methyltransferase, N2 G1207 methyltransferase; HET: SAH; 1.55A {Thermus thermophilus} PDB: 3dmf_A* 3dmh_A* 2zul_A* 2zwv_A* Back     alignment and structure
>1sqg_A SUN protein, FMU protein; rossmann-fold, mixed beta sheet, methyltransferase-fold, RNA-binding domain; 1.65A {Escherichia coli} SCOP: a.79.1.3 c.66.1.38 PDB: 1sqf_A Back     alignment and structure
>2vdw_A Vaccinia virus capping enzyme D1 subunit; nucleotidyltransferase, S-adenosyl-L-methionine, RNA metabolism, mRNA processing, methyltransferase, poxvirus; HET: SAH; 2.70A {Vaccinia virus} Back     alignment and structure
>3evf_A RNA-directed RNA polymerase NS5; NS5 methyltransferase, RNA CAP binding, binding, capsid protein; HET: GTA SAH; 1.45A {Yellow fever virus} SCOP: c.66.1.0 PDB: 3evb_A* 3evc_A* 3evd_A* 3eve_A* 3eva_A* Back     alignment and structure
>2igt_A SAM dependent methyltransferase; alpha-beta sandwich, beta-barrel, structural genomics, PSI-2 structure initiative; HET: MSE SAM GOL; 1.89A {Agrobacterium tumefaciens str} SCOP: c.66.1.51 Back     alignment and structure
>3k0b_A Predicted N6-adenine-specific DNA methylase; methylase,PF01170, putative RNA methylase, PSI,MCSG, structu genomics; 1.50A {Listeria monocytogenes str} Back     alignment and structure
>3ldu_A Putative methylase; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: MSE GTP; 1.70A {Clostridium difficile} Back     alignment and structure
>3lcv_B Sisomicin-gentamicin resistance methylase SGM; antibiotic resistance, methyltransferase, transferase; HET: SAM; 2.00A {Micromonospora zionensis} PDB: 3lcu_A* Back     alignment and structure
>2g72_A Phenylethanolamine N-methyltransferase; HET: SAM F21; 2.00A {Homo sapiens} SCOP: c.66.1.15 PDB: 1yz3_A* 2an4_A* 2an5_A* 2g70_A* 2g71_A* 2an3_A* 2g8n_A* 2ony_A* 3hcb_A* 3hcc_A* 3hcd_A* 3hcf_A* 3kpj_A* 3kpu_A* 3kpv_A* 3kpw_A* 3kpy_A* 3kqm_A* 3kqo_A* 3kqp_A* ... Back     alignment and structure
>2gs9_A Hypothetical protein TT1324; methyl transferase, structural genomics, NPPSFA, national PR protein structural and functional analyses; HET: SAH; 2.60A {Thermus thermophilus} Back     alignment and structure
>2oyr_A UPF0341 protein YHIQ; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAH; 2.00A {Shigella flexneri 2A} SCOP: c.66.1.55 PDB: 2pgx_A 2pkw_A Back     alignment and structure
>3bt7_A TRNA (uracil-5-)-methyltransferase; methyluridine, methyltransferase, TRMA, RUMT; HET: 5MU; 2.43A {Escherichia coli} Back     alignment and structure
>3giw_A Protein of unknown function DUF574; rossmann-fold protein, structural genomics, joint center for structural genomics, JCSG; HET: MSE UNL; 1.45A {Streptomyces avermitilis} PDB: 3go4_A* Back     alignment and structure
>3ldg_A Putative uncharacterized protein SMU.472; YPSC, methyltransferase, transferase; HET: SAH; 1.96A {Streptococcus mutans} Back     alignment and structure
>2jjq_A Uncharacterized RNA methyltransferase pyrab10780; metal-binding, tRNA methyltransferase, S-adenosyl-L-methionine, iron, 4Fe-4S, iron-sulfur; HET: SAH; 1.8A {Pyrococcus abyssi} PDB: 2vs1_A* Back     alignment and structure
>3sso_A Methyltransferase; macrolide, natural product, rossman fold; HET: SAH; 1.90A {Micromonospora griseorubida} PDB: 3ssn_A* 3ssm_A* Back     alignment and structure
>2dul_A N(2),N(2)-dimethylguanosine tRNA methyltransferas; tRNA modification enzyme, guanine 26, N(2),N(2)-dimethyltran structural genomics; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.58 PDB: 2ejt_A* 2eju_A* 2ytz_A* Back     alignment and structure
>3ll7_A Putative methyltransferase; methytransferase, structural genomics, MCSG, PSI-2, protein initiative; HET: MSE; 1.80A {Porphyromonas gingivalis} Back     alignment and structure
>3frh_A 16S rRNA methylase; methyltransferase domain, helical N-terminal domain, methyltransferase, plasmid, transferase; HET: SAH; 1.20A {Escherichia coli} PDB: 3fri_A* 3b89_A* Back     alignment and structure
>3b5i_A S-adenosyl-L-methionine:salicylic acid carboxyl methyltransferase-like protein; sabath family, indole-3-acetic acid, S-AD methionine; HET: SAH; 2.75A {Arabidopsis thaliana} Back     alignment and structure
>2f8l_A Hypothetical protein LMO1582; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE SAM; 2.20A {Listeria monocytogenes} SCOP: c.66.1.45 Back     alignment and structure
>1af7_A Chemotaxis receptor methyltransferase CHER; chemotaxis receptor methylation; HET: SAH; 2.00A {Salmonella typhimurium} SCOP: a.58.1.1 c.66.1.8 PDB: 1bc5_A* Back     alignment and structure
>4dmg_A Putative uncharacterized protein TTHA1493; rRNA, methyltransferase, S-adenosyl-methionine, 23S ribosoma transferase; HET: SAM; 1.70A {Thermus thermophilus} Back     alignment and structure
>2okc_A Type I restriction enzyme stysji M protein; NP_813429.1, N-6 DNA methylase, type I restriction enzyme ST protein; HET: SAM; 2.20A {Bacteroides thetaiotaomicron vpi-5482} SCOP: c.66.1.45 Back     alignment and structure
>2a14_A Indolethylamine N-methyltransferase; SGC,INMT, structural genomics, structural genomics consortium; HET: SAH; 1.70A {Homo sapiens} SCOP: c.66.1.15 Back     alignment and structure
>2py6_A Methyltransferase FKBM; YP_546752.1, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; 2.15A {Methylobacillus flagellatus KT} SCOP: c.66.1.56 Back     alignment and structure
>2b78_A Hypothetical protein SMU.776; structure genomics, methyltransferase, caries, structural genomics, unknown function; 2.00A {Streptococcus mutans} SCOP: b.122.1.9 c.66.1.51 PDB: 3ldf_A* Back     alignment and structure
>1i4w_A Mitochondrial replication protein MTF1; mitochondrial transcription factor, transcription initiation; 2.60A {Saccharomyces cerevisiae} SCOP: c.66.1.24 Back     alignment and structure
>3m6w_A RRNA methylase; rRNA methyltransferase, 5-methylcytidine, RSMF, adoMet, MULT specific, methyltransferase, transferase; HET: CXM SAM; 1.30A {Thermus thermophilus} PDB: 3m6v_A* 3m6u_A* 3m6x_A* Back     alignment and structure
>3c0k_A UPF0064 protein YCCW; PUA domain, adoMet dependent methyltransferase fold; 2.00A {Escherichia coli K12} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 178
d1kyza2 243 c.66.1.12 (A:120-362) Caffeic acid/5-hydroxyferuli 5e-21
d1fp2a2 244 c.66.1.12 (A:109-352) Isoflavone O-methyltransfera 4e-19
d1fp1d2 244 c.66.1.12 (D:129-372) Chalcone O-methyltransferase 8e-18
d1qzza2 256 c.66.1.12 (A:102-357) Aclacinomycin-10-hydroxylase 2e-11
d1tw3a2 253 c.66.1.12 (A:99-351) Carminomycin 4-O-methyltransf 7e-10
d1kyza1107 a.4.5.29 (A:13-119) Caffeic acid/5-hydroxyferulic 8e-08
d1fp1d1110 a.4.5.29 (D:19-128) Chalcone O-methyltransferase { 6e-07
d1fp1d1110 a.4.5.29 (D:19-128) Chalcone O-methyltransferase { 6e-04
>d1kyza2 c.66.1.12 (A:120-362) Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Length = 243 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: S-adenosyl-L-methionine-dependent methyltransferases
superfamily: S-adenosyl-L-methionine-dependent methyltransferases
family: Plant O-methyltransferase, C-terminal domain
domain: Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltransferase
species: Alfalfa (Medicago sativa) [TaxId: 3879]
 Score = 84.5 bits (208), Expect = 5e-21
 Identities = 47/94 (50%), Positives = 62/94 (65%), Gaps = 1/94 (1%)

Query: 66  GVSLAPTLLIIQDKVNMDSWSCVKDALLEGLVPFMKAHNGMDGFAVAAKDEKINNLFNQS 125
           GVS++   L+ QDKV M+SW  +KDA+L+G +PF KA+ GM  F     D + N +FN+ 
Sbjct: 2   GVSISALNLMNQDKVLMESWYHLKDAVLDGGIPFNKAY-GMTAFEYHGTDPRFNKVFNKG 60

Query: 126 MHNHTTIVMKEILETYKGFERLNQFVDVADGLGE 159
           M +H+TI MK+ILETY GFE L   VDV  G G 
Sbjct: 61  MSDHSTITMKKILETYTGFEGLKSLVDVGGGTGA 94


>d1fp2a2 c.66.1.12 (A:109-352) Isoflavone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Length = 244 Back     information, alignment and structure
>d1fp1d2 c.66.1.12 (D:129-372) Chalcone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Length = 244 Back     information, alignment and structure
>d1qzza2 c.66.1.12 (A:102-357) Aclacinomycin-10-hydroxylase RdmB {Streptomyces purpurascens [TaxId: 1924]} Length = 256 Back     information, alignment and structure
>d1tw3a2 c.66.1.12 (A:99-351) Carminomycin 4-O-methyltransferase {Streptomyces peucetius [TaxId: 1950]} Length = 253 Back     information, alignment and structure
>d1kyza1 a.4.5.29 (A:13-119) Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Length = 107 Back     information, alignment and structure
>d1fp1d1 a.4.5.29 (D:19-128) Chalcone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Length = 110 Back     information, alignment and structure
>d1fp1d1 a.4.5.29 (D:19-128) Chalcone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Length = 110 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query178
d1kyza2 243 Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltra 99.92
d1fp1d2 244 Chalcone O-methyltransferase {Alfalfa (Medicago sa 99.91
d1fp2a2 244 Isoflavone O-methyltransferase {Alfalfa (Medicago 99.88
d1qzza2 256 Aclacinomycin-10-hydroxylase RdmB {Streptomyces pu 99.84
d1tw3a2 253 Carminomycin 4-O-methyltransferase {Streptomyces p 99.8
d1fp2a1101 Isoflavone O-methyltransferase {Alfalfa (Medicago 98.68
d1kyza1107 Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltra 97.66
d1fp1d1110 Chalcone O-methyltransferase {Alfalfa (Medicago sa 97.5
d1tw3a185 Carminomycin 4-O-methyltransferase {Streptomyces p 97.4
d2o57a1 282 Putative sarcosine dimethylglycine methyltransfera 97.36
d1dusa_ 194 Hypothetical protein MJ0882 {Archaeon Methanococcu 97.04
d1nkva_ 245 Hypothetical Protein YjhP {Escherichia coli [TaxId 96.85
d1qzza192 Aclacinomycin-10-hydroxylase RdmB {Streptomyces pu 96.82
d2fcaa1 204 tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacil 96.78
d1yzha1 204 tRNA (guanine-N(7)-)-methyltransferase TrmB {Strep 96.77
d1wzna1 251 Hypothetical methyltransferase PH1305 {Archaeon Py 96.74
d1im8a_ 225 Hypothetical protein HI0319 (YecO) {Haemophilus in 96.73
d1l3ia_ 186 Precorrin-6Y methyltransferase (CbiT) {Archaeon Me 96.62
d2i6ga1 198 Putative methyltransferase TehB {Salmonella typhim 96.55
d1kpga_ 285 CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]} 96.53
d1kpia_ 291 CmaA2 {Mycobacterium tuberculosis [TaxId: 1773]} 96.45
d1p91a_ 268 rRNA methyltransferase RlmA {Escherichia coli [Tax 96.43
d1u2za_ 406 Catalytic, N-terminal domain of histone methyltran 96.41
d2fk8a1 280 Methoxy mycolic acid synthase 4, Mma4 {Mycobacteri 96.35
d1ve3a1 226 Hypothetical protein PH0226 {Archaeon Pyrococcus h 96.32
d1nw3a_ 328 Catalytic, N-terminal domain of histone methyltran 96.12
d1xtpa_ 254 Hypothetical protein Lmaj004091aaa (LmjF30.0810) { 96.1
d1y8ca_ 246 Putative methyltransferase CAC2371 {Clostridium ac 96.06
d2b3ta1 274 N5-glutamine methyltransferase, HemK {Escherichia 96.05
d2nxca1 254 PrmA-like protein TTHA0656 (TT0836) {Thermus therm 95.81
d1jqea_ 280 Histamine methyltransferase {Human (Homo sapiens) 95.8
d1zx0a1 229 Guanidinoacetate methyltransferase {Human (Homo sa 95.73
d2avna1 246 Hypothetical methyltransferase TM1389 {Thermotoga 95.69
d1g8sa_ 230 Fibrillarin homologue {Archaeon Methanococcus jann 95.67
d1dl5a1 213 Protein-L-isoaspartyl O-methyltransferase {Thermot 95.55
d2ex4a1 222 Adrenal gland protein AD-003 (C9orf32) {Human (Hom 95.46
d1nt2a_ 209 Fibrillarin homologue {Archaeon Archaeoglobus fulg 95.46
d1vlma_ 208 Possible histamine N-methyltransferase TM1293 {The 95.43
d2fyta1 311 Protein arginine N-methyltransferase 3, PRMT3 {Hum 94.65
d1yb2a1 250 Hypothetical protein Ta0852 {Thermoplasma acidophi 94.53
d1o54a_ 266 Hypothetical protein TM0748 {Thermotoga maritima [ 94.43
d1xvaa_ 292 Glycine N-methyltransferase {Rat (Rattus norvegicu 94.43
d1i9ga_ 264 Probable methyltransferase Rv2118c {Mycobacterium 94.23
d1ne2a_ 197 Hypothetical protein Ta1320 {Archaeon Thermoplasma 94.07
d2h00a1 250 Methyltransferase 10 domain containing protein MET 93.88
d2bzga1 229 Thiopurine S-methyltransferase {Human (Homo sapien 93.83
d1vbfa_ 224 Protein-L-isoaspartyl O-methyltransferase {Sulfolo 93.82
d1oria_ 316 Protein arginine N-methyltransferase 1, PRMT1 {Rat 93.72
d1yuba_ 245 rRNA adenine dimethylase {Streptococcus pneumoniae 93.7
d1g6q1_ 328 Arginine methyltransferase, HMT1 {Baker's yeast (S 93.49
d1wy7a1 201 Hypothetical protein PH1948 {Archaeon Pyrococcus h 93.32
d2b25a1 324 Hypothetical protein FLJ20628 {Human (Homo sapiens 92.28
d1i1na_ 224 Protein-L-isoaspartyl O-methyltransferase {Human ( 91.5
d1ws6a1171 Methyltransferase TTHA0928 {Thermus thermophilus [ 91.36
d1nv8a_ 271 N5-glutamine methyltransferase, HemK {Thermotoga m 91.35
d1g8aa_ 227 Fibrillarin homologue {Archaeon Pyrococcus horikos 90.45
d1jg1a_ 215 Protein-L-isoaspartyl O-methyltransferase {Archaeo 89.92
d2fpoa1 183 Methylase YhhF {Escherichia coli [TaxId: 562]} 89.21
d2a14a1 257 Indolethylamine N-methyltransferase, INMT {Human ( 89.07
d1r18a_ 223 Protein-L-isoaspartyl O-methyltransferase {Fruit f 88.67
d1xdza_ 239 Glucose-inhibited division protein B (GidB) {Bacil 88.22
d1jsxa_ 207 Glucose-inhibited division protein B (GidB) {Esche 86.8
d1uira_ 312 Spermidine synthase {Thermus thermophilus [TaxId: 85.39
d2frna1 260 Hypothetical protein PH0793 {Pyrococcus horikoshii 84.82
d2g72a1 263 Phenylethanolamine N-methyltransferase, PNMTase {H 84.41
d2fhpa1 182 Putative methylase EF2452 {Enterococcus faecalis [ 81.92
d1mjfa_ 276 Putative spermidine synthetase PF0127 (SpeE) {Arch 80.61
>d1kyza2 c.66.1.12 (A:120-362) Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: S-adenosyl-L-methionine-dependent methyltransferases
superfamily: S-adenosyl-L-methionine-dependent methyltransferases
family: Plant O-methyltransferase, C-terminal domain
domain: Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltransferase
species: Alfalfa (Medicago sativa) [TaxId: 3879]
Probab=99.92  E-value=4.9e-25  Score=171.13  Aligned_cols=109  Identities=45%  Similarity=0.704  Sum_probs=102.6

Q ss_pred             CChHHHHHHhcChhhhhhhhhHHHHHhcCCcchhhhccCCchhhhhccChHHHHHHHHHHHhhhHHhHHHHHHhcCCCCC
Q 037090           67 VSLAPTLLIIQDKVNMDSWSCVKDALLEGLVPFMKAHNGMDGFAVAAKDEKINNLFNQSMHNHTTIVMKEILETYKGFER  146 (178)
Q Consensus        67 ~~~~~~v~~~~~~~~~~~~~~L~~~l~~g~~~f~~a~~g~~~~e~~~~~p~~~~~F~~~M~~~~~~~~~~~~~~~~~~~~  146 (178)
                      .|+++++++..++.++++|.+|+++||+|+++|+.+| |.++|+|+.++|+..+.|+++|...+....+.+++.|+.+++
T Consensus         3 ~s~~~~~~~~~~~~~~~~W~~L~~avrtG~~~f~~~~-G~~~~~~~~~~p~~~~~F~~aM~~~~~~~~~~~~~~~~~~~~   81 (243)
T d1kyza2           3 VSISALNLMNQDKVLMESWYHLKDAVLDGGIPFNKAY-GMTAFEYHGTDPRFNKVFNKGMSDHSTITMKKILETYTGFEG   81 (243)
T ss_dssp             CCTHHHHHHHTSHHHHGGGGGHHHHHHHCSCHHHHHH-SSCHHHHGGGCHHHHHHHHHHHHHHHHHHHHHHHHHCCTTSS
T ss_pred             CcHHHHHHHhcCHHHHHHHHHHHHHHhhCCCHHHhhc-CCCHHHHHHhCHHHHHHHHHHHhHhhhhHHHHHHHhcccccC
Confidence            3899999998888899999999999999999999999 999999999999999999999999998888999999983466


Q ss_pred             CCeEEEecCCccHHHHHHHHhcCCCeEEEe
Q 037090          147 LNQFVDVADGLGENKNILLTKISIISLNTI  176 (178)
Q Consensus       147 ~~~vVDVGGg~G~~~~~i~~~~P~l~~~v~  176 (178)
                      .++|||||||+|+++++|+++||+++++++
T Consensus        82 ~~~vvDvGGG~G~~~~~l~~~~P~l~~~v~  111 (243)
T d1kyza2          82 LKSLVDVGGGTGAVINTIVSKYPTIKGINF  111 (243)
T ss_dssp             CSEEEEETCTTSHHHHHHHHHCTTSEEEEE
T ss_pred             CcEEEEecCCCcHHHHHHHHHCCCCeEEEc
Confidence            899999999999999999999999999986



>d1fp1d2 c.66.1.12 (D:129-372) Chalcone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d1fp2a2 c.66.1.12 (A:109-352) Isoflavone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d1qzza2 c.66.1.12 (A:102-357) Aclacinomycin-10-hydroxylase RdmB {Streptomyces purpurascens [TaxId: 1924]} Back     information, alignment and structure
>d1tw3a2 c.66.1.12 (A:99-351) Carminomycin 4-O-methyltransferase {Streptomyces peucetius [TaxId: 1950]} Back     information, alignment and structure
>d1fp2a1 a.4.5.29 (A:8-108) Isoflavone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d1kyza1 a.4.5.29 (A:13-119) Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d1fp1d1 a.4.5.29 (D:19-128) Chalcone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d1tw3a1 a.4.5.29 (A:14-98) Carminomycin 4-O-methyltransferase {Streptomyces peucetius [TaxId: 1950]} Back     information, alignment and structure
>d2o57a1 c.66.1.18 (A:16-297) Putative sarcosine dimethylglycine methyltransferase {Red algae (Galdieria sulphuraria) [TaxId: 130081]} Back     information, alignment and structure
>d1dusa_ c.66.1.4 (A:) Hypothetical protein MJ0882 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1nkva_ c.66.1.21 (A:) Hypothetical Protein YjhP {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qzza1 a.4.5.29 (A:10-101) Aclacinomycin-10-hydroxylase RdmB {Streptomyces purpurascens [TaxId: 1924]} Back     information, alignment and structure
>d2fcaa1 c.66.1.53 (A:10-213) tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1yzha1 c.66.1.53 (A:8-211) tRNA (guanine-N(7)-)-methyltransferase TrmB {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1wzna1 c.66.1.43 (A:1-251) Hypothetical methyltransferase PH1305 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1im8a_ c.66.1.14 (A:) Hypothetical protein HI0319 (YecO) {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1l3ia_ c.66.1.22 (A:) Precorrin-6Y methyltransferase (CbiT) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d2i6ga1 c.66.1.44 (A:1-198) Putative methyltransferase TehB {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1kpga_ c.66.1.18 (A:) CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1kpia_ c.66.1.18 (A:) CmaA2 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1p91a_ c.66.1.33 (A:) rRNA methyltransferase RlmA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1u2za_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2fk8a1 c.66.1.18 (A:22-301) Methoxy mycolic acid synthase 4, Mma4 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ve3a1 c.66.1.43 (A:2-227) Hypothetical protein PH0226 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1nw3a_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xtpa_ c.66.1.42 (A:) Hypothetical protein Lmaj004091aaa (LmjF30.0810) {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1y8ca_ c.66.1.43 (A:) Putative methyltransferase CAC2371 {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d2b3ta1 c.66.1.30 (A:2-275) N5-glutamine methyltransferase, HemK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2nxca1 c.66.1.39 (A:1-254) PrmA-like protein TTHA0656 (TT0836) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1jqea_ c.66.1.19 (A:) Histamine methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zx0a1 c.66.1.16 (A:8-236) Guanidinoacetate methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2avna1 c.66.1.41 (A:1-246) Hypothetical methyltransferase TM1389 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1g8sa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1dl5a1 c.66.1.7 (A:1-213) Protein-L-isoaspartyl O-methyltransferase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2ex4a1 c.66.1.42 (A:2-224) Adrenal gland protein AD-003 (C9orf32) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nt2a_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1vlma_ c.66.1.41 (A:) Possible histamine N-methyltransferase TM1293 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2fyta1 c.66.1.6 (A:238-548) Protein arginine N-methyltransferase 3, PRMT3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yb2a1 c.66.1.13 (A:6-255) Hypothetical protein Ta0852 {Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1o54a_ c.66.1.13 (A:) Hypothetical protein TM0748 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1xvaa_ c.66.1.5 (A:) Glycine N-methyltransferase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1i9ga_ c.66.1.13 (A:) Probable methyltransferase Rv2118c {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ne2a_ c.66.1.32 (A:) Hypothetical protein Ta1320 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d2h00a1 c.66.1.54 (A:5-254) Methyltransferase 10 domain containing protein METT10D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bzga1 c.66.1.36 (A:17-245) Thiopurine S-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vbfa_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1oria_ c.66.1.6 (A:) Protein arginine N-methyltransferase 1, PRMT1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1yuba_ c.66.1.24 (A:) rRNA adenine dimethylase {Streptococcus pneumoniae, Ermam [TaxId: 1313]} Back     information, alignment and structure
>d1g6q1_ c.66.1.6 (1:) Arginine methyltransferase, HMT1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wy7a1 c.66.1.32 (A:4-204) Hypothetical protein PH1948 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2b25a1 c.66.1.13 (A:6-329) Hypothetical protein FLJ20628 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i1na_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ws6a1 c.66.1.46 (A:15-185) Methyltransferase TTHA0928 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1nv8a_ c.66.1.30 (A:) N5-glutamine methyltransferase, HemK {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1g8aa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1jg1a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2fpoa1 c.66.1.46 (A:10-192) Methylase YhhF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2a14a1 c.66.1.15 (A:5-261) Indolethylamine N-methyltransferase, INMT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r18a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1xdza_ c.66.1.20 (A:) Glucose-inhibited division protein B (GidB) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1jsxa_ c.66.1.20 (A:) Glucose-inhibited division protein B (GidB) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1uira_ c.66.1.17 (A:) Spermidine synthase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2frna1 c.66.1.47 (A:19-278) Hypothetical protein PH0793 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2g72a1 c.66.1.15 (A:18-280) Phenylethanolamine N-methyltransferase, PNMTase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fhpa1 c.66.1.46 (A:1-182) Putative methylase EF2452 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1mjfa_ c.66.1.17 (A:) Putative spermidine synthetase PF0127 (SpeE) {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure