Citrus Sinensis ID: 037210
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 73 | ||||||
| 225423481 | 340 | PREDICTED: uncharacterized hydrolase yug | 0.986 | 0.211 | 0.791 | 3e-26 | |
| 224108884 | 335 | predicted protein [Populus trichocarpa] | 0.986 | 0.214 | 0.791 | 4e-26 | |
| 356577153 | 346 | PREDICTED: uncharacterized hydrolase yug | 0.972 | 0.205 | 0.732 | 7e-24 | |
| 357475035 | 331 | 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoat | 0.958 | 0.211 | 0.728 | 2e-23 | |
| 255542046 | 340 | alpha/beta hydrolase, putative [Ricinus | 0.931 | 0.2 | 0.735 | 2e-23 | |
| 359806911 | 344 | uncharacterized protein LOC100800197 [Gl | 0.986 | 0.209 | 0.694 | 2e-23 | |
| 449452861 | 338 | PREDICTED: uncharacterized hydrolase Yug | 0.986 | 0.213 | 0.722 | 1e-22 | |
| 356494991 | 343 | PREDICTED: 2-hydroxy-6-oxononadienedioat | 0.986 | 0.209 | 0.680 | 2e-22 | |
| 357487589 | 355 | 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoat | 0.986 | 0.202 | 0.694 | 2e-21 | |
| 8778385 | 633 | F16A14.4 [Arabidopsis thaliana] | 0.863 | 0.099 | 0.730 | 8e-21 |
| >gi|225423481|ref|XP_002274292.1| PREDICTED: uncharacterized hydrolase yugF [Vitis vinifera] gi|297738082|emb|CBI27283.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 122 bits (306), Expect = 3e-26, Method: Compositional matrix adjust.
Identities = 57/72 (79%), Positives = 65/72 (90%)
Query: 1 VKQKTLIIWGEDDQIISSKLAVRLHCELPNAIIRQIPDCGHLPHVEKPGAVAKLIVEFIQ 60
VK+KTLIIWGEDDQIIS+KLAVRLHCELPNAII QIPDCGHLPHVEKP +V+KLI+EF+Q
Sbjct: 268 VKKKTLIIWGEDDQIISNKLAVRLHCELPNAIISQIPDCGHLPHVEKPHSVSKLIMEFVQ 327
Query: 61 ENCISEPQLVSQ 72
E+ E Q +SQ
Sbjct: 328 EDSYKEAQCISQ 339
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|224108884|ref|XP_002315003.1| predicted protein [Populus trichocarpa] gi|222864043|gb|EEF01174.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|356577153|ref|XP_003556692.1| PREDICTED: uncharacterized hydrolase yugF-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|357475035|ref|XP_003607803.1| 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase [Medicago truncatula] gi|355508858|gb|AES90000.1| 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|255542046|ref|XP_002512087.1| alpha/beta hydrolase, putative [Ricinus communis] gi|223549267|gb|EEF50756.1| alpha/beta hydrolase, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|359806911|ref|NP_001241322.1| uncharacterized protein LOC100800197 [Glycine max] gi|255639051|gb|ACU19826.1| unknown [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|449452861|ref|XP_004144177.1| PREDICTED: uncharacterized hydrolase YugF-like [Cucumis sativus] gi|449529427|ref|XP_004171701.1| PREDICTED: uncharacterized hydrolase YugF-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|356494991|ref|XP_003516364.1| PREDICTED: 2-hydroxy-6-oxononadienedioate/2-hydroxy-6- oxononatrienedioate hydrolase-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|357487589|ref|XP_003614082.1| 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase [Medicago truncatula] gi|355515417|gb|AES97040.1| 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|8778385|gb|AAF79393.1|AC068197_3 F16A14.4 [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 73 | ||||||
| TAIR|locus:2014774 | 339 | AT1G13820 [Arabidopsis thalian | 0.863 | 0.185 | 0.730 | 4.9e-21 | |
| TAIR|locus:2157260 | 330 | AT5G39220 [Arabidopsis thalian | 0.794 | 0.175 | 0.534 | 7.3e-14 | |
| UNIPROTKB|Q74EB1 | 302 | GSU1052 "Hydrolase or acyltran | 0.794 | 0.192 | 0.465 | 1.3e-07 | |
| TIGR_CMR|GSU_1052 | 302 | GSU_1052 "hydrolase, alpha/bet | 0.794 | 0.192 | 0.465 | 1.3e-07 | |
| UNIPROTKB|E2QVK3 | 337 | ABHD6 "Uncharacterized protein | 0.808 | 0.175 | 0.372 | 1.2e-05 | |
| TAIR|locus:2194744 | 314 | AT1G78210 [Arabidopsis thalian | 0.917 | 0.213 | 0.385 | 1.3e-05 | |
| UNIPROTKB|Q81K69 | 279 | BAS4774 "Hydrolase, alpha/beta | 0.794 | 0.207 | 0.379 | 1.3e-05 | |
| TIGR_CMR|BA_5136 | 279 | BA_5136 "hydrolase, alpha/beta | 0.794 | 0.207 | 0.379 | 1.3e-05 | |
| MGI|MGI:1913332 | 336 | Abhd6 "abhydrolase domain cont | 0.808 | 0.175 | 0.372 | 1.5e-05 | |
| UNIPROTKB|Q1LZ86 | 337 | ABHD6 "Monoacylglycerol lipase | 0.808 | 0.175 | 0.355 | 1.5e-05 |
| TAIR|locus:2014774 AT1G13820 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 247 (92.0 bits), Expect = 4.9e-21, P = 4.9e-21
Identities = 46/63 (73%), Positives = 53/63 (84%)
Query: 1 VKQKTLIIWGEDDQIISSKLAVRLHCELPNAIIRQIPDCGHLPHVEKPGAVAKLIVEFIQ 60
V QKTLI+WGEDDQIIS+KLA RLH EL NA ++QI +CGHLPHVEKP AV KLI EF++
Sbjct: 268 VSQKTLILWGEDDQIISNKLAWRLHGELSNARVKQISNCGHLPHVEKPAAVTKLIAEFVR 327
Query: 61 ENC 63
E C
Sbjct: 328 ETC 330
|
|
| TAIR|locus:2157260 AT5G39220 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q74EB1 GSU1052 "Hydrolase or acyltransferase, alpha/beta fold family" [Geobacter sulfurreducens PCA (taxid:243231)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|GSU_1052 GSU_1052 "hydrolase, alpha/beta fold family" [Geobacter sulfurreducens PCA (taxid:243231)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2QVK3 ABHD6 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2194744 AT1G78210 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q81K69 BAS4774 "Hydrolase, alpha/beta fold family" [Bacillus anthracis (taxid:1392)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|BA_5136 BA_5136 "hydrolase, alpha/beta fold family" [Bacillus anthracis str. Ames (taxid:198094)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1913332 Abhd6 "abhydrolase domain containing 6" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q1LZ86 ABHD6 "Monoacylglycerol lipase ABHD6" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 73 | |||
| COG0596 | 282 | COG0596, MhpC, Predicted hydrolases or acyltransfe | 7e-13 | |
| PRK14875 | 371 | PRK14875, PRK14875, acetoin dehydrogenase E2 subun | 5e-12 | |
| pfam12697 | 187 | pfam12697, Abhydrolase_6, Alpha/beta hydrolase fam | 6e-12 | |
| pfam00561 | 226 | pfam00561, Abhydrolase_1, alpha/beta hydrolase fol | 6e-10 | |
| TIGR03343 | 282 | TIGR03343, biphenyl_bphD, 2-hydroxy-6-oxo-6-phenyl | 4e-07 | |
| TIGR03695 | 252 | TIGR03695, menH_SHCHC, 2-succinyl-6-hydroxy-2,4-cy | 4e-07 | |
| TIGR03056 | 278 | TIGR03056, bchO_mg_che_rel, putative magnesium che | 1e-06 | |
| TIGR01250 | 289 | TIGR01250, pro_imino_pep_2, proline-specific pepti | 4e-06 | |
| TIGR02427 | 251 | TIGR02427, protocat_pcaD, 3-oxoadipate enol-lacton | 3e-05 | |
| TIGR02240 | 276 | TIGR02240, PHA_depoly_arom, poly(3-hydroxyalkanoat | 5e-05 | |
| PLN02578 | 354 | PLN02578, PLN02578, hydrolase | 0.002 | |
| COG2267 | 298 | COG2267, PldB, Lysophospholipase [Lipid metabolism | 0.002 |
| >gnl|CDD|223669 COG0596, MhpC, Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) [General function prediction only] | Back alignment and domain information |
|---|
Score = 60.8 bits (146), Expect = 7e-13
Identities = 27/57 (47%), Positives = 37/57 (64%), Gaps = 1/57 (1%)
Query: 5 TLIIWGEDDQIISSKLAVRLHCELPN-AIIRQIPDCGHLPHVEKPGAVAKLIVEFIQ 60
TLII GEDD ++ ++LA RL LPN A + IP GH PH+E P A A ++ F++
Sbjct: 224 TLIIHGEDDPVVPAELARRLAAALPNDARLVVIPGAGHFPHLEAPEAFAAALLAFLE 280
|
Length = 282 |
| >gnl|CDD|184875 PRK14875, PRK14875, acetoin dehydrogenase E2 subunit dihydrolipoyllysine-residue acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|221720 pfam12697, Abhydrolase_6, Alpha/beta hydrolase family | Back alignment and domain information |
|---|
| >gnl|CDD|201306 pfam00561, Abhydrolase_1, alpha/beta hydrolase fold | Back alignment and domain information |
|---|
| >gnl|CDD|132386 TIGR03343, biphenyl_bphD, 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase | Back alignment and domain information |
|---|
| >gnl|CDD|234315 TIGR03695, menH_SHCHC, 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase | Back alignment and domain information |
|---|
| >gnl|CDD|132100 TIGR03056, bchO_mg_che_rel, putative magnesium chelatase accessory protein | Back alignment and domain information |
|---|
| >gnl|CDD|188121 TIGR01250, pro_imino_pep_2, proline-specific peptidase, Bacillus coagulans-type subfamily | Back alignment and domain information |
|---|
| >gnl|CDD|131480 TIGR02427, protocat_pcaD, 3-oxoadipate enol-lactonase | Back alignment and domain information |
|---|
| >gnl|CDD|131294 TIGR02240, PHA_depoly_arom, poly(3-hydroxyalkanoate) depolymerase | Back alignment and domain information |
|---|
| >gnl|CDD|215315 PLN02578, PLN02578, hydrolase | Back alignment and domain information |
|---|
| >gnl|CDD|225176 COG2267, PldB, Lysophospholipase [Lipid metabolism] | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 73 | |||
| PLN02965 | 255 | Probable pheophorbidase | 99.61 | |
| TIGR03343 | 282 | biphenyl_bphD 2-hydroxy-6-oxo-6-phenylhexa-2,4-die | 99.6 | |
| TIGR01738 | 245 | bioH putative pimeloyl-BioC--CoA transferase BioH. | 99.58 | |
| PRK10349 | 256 | carboxylesterase BioH; Provisional | 99.57 | |
| PLN02679 | 360 | hydrolase, alpha/beta fold family protein | 99.54 | |
| PLN02824 | 294 | hydrolase, alpha/beta fold family protein | 99.54 | |
| KOG1454 | 326 | consensus Predicted hydrolase/acyltransferase (alp | 99.53 | |
| TIGR03056 | 278 | bchO_mg_che_rel putative magnesium chelatase acces | 99.52 | |
| PRK10673 | 255 | acyl-CoA esterase; Provisional | 99.52 | |
| PLN03087 | 481 | BODYGUARD 1 domain containing hydrolase; Provision | 99.5 | |
| TIGR03611 | 257 | RutD pyrimidine utilization protein D. This protei | 99.5 | |
| PRK03592 | 295 | haloalkane dehalogenase; Provisional | 99.5 | |
| PRK03204 | 286 | haloalkane dehalogenase; Provisional | 99.5 | |
| TIGR02240 | 276 | PHA_depoly_arom poly(3-hydroxyalkanoate) depolymer | 99.49 | |
| PRK07581 | 339 | hypothetical protein; Validated | 99.47 | |
| PRK00870 | 302 | haloalkane dehalogenase; Provisional | 99.47 | |
| PLN02578 | 354 | hydrolase | 99.46 | |
| PRK08775 | 343 | homoserine O-acetyltransferase; Provisional | 99.46 | |
| PRK06489 | 360 | hypothetical protein; Provisional | 99.45 | |
| TIGR02427 | 251 | protocat_pcaD 3-oxoadipate enol-lactonase. Members | 99.45 | |
| PRK00175 | 379 | metX homoserine O-acetyltransferase; Provisional | 99.44 | |
| TIGR01392 | 351 | homoserO_Ac_trn homoserine O-acetyltransferase. Th | 99.42 | |
| PLN03084 | 383 | alpha/beta hydrolase fold protein; Provisional | 99.41 | |
| PLN02385 | 349 | hydrolase; alpha/beta fold family protein | 99.41 | |
| TIGR01250 | 288 | pro_imino_pep_2 proline-specific peptidases, Bacil | 99.39 | |
| PHA02857 | 276 | monoglyceride lipase; Provisional | 99.34 | |
| PLN02298 | 330 | hydrolase, alpha/beta fold family protein | 99.31 | |
| TIGR03695 | 251 | menH_SHCHC 2-succinyl-6-hydroxy-2,4-cyclohexadiene | 99.31 | |
| PF12697 | 228 | Abhydrolase_6: Alpha/beta hydrolase family; PDB: 3 | 99.31 | |
| KOG2382 | 315 | consensus Predicted alpha/beta hydrolase [General | 99.29 | |
| PF00561 | 230 | Abhydrolase_1: alpha/beta hydrolase fold A web pag | 99.28 | |
| PRK06765 | 389 | homoserine O-acetyltransferase; Provisional | 99.28 | |
| PLN02894 | 402 | hydrolase, alpha/beta fold family protein | 99.27 | |
| PRK11126 | 242 | 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxyl | 99.27 | |
| PLN02980 | 1655 | 2-oxoglutarate decarboxylase/ hydro-lyase/ magnesi | 99.26 | |
| PLN02211 | 273 | methyl indole-3-acetate methyltransferase | 99.25 | |
| PRK10749 | 330 | lysophospholipase L2; Provisional | 99.24 | |
| KOG2984 | 277 | consensus Predicted hydrolase [General function pr | 99.24 | |
| PRK14875 | 371 | acetoin dehydrogenase E2 subunit dihydrolipoyllysi | 99.22 | |
| PLN02652 | 395 | hydrolase; alpha/beta fold family protein | 99.2 | |
| KOG4178 | 322 | consensus Soluble epoxide hydrolase [Lipid transpo | 99.19 | |
| PRK05855 | 582 | short chain dehydrogenase; Validated | 99.17 | |
| PLN02511 | 388 | hydrolase | 99.17 | |
| TIGR01249 | 306 | pro_imino_pep_1 proline iminopeptidase, Neisseria- | 99.03 | |
| KOG4409 | 365 | consensus Predicted hydrolase/acyltransferase (alp | 98.98 | |
| PRK10985 | 324 | putative hydrolase; Provisional | 98.96 | |
| PRK05077 | 414 | frsA fermentation/respiration switch protein; Revi | 98.91 | |
| TIGR01607 | 332 | PST-A Plasmodium subtelomeric family (PST-A). Thes | 98.88 | |
| PRK07868 | 994 | acyl-CoA synthetase; Validated | 98.86 | |
| COG0596 | 282 | MhpC Predicted hydrolases or acyltransferases (alp | 98.83 | |
| PF08386 | 103 | Abhydrolase_4: TAP-like protein; InterPro: IPR0135 | 98.82 | |
| PF00326 | 213 | Peptidase_S9: Prolyl oligopeptidase family This fa | 98.81 | |
| COG3208 | 244 | GrsT Predicted thioesterase involved in non-riboso | 98.81 | |
| PLN02872 | 395 | triacylglycerol lipase | 98.79 | |
| TIGR03100 | 274 | hydr1_PEP hydrolase, ortholog 1, exosortase system | 98.76 | |
| TIGR01836 | 350 | PHA_synth_III_C poly(R)-hydroxyalkanoic acid synth | 98.72 | |
| COG2267 | 298 | PldB Lysophospholipase [Lipid metabolism] | 98.69 | |
| TIGR01838 | 532 | PHA_synth_I poly(R)-hydroxyalkanoic acid synthase, | 98.65 | |
| COG1647 | 243 | Esterase/lipase [General function prediction only] | 98.6 | |
| KOG1552 | 258 | consensus Predicted alpha/beta hydrolase [General | 98.53 | |
| PRK13604 | 307 | luxD acyl transferase; Provisional | 98.51 | |
| PRK11071 | 190 | esterase YqiA; Provisional | 98.51 | |
| COG1506 | 620 | DAP2 Dipeptidyl aminopeptidases/acylaminoacyl-pept | 98.49 | |
| PRK11460 | 232 | putative hydrolase; Provisional | 98.47 | |
| PRK10566 | 249 | esterase; Provisional | 98.46 | |
| PF12695 | 145 | Abhydrolase_5: Alpha/beta hydrolase family; PDB: 3 | 98.44 | |
| KOG1455 | 313 | consensus Lysophospholipase [Lipid transport and m | 98.42 | |
| KOG2551 | 230 | consensus Phospholipase/carboxyhydrolase [Amino ac | 98.41 | |
| PF01738 | 218 | DLH: Dienelactone hydrolase family; InterPro: IPR0 | 98.39 | |
| COG0429 | 345 | Predicted hydrolase of the alpha/beta-hydrolase fo | 98.32 | |
| KOG4391 | 300 | consensus Predicted alpha/beta hydrolase BEM46 [Ge | 98.23 | |
| KOG4667 | 269 | consensus Predicted esterase [Lipid transport and | 98.23 | |
| PF00450 | 415 | Peptidase_S10: Serine carboxypeptidase; InterPro: | 98.17 | |
| KOG2931 | 326 | consensus Differentiation-related gene 1 protein ( | 98.12 | |
| PF02230 | 216 | Abhydrolase_2: Phospholipase/Carboxylesterase; Int | 98.1 | |
| PF03096 | 283 | Ndr: Ndr family; InterPro: IPR004142 This family c | 98.09 | |
| PF03959 | 212 | FSH1: Serine hydrolase (FSH1); InterPro: IPR005645 | 98.07 | |
| PTZ00472 | 462 | serine carboxypeptidase (CBP1); Provisional | 98.06 | |
| PF05705 | 240 | DUF829: Eukaryotic protein of unknown function (DU | 98.05 | |
| PF06821 | 171 | Ser_hydrolase: Serine hydrolase; InterPro: IPR0106 | 97.97 | |
| PF10142 | 367 | PhoPQ_related: PhoPQ-activated pathogenicity-relat | 97.96 | |
| TIGR01849 | 406 | PHB_depoly_PhaZ polyhydroxyalkanoate depolymerase, | 97.95 | |
| PF08840 | 213 | BAAT_C: BAAT / Acyl-CoA thioester hydrolase C term | 97.94 | |
| COG2945 | 210 | Predicted hydrolase of the alpha/beta superfamily | 97.94 | |
| KOG3043 | 242 | consensus Predicted hydrolase related to dienelact | 97.91 | |
| PLN02213 | 319 | sinapoylglucose-malate O-sinapoyltransferase/ carb | 97.89 | |
| PLN02209 | 437 | serine carboxypeptidase | 97.83 | |
| PF05448 | 320 | AXE1: Acetyl xylan esterase (AXE1); InterPro: IPR0 | 97.79 | |
| COG1073 | 299 | Hydrolases of the alpha/beta superfamily [General | 97.77 | |
| PLN03016 | 433 | sinapoylglucose-malate O-sinapoyltransferase | 97.77 | |
| KOG1282 | 454 | consensus Serine carboxypeptidases (lysosomal cath | 97.76 | |
| PF09752 | 348 | DUF2048: Uncharacterized conserved protein (DUF204 | 97.73 | |
| COG2021 | 368 | MET2 Homoserine acetyltransferase [Amino acid tran | 97.69 | |
| KOG1838 | 409 | consensus Alpha/beta hydrolase [General function p | 97.47 | |
| COG0400 | 207 | Predicted esterase [General function prediction on | 97.46 | |
| PLN02442 | 283 | S-formylglutathione hydrolase | 97.46 | |
| COG0412 | 236 | Dienelactone hydrolase and related enzymes [Second | 97.43 | |
| KOG2564 | 343 | consensus Predicted acetyltransferases and hydrola | 97.31 | |
| COG4757 | 281 | Predicted alpha/beta hydrolase [General function p | 97.26 | |
| COG3243 | 445 | PhaC Poly(3-hydroxyalkanoate) synthetase [Lipid me | 97.17 | |
| PRK05371 | 767 | x-prolyl-dipeptidyl aminopeptidase; Provisional | 97.13 | |
| PF08538 | 303 | DUF1749: Protein of unknown function (DUF1749); In | 97.12 | |
| PRK10162 | 318 | acetyl esterase; Provisional | 97.08 | |
| TIGR01839 | 560 | PHA_synth_II poly(R)-hydroxyalkanoic acid synthase | 97.02 | |
| TIGR02821 | 275 | fghA_ester_D S-formylglutathione hydrolase. This m | 96.91 | |
| KOG3975 | 301 | consensus Uncharacterized conserved protein [Funct | 96.74 | |
| COG3571 | 213 | Predicted hydrolase of the alpha/beta-hydrolase fo | 96.73 | |
| COG3545 | 181 | Predicted esterase of the alpha/beta hydrolase fol | 96.71 | |
| KOG3253 | 784 | consensus Predicted alpha/beta hydrolase [General | 96.69 | |
| PF02273 | 294 | Acyl_transf_2: Acyl transferase; InterPro: IPR0031 | 96.64 | |
| PF06850 | 202 | PHB_depo_C: PHB de-polymerase C-terminus; InterPro | 96.63 | |
| PF05728 | 187 | UPF0227: Uncharacterised protein family (UPF0227); | 96.62 | |
| PF07859 | 211 | Abhydrolase_3: alpha/beta hydrolase fold A web pag | 96.49 | |
| PF00975 | 229 | Thioesterase: Thioesterase domain; InterPro: IPR00 | 96.36 | |
| PRK10115 | 686 | protease 2; Provisional | 96.33 | |
| KOG1551 | 371 | consensus Uncharacterized conserved protein [Funct | 96.28 | |
| KOG1515 | 336 | consensus Arylacetamide deacetylase [Defense mecha | 96.13 | |
| PF06342 | 297 | DUF1057: Alpha/beta hydrolase of unknown function | 96.08 | |
| PF03583 | 290 | LIP: Secretory lipase ; InterPro: IPR005152 This e | 96.02 | |
| PF06500 | 411 | DUF1100: Alpha/beta hydrolase of unknown function | 95.66 | |
| COG0657 | 312 | Aes Esterase/lipase [Lipid metabolism] | 95.39 | |
| COG4287 | 507 | PqaA PhoPQ-activated pathogenicity-related protein | 95.35 | |
| PF06057 | 192 | VirJ: Bacterial virulence protein (VirJ); InterPro | 95.31 | |
| KOG2565 | 469 | consensus Predicted hydrolases or acyltransferases | 95.24 | |
| COG3458 | 321 | Acetyl esterase (deacetylase) [Secondary metabolit | 95.0 | |
| PF11339 | 581 | DUF3141: Protein of unknown function (DUF3141); In | 94.92 | |
| PF04301 | 213 | DUF452: Protein of unknown function (DUF452); Inte | 94.73 | |
| PLN00021 | 313 | chlorophyllase | 94.15 | |
| KOG2100 | 755 | consensus Dipeptidyl aminopeptidase [Posttranslati | 94.14 | |
| PF10230 | 266 | DUF2305: Uncharacterised conserved protein (DUF230 | 94.12 | |
| KOG2624 | 403 | consensus Triglyceride lipase-cholesterol esterase | 93.99 | |
| KOG2112 | 206 | consensus Lysophospholipase [Lipid transport and m | 93.67 | |
| PF05576 | 448 | Peptidase_S37: PS-10 peptidase S37; InterPro: IPR0 | 93.05 | |
| COG4188 | 365 | Predicted dienelactone hydrolase [General function | 92.93 | |
| PF07519 | 474 | Tannase: Tannase and feruloyl esterase; InterPro: | 92.41 | |
| KOG4627 | 270 | consensus Kynurenine formamidase [Amino acid trans | 91.37 | |
| smart00824 | 212 | PKS_TE Thioesterase. Peptide synthetases are invol | 91.11 | |
| TIGR01840 | 212 | esterase_phb esterase, PHB depolymerase family. Th | 90.6 | |
| PRK10252 | 1296 | entF enterobactin synthase subunit F; Provisional | 88.73 | |
| COG2939 | 498 | Carboxypeptidase C (cathepsin A) [Amino acid trans | 88.54 | |
| PF02129 | 272 | Peptidase_S15: X-Pro dipeptidyl-peptidase (S15 fam | 88.46 | |
| COG4553 | 415 | DepA Poly-beta-hydroxyalkanoate depolymerase [Lipi | 88.42 | |
| PF06028 | 255 | DUF915: Alpha/beta hydrolase of unknown function ( | 87.54 | |
| KOG2521 | 350 | consensus Uncharacterized conserved protein [Funct | 86.91 | |
| PRK04940 | 180 | hypothetical protein; Provisional | 84.63 | |
| PF10503 | 220 | Esterase_phd: Esterase PHB depolymerase | 84.38 | |
| COG3946 | 456 | VirJ Type IV secretory pathway, VirJ component [In | 80.87 |
| >PLN02965 Probable pheophorbidase | Back alignment and domain information |
|---|
Probab=99.61 E-value=6.5e-15 Score=81.15 Aligned_cols=62 Identities=13% Similarity=0.136 Sum_probs=58.6
Q ss_pred CCccEEEEEcCCCcccCHHHHHHHHhhCCCcEEEEeCCCCccCCccChHHHHHHHHHHHhhc
Q 037210 1 VKQKTLIIWGEDDQIISSKLAVRLHCELPNAIIRQIPDCGHLPHVEKPGAVAKLIVEFIQEN 62 (73)
Q Consensus 1 i~~p~l~i~g~~d~~~~~~~~~~~~~~~~~~~~~~~~~~~H~~~~~~~~~~~~~~~~~~~~~ 62 (73)
+++|+++++|++|..+++...+.+.+.+++.++.+++++||+++.|+|+.+++.+.+|++..
T Consensus 192 i~vP~lvi~g~~D~~~~~~~~~~~~~~~~~a~~~~i~~~GH~~~~e~p~~v~~~l~~~~~~~ 253 (255)
T PLN02965 192 EKVPRVYIKTAKDNLFDPVRQDVMVENWPPAQTYVLEDSDHSAFFSVPTTLFQYLLQAVSSL 253 (255)
T ss_pred CCCCEEEEEcCCCCCCCHHHHHHHHHhCCcceEEEecCCCCchhhcCHHHHHHHHHHHHHHh
Confidence 57999999999999999999999999999999999999999999999999999999998764
|
|
| >TIGR03343 biphenyl_bphD 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase | Back alignment and domain information |
|---|
| >TIGR01738 bioH putative pimeloyl-BioC--CoA transferase BioH | Back alignment and domain information |
|---|
| >PRK10349 carboxylesterase BioH; Provisional | Back alignment and domain information |
|---|
| >PLN02679 hydrolase, alpha/beta fold family protein | Back alignment and domain information |
|---|
| >PLN02824 hydrolase, alpha/beta fold family protein | Back alignment and domain information |
|---|
| >KOG1454 consensus Predicted hydrolase/acyltransferase (alpha/beta hydrolase superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR03056 bchO_mg_che_rel putative magnesium chelatase accessory protein | Back alignment and domain information |
|---|
| >PRK10673 acyl-CoA esterase; Provisional | Back alignment and domain information |
|---|
| >PLN03087 BODYGUARD 1 domain containing hydrolase; Provisional | Back alignment and domain information |
|---|
| >TIGR03611 RutD pyrimidine utilization protein D | Back alignment and domain information |
|---|
| >PRK03592 haloalkane dehalogenase; Provisional | Back alignment and domain information |
|---|
| >PRK03204 haloalkane dehalogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR02240 PHA_depoly_arom poly(3-hydroxyalkanoate) depolymerase | Back alignment and domain information |
|---|
| >PRK07581 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK00870 haloalkane dehalogenase; Provisional | Back alignment and domain information |
|---|
| >PLN02578 hydrolase | Back alignment and domain information |
|---|
| >PRK08775 homoserine O-acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK06489 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02427 protocat_pcaD 3-oxoadipate enol-lactonase | Back alignment and domain information |
|---|
| >PRK00175 metX homoserine O-acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR01392 homoserO_Ac_trn homoserine O-acetyltransferase | Back alignment and domain information |
|---|
| >PLN03084 alpha/beta hydrolase fold protein; Provisional | Back alignment and domain information |
|---|
| >PLN02385 hydrolase; alpha/beta fold family protein | Back alignment and domain information |
|---|
| >TIGR01250 pro_imino_pep_2 proline-specific peptidases, Bacillus coagulans-type subfamily | Back alignment and domain information |
|---|
| >PHA02857 monoglyceride lipase; Provisional | Back alignment and domain information |
|---|
| >PLN02298 hydrolase, alpha/beta fold family protein | Back alignment and domain information |
|---|
| >TIGR03695 menH_SHCHC 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase | Back alignment and domain information |
|---|
| >PF12697 Abhydrolase_6: Alpha/beta hydrolase family; PDB: 3LLC_A 3A2N_E 3A2M_A 3A2L_A 3AFI_F 3C5V_A 3C5W_P 3E0X_A 2ZJF_A 3QYJ_A | Back alignment and domain information |
|---|
| >KOG2382 consensus Predicted alpha/beta hydrolase [General function prediction only] | Back alignment and domain information |
|---|
| >PF00561 Abhydrolase_1: alpha/beta hydrolase fold A web page of Esterases and alpha/beta hydrolases | Back alignment and domain information |
|---|
| >PRK06765 homoserine O-acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PLN02894 hydrolase, alpha/beta fold family protein | Back alignment and domain information |
|---|
| >PRK11126 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase; Provisional | Back alignment and domain information |
|---|
| >PLN02980 2-oxoglutarate decarboxylase/ hydro-lyase/ magnesium ion binding / thiamin pyrophosphate binding | Back alignment and domain information |
|---|
| >PLN02211 methyl indole-3-acetate methyltransferase | Back alignment and domain information |
|---|
| >PRK10749 lysophospholipase L2; Provisional | Back alignment and domain information |
|---|
| >KOG2984 consensus Predicted hydrolase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK14875 acetoin dehydrogenase E2 subunit dihydrolipoyllysine-residue acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PLN02652 hydrolase; alpha/beta fold family protein | Back alignment and domain information |
|---|
| >KOG4178 consensus Soluble epoxide hydrolase [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK05855 short chain dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PLN02511 hydrolase | Back alignment and domain information |
|---|
| >TIGR01249 pro_imino_pep_1 proline iminopeptidase, Neisseria-type subfamily | Back alignment and domain information |
|---|
| >KOG4409 consensus Predicted hydrolase/acyltransferase (alpha/beta hydrolase superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >PRK10985 putative hydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK05077 frsA fermentation/respiration switch protein; Reviewed | Back alignment and domain information |
|---|
| >TIGR01607 PST-A Plasmodium subtelomeric family (PST-A) | Back alignment and domain information |
|---|
| >PRK07868 acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >COG0596 MhpC Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >PF08386 Abhydrolase_4: TAP-like protein; InterPro: IPR013595 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families | Back alignment and domain information |
|---|
| >PF00326 Peptidase_S9: Prolyl oligopeptidase family This family belongs to family S9 of the peptidase classification | Back alignment and domain information |
|---|
| >COG3208 GrsT Predicted thioesterase involved in non-ribosomal peptide biosynthesis [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >PLN02872 triacylglycerol lipase | Back alignment and domain information |
|---|
| >TIGR03100 hydr1_PEP hydrolase, ortholog 1, exosortase system type 1 associated | Back alignment and domain information |
|---|
| >TIGR01836 PHA_synth_III_C poly(R)-hydroxyalkanoic acid synthase, class III, PhaC subunit | Back alignment and domain information |
|---|
| >COG2267 PldB Lysophospholipase [Lipid metabolism] | Back alignment and domain information |
|---|
| >TIGR01838 PHA_synth_I poly(R)-hydroxyalkanoic acid synthase, class I | Back alignment and domain information |
|---|
| >COG1647 Esterase/lipase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1552 consensus Predicted alpha/beta hydrolase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK13604 luxD acyl transferase; Provisional | Back alignment and domain information |
|---|
| >PRK11071 esterase YqiA; Provisional | Back alignment and domain information |
|---|
| >COG1506 DAP2 Dipeptidyl aminopeptidases/acylaminoacyl-peptidases [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK11460 putative hydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK10566 esterase; Provisional | Back alignment and domain information |
|---|
| >PF12695 Abhydrolase_5: Alpha/beta hydrolase family; PDB: 3D0K_B 2I3D_B 3DOH_B 3DOI_B 3PFB_A 3S2Z_B 3PFC_A 3QM1_A 3PF8_B 3PF9_A | Back alignment and domain information |
|---|
| >KOG1455 consensus Lysophospholipase [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >KOG2551 consensus Phospholipase/carboxyhydrolase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PF01738 DLH: Dienelactone hydrolase family; InterPro: IPR002925 Dienelactone hydrolases play a crucial role in chlorocatechol degradation via the modified ortho cleavage pathway | Back alignment and domain information |
|---|
| >COG0429 Predicted hydrolase of the alpha/beta-hydrolase fold [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4391 consensus Predicted alpha/beta hydrolase BEM46 [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4667 consensus Predicted esterase [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >PF00450 Peptidase_S10: Serine carboxypeptidase; InterPro: IPR001563 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families | Back alignment and domain information |
|---|
| >KOG2931 consensus Differentiation-related gene 1 protein (NDR1 protein), related proteins [Function unknown] | Back alignment and domain information |
|---|
| >PF02230 Abhydrolase_2: Phospholipase/Carboxylesterase; InterPro: IPR003140 This entry represents the alpha/beta hydrolase domain found in phospholipases [], carboxylesterases [] and thioesterases | Back alignment and domain information |
|---|
| >PF03096 Ndr: Ndr family; InterPro: IPR004142 This family consists of proteins from different gene families: Ndr1/RTP/Drg1, Ndr2, and Ndr3 | Back alignment and domain information |
|---|
| >PF03959 FSH1: Serine hydrolase (FSH1); InterPro: IPR005645 This entry represents proteins belonging to the AB hydrolase family | Back alignment and domain information |
|---|
| >PTZ00472 serine carboxypeptidase (CBP1); Provisional | Back alignment and domain information |
|---|
| >PF05705 DUF829: Eukaryotic protein of unknown function (DUF829); InterPro: IPR008547 This signature identifies Transmembrane protein 53, that have no known function but are predicted to be integral membrane proteins | Back alignment and domain information |
|---|
| >PF06821 Ser_hydrolase: Serine hydrolase; InterPro: IPR010662 This family contains a number of hypothetical bacterial proteins of unknown function, which may be cytosolic | Back alignment and domain information |
|---|
| >PF10142 PhoPQ_related: PhoPQ-activated pathogenicity-related protein; InterPro: IPR009199 Proteins in this entry are believed to play a role in virulence/pathogenicity in Salmonella | Back alignment and domain information |
|---|
| >TIGR01849 PHB_depoly_PhaZ polyhydroxyalkanoate depolymerase, intracellular | Back alignment and domain information |
|---|
| >PF08840 BAAT_C: BAAT / Acyl-CoA thioester hydrolase C terminal; InterPro: IPR014940 Acyl-CoA thioesterases are a group of enzymes that catalyse the hydrolysis of acyl-CoAs to the free fatty acid and coenzyme A (CoASH), providing the potential to regulate intracellular levels of acyl-CoAs, free fatty acids and CoASH | Back alignment and domain information |
|---|
| >COG2945 Predicted hydrolase of the alpha/beta superfamily [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3043 consensus Predicted hydrolase related to dienelactone hydrolase [General function prediction only] | Back alignment and domain information |
|---|
| >PLN02213 sinapoylglucose-malate O-sinapoyltransferase/ carboxypeptidase | Back alignment and domain information |
|---|
| >PLN02209 serine carboxypeptidase | Back alignment and domain information |
|---|
| >PF05448 AXE1: Acetyl xylan esterase (AXE1); InterPro: IPR008391 This family consists of several bacterial acetyl xylan esterase proteins | Back alignment and domain information |
|---|
| >COG1073 Hydrolases of the alpha/beta superfamily [General function prediction only] | Back alignment and domain information |
|---|
| >PLN03016 sinapoylglucose-malate O-sinapoyltransferase | Back alignment and domain information |
|---|
| >KOG1282 consensus Serine carboxypeptidases (lysosomal cathepsin A) [Posttranslational modification, protein turnover, chaperones; Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PF09752 DUF2048: Uncharacterized conserved protein (DUF2048); InterPro: IPR019149 This family of proteins has no known function | Back alignment and domain information |
|---|
| >COG2021 MET2 Homoserine acetyltransferase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >KOG1838 consensus Alpha/beta hydrolase [General function prediction only] | Back alignment and domain information |
|---|
| >COG0400 Predicted esterase [General function prediction only] | Back alignment and domain information |
|---|
| >PLN02442 S-formylglutathione hydrolase | Back alignment and domain information |
|---|
| >COG0412 Dienelactone hydrolase and related enzymes [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >KOG2564 consensus Predicted acetyltransferases and hydrolases with the alpha/beta hydrolase fold [General function prediction only] | Back alignment and domain information |
|---|
| >COG4757 Predicted alpha/beta hydrolase [General function prediction only] | Back alignment and domain information |
|---|
| >COG3243 PhaC Poly(3-hydroxyalkanoate) synthetase [Lipid metabolism] | Back alignment and domain information |
|---|
| >PRK05371 x-prolyl-dipeptidyl aminopeptidase; Provisional | Back alignment and domain information |
|---|
| >PF08538 DUF1749: Protein of unknown function (DUF1749); InterPro: IPR013744 This is a plant and fungal family of unknown function | Back alignment and domain information |
|---|
| >PRK10162 acetyl esterase; Provisional | Back alignment and domain information |
|---|
| >TIGR01839 PHA_synth_II poly(R)-hydroxyalkanoic acid synthase, class II | Back alignment and domain information |
|---|
| >TIGR02821 fghA_ester_D S-formylglutathione hydrolase | Back alignment and domain information |
|---|
| >KOG3975 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >COG3571 Predicted hydrolase of the alpha/beta-hydrolase fold [General function prediction only] | Back alignment and domain information |
|---|
| >COG3545 Predicted esterase of the alpha/beta hydrolase fold [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3253 consensus Predicted alpha/beta hydrolase [General function prediction only] | Back alignment and domain information |
|---|
| >PF02273 Acyl_transf_2: Acyl transferase; InterPro: IPR003157 LuxD proteins are bacterial acyl transferases | Back alignment and domain information |
|---|
| >PF06850 PHB_depo_C: PHB de-polymerase C-terminus; InterPro: IPR009656 This entry represents the C terminus of bacterial poly(3-hydroxybutyrate) (PHB) de-polymerase | Back alignment and domain information |
|---|
| >PF05728 UPF0227: Uncharacterised protein family (UPF0227); InterPro: IPR008886 Despite being classed as uncharacterised proteins, the members of this family are almost certainly enzymes in that they contain a domain distantly related to IPR000073 from INTERPRO | Back alignment and domain information |
|---|
| >PF07859 Abhydrolase_3: alpha/beta hydrolase fold A web page of Esterases and alpha/beta hydrolases | Back alignment and domain information |
|---|
| >PF00975 Thioesterase: Thioesterase domain; InterPro: IPR001031 Thioesterase domains often occur integrated in or associated with peptide synthetases which are involved in the non-ribosomal synthesis of peptide antibiotics [] | Back alignment and domain information |
|---|
| >PRK10115 protease 2; Provisional | Back alignment and domain information |
|---|
| >KOG1551 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG1515 consensus Arylacetamide deacetylase [Defense mechanisms] | Back alignment and domain information |
|---|
| >PF06342 DUF1057: Alpha/beta hydrolase of unknown function (DUF1057); InterPro: IPR010463 This entry consists of proteins of unknown function which have an alpha/beta hydrolase fold | Back alignment and domain information |
|---|
| >PF03583 LIP: Secretory lipase ; InterPro: IPR005152 This entry represents a family of secreted lipases | Back alignment and domain information |
|---|
| >PF06500 DUF1100: Alpha/beta hydrolase of unknown function (DUF1100); InterPro: IPR010520 Proteins in this entry display esterase activity toward pNP-butyrate [] | Back alignment and domain information |
|---|
| >COG0657 Aes Esterase/lipase [Lipid metabolism] | Back alignment and domain information |
|---|
| >COG4287 PqaA PhoPQ-activated pathogenicity-related protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF06057 VirJ: Bacterial virulence protein (VirJ); InterPro: IPR010333 This entry contains several bacterial VirJ virulence proteins | Back alignment and domain information |
|---|
| >KOG2565 consensus Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >COG3458 Acetyl esterase (deacetylase) [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >PF11339 DUF3141: Protein of unknown function (DUF3141); InterPro: IPR024501 This family of proteins appears to be predominantly expressed in Proteobacteria | Back alignment and domain information |
|---|
| >PF04301 DUF452: Protein of unknown function (DUF452); InterPro: IPR007398 This is a family of uncharacterised proteins | Back alignment and domain information |
|---|
| >PLN00021 chlorophyllase | Back alignment and domain information |
|---|
| >KOG2100 consensus Dipeptidyl aminopeptidase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF10230 DUF2305: Uncharacterised conserved protein (DUF2305); InterPro: IPR019363 This entry contains proteins that have no known function | Back alignment and domain information |
|---|
| >KOG2624 consensus Triglyceride lipase-cholesterol esterase [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >KOG2112 consensus Lysophospholipase [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >PF05576 Peptidase_S37: PS-10 peptidase S37; InterPro: IPR008761 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families | Back alignment and domain information |
|---|
| >COG4188 Predicted dienelactone hydrolase [General function prediction only] | Back alignment and domain information |
|---|
| >PF07519 Tannase: Tannase and feruloyl esterase; InterPro: IPR011118 This family includes fungal tannase [] and feruloyl esterase [, ] | Back alignment and domain information |
|---|
| >KOG4627 consensus Kynurenine formamidase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >smart00824 PKS_TE Thioesterase | Back alignment and domain information |
|---|
| >TIGR01840 esterase_phb esterase, PHB depolymerase family | Back alignment and domain information |
|---|
| >PRK10252 entF enterobactin synthase subunit F; Provisional | Back alignment and domain information |
|---|
| >COG2939 Carboxypeptidase C (cathepsin A) [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PF02129 Peptidase_S15: X-Pro dipeptidyl-peptidase (S15 family); InterPro: IPR000383 This entry represents a domain found peptidases Xaa-Pro dipeptidyl-peptidase and glutaryl-7-aminocephalosporanic-acid acylase, which belong to MEROPS peptidase families S15 and S45 respectively [] | Back alignment and domain information |
|---|
| >COG4553 DepA Poly-beta-hydroxyalkanoate depolymerase [Lipid metabolism] | Back alignment and domain information |
|---|
| >PF06028 DUF915: Alpha/beta hydrolase of unknown function (DUF915); InterPro: IPR010315 This family consists of bacterial proteins of unknown function, which are hydrolase-like | Back alignment and domain information |
|---|
| >KOG2521 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PRK04940 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF10503 Esterase_phd: Esterase PHB depolymerase | Back alignment and domain information |
|---|
| >COG3946 VirJ Type IV secretory pathway, VirJ component [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 73 | ||||
| 1u2e_A | 289 | Crystal Structure Of The C-C Bond Hydrolase Mhpc Le | 3e-04 | ||
| 1iun_A | 282 | Meta-Cleavage Product Hydrolase From Pseudomonas Fl | 4e-04 | ||
| 2d0d_A | 282 | Crystal Structure Of A Meta-Cleavage Product Hydrol | 4e-04 | ||
| 3bdi_A | 207 | Crystal Structure Of Predicted Cib-Like Hydrolase ( | 8e-04 | ||
| 2og1_A | 286 | Crystal Structure Of Bphd, A C-C Hydrolase From Bur | 8e-04 | ||
| 2rht_A | 283 | Crystal Structure Of The S112a Mutant Of A C-C Hydr | 8e-04 | ||
| 2puh_A | 286 | Crystal Structure Of The S112a Mutant Of A C-C Hydr | 8e-04 |
| >pdb|1U2E|A Chain A, Crystal Structure Of The C-C Bond Hydrolase Mhpc Length = 289 | Back alignment and structure |
|
| >pdb|1IUN|A Chain A, Meta-Cleavage Product Hydrolase From Pseudomonas Fluorescens Ip01 (Cumd) S103a Mutant Hexagonal Length = 282 | Back alignment and structure |
| >pdb|2D0D|A Chain A, Crystal Structure Of A Meta-Cleavage Product Hydrolase (Cumd) A129v Mutant Length = 282 | Back alignment and structure |
| >pdb|3BDI|A Chain A, Crystal Structure Of Predicted Cib-Like Hydrolase (Np_393672.1) From Thermoplasma Acidophilum At 1.45 A Resolution Length = 207 | Back alignment and structure |
| >pdb|2OG1|A Chain A, Crystal Structure Of Bphd, A C-C Hydrolase From Burkholderia Xenovorans Lb400 Length = 286 | Back alignment and structure |
| >pdb|2RHT|A Chain A, Crystal Structure Of The S112a Mutant Of A C-C Hydrolase, Bphd From Burkholderia Xenovorans Lb400, In Complex With 3-Cl Hopda Length = 283 | Back alignment and structure |
| >pdb|2PUH|A Chain A, Crystal Structure Of The S112a Mutant Of A C-C Hydrolase, Bphd From Burkholderia Xenovorans Lb400, In Complex With Its Substrate Hopda Length = 286 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 73 | |||
| 2puj_A | 286 | 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrola; | 2e-20 | |
| 1c4x_A | 285 | BPHD, protein (2-hydroxy-6-OXO-6-phenylhexa-2,4-di | 4e-20 | |
| 2wue_A | 291 | 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrolas | 6e-20 | |
| 1iup_A | 282 | META-cleavage product hydrolase; aromatic compound | 8e-20 | |
| 1j1i_A | 296 | META cleavage compound hydrolase; carbazole degrad | 1e-19 | |
| 3fsg_A | 272 | Alpha/beta superfamily hydrolase; PF00561, MCSG, P | 1e-19 | |
| 1u2e_A | 289 | 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase | 7e-19 | |
| 2xmz_A | 269 | Hydrolase, alpha/beta hydrolase fold family; menaq | 1e-18 | |
| 3e0x_A | 245 | Lipase-esterase related protein; APC60309, clostri | 2e-18 | |
| 3kxp_A | 314 | Alpha-(N-acetylaminomethylene)succinic acid hydrol | 8e-18 | |
| 2wj6_A | 276 | 1H-3-hydroxy-4-oxoquinaldine 2,4-dioxygenase; oxid | 1e-17 | |
| 1m33_A | 258 | BIOH protein; alpha-betta-alpha sandwich, structur | 1e-17 | |
| 2ocg_A | 254 | Valacyclovir hydrolase; alpha beta hydrolase fold; | 2e-17 | |
| 3oos_A | 278 | Alpha/beta hydrolase family protein; APC67239.0, p | 2e-17 | |
| 4f0j_A | 315 | Probable hydrolytic enzyme; alpha/beta hydrolase f | 1e-16 | |
| 1wom_A | 271 | RSBQ, sigma factor SIGB regulation protein RSBQ; a | 1e-16 | |
| 3v48_A | 268 | Aminohydrolase, putative aminoacrylate hydrolase R | 2e-16 | |
| 2y6u_A | 398 | Peroxisomal membrane protein LPX1; hydrolase, puta | 4e-16 | |
| 3bf7_A | 255 | Esterase YBFF; thioesterase, helical CAP, hydrolas | 4e-16 | |
| 3qvm_A | 282 | OLEI00960; structural genomics, PSI-biology, midwe | 4e-16 | |
| 2r11_A | 306 | Carboxylesterase NP; 2632844, putative hydrolase, | 7e-16 | |
| 3hss_A | 293 | Putative bromoperoxidase; alpha beta hydrolase, ox | 9e-16 | |
| 1hkh_A | 279 | Gamma lactamase; hydrolase, alpha/beta hydrolase, | 1e-15 | |
| 3fob_A | 281 | Bromoperoxidase; structural genomics, IDP00046, ba | 2e-15 | |
| 1q0r_A | 298 | RDMC, aclacinomycin methylesterase; anthracycline, | 5e-15 | |
| 3c5v_A | 316 | PME-1, protein phosphatase methylesterase 1; demet | 5e-15 | |
| 1r3d_A | 264 | Conserved hypothetical protein VC1974; structural | 6e-15 | |
| 1brt_A | 277 | Bromoperoxidase A2; haloperoxidase, oxidoreductase | 8e-15 | |
| 3vdx_A | 456 | Designed 16NM tetrahedral protein CAGE containing | 2e-14 | |
| 1a88_A | 275 | Chloroperoxidase L; haloperoxidase, oxidoreductase | 2e-14 | |
| 3nwo_A | 330 | PIP, proline iminopeptidase; structural genomics, | 2e-14 | |
| 3g9x_A | 299 | Haloalkane dehalogenase; alpha/beta hydrolase, hel | 3e-14 | |
| 1mtz_A | 293 | Proline iminopeptidase; alpha-beta hydrolase, CAP | 3e-14 | |
| 1a8s_A | 273 | Chloroperoxidase F; haloperoxidase, oxidoreductase | 5e-14 | |
| 3bwx_A | 285 | Alpha/beta hydrolase; YP_496220.1, joint center fo | 5e-14 | |
| 3i28_A | 555 | Epoxide hydrolase 2; aromatic hydrocarbons catabol | 6e-14 | |
| 1zoi_A | 276 | Esterase; alpha/beta hydrolase fold; 1.60A {Pseudo | 7e-14 | |
| 3afi_E | 316 | Haloalkane dehalogenase; A/B-hydrolase, hydrolase; | 9e-14 | |
| 3u1t_A | 309 | DMMA haloalkane dehalogenase; alpha/beta-hydrolase | 3e-13 | |
| 3ia2_A | 271 | Arylesterase; alpha-beta hydrolase fold, transitio | 5e-13 | |
| 3bdi_A | 207 | Uncharacterized protein TA0194; NP_393672.1, predi | 6e-13 | |
| 2yys_A | 286 | Proline iminopeptidase-related protein; TTHA1809, | 6e-13 | |
| 2xua_A | 266 | PCAD, 3-oxoadipate ENOL-lactonase; hydrolase, cate | 1e-12 | |
| 3kda_A | 301 | CFTR inhibitory factor (CIF); alpha/beta hydrolase | 1e-12 | |
| 1imj_A | 210 | CIB, CCG1-interacting factor B; alpha/beta hydrola | 2e-12 | |
| 1a8q_A | 274 | Bromoperoxidase A1; haloperoxidase, oxidoreductase | 4e-12 | |
| 3r0v_A | 262 | Alpha/beta hydrolase fold protein; structural geno | 5e-12 | |
| 3p2m_A | 330 | Possible hydrolase; alpha/beta hydrolase superfami | 5e-12 | |
| 3om8_A | 266 | Probable hydrolase; structural genomics, PSI-2, pr | 5e-12 | |
| 2cjp_A | 328 | Epoxide hydrolase; HET: PG4 VPR; 1.95A {Solanum tu | 7e-12 | |
| 2xt0_A | 297 | Haloalkane dehalogenase; hydrolase, alpha-beta hyd | 2e-11 | |
| 2qmq_A | 286 | Protein NDRG2, protein NDR2; alpha/beta-hydrolases | 4e-11 | |
| 1ehy_A | 294 | Protein (soluble epoxide hydrolase); alpha/beta hy | 6e-11 | |
| 2qvb_A | 297 | Haloalkane dehalogenase 3; RV2579, alpha-beta hydr | 7e-11 | |
| 3ibt_A | 264 | 1H-3-hydroxy-4-oxoquinoline 2,4-dioxygenase; QDO, | 1e-10 | |
| 1b6g_A | 310 | Haloalkane dehalogenase; hydrolase, alpha/beta-hyd | 2e-10 | |
| 1mj5_A | 302 | 1,3,4,6-tetrachloro-1,4-cyclohexadiene hydrolase; | 2e-10 | |
| 3qit_A | 286 | CURM TE, polyketide synthase; thioesterase, alpha/ | 6e-10 | |
| 3l80_A | 292 | Putative uncharacterized protein SMU.1393C; alpha/ | 6e-10 | |
| 2e3j_A | 356 | Epoxide hydrolase EPHB; epoxide hydrolase B, struc | 8e-10 | |
| 3r40_A | 306 | Fluoroacetate dehalogenase; FACD, defluorinase, al | 4e-09 | |
| 1tqh_A | 247 | Carboxylesterase precursor; tetrahedral intermedia | 7e-09 | |
| 3b12_A | 304 | Fluoroacetate dehalogenase; dehalogease, hydrolase | 1e-08 | |
| 2psd_A | 318 | Renilla-luciferin 2-monooxygenase; alpha/beta-hydr | 3e-08 | |
| 3qyj_A | 291 | ALR0039 protein; alpha/beta fold, hydrolase; 1.78A | 3e-08 | |
| 2wfl_A | 264 | Polyneuridine-aldehyde esterase; alkaloid metaboli | 7e-08 | |
| 1xkl_A | 273 | SABP2, salicylic acid-binding protein 2; alpha-bet | 3e-07 | |
| 3dkr_A | 251 | Esterase D; alpha beta hydrolase, mechanism, catal | 7e-07 | |
| 3sty_A | 267 | Methylketone synthase 1; alpha/beta hydrolase, dec | 1e-06 | |
| 3c6x_A | 257 | Hydroxynitrilase; atomic resolution, hydroxynitril | 4e-06 | |
| 3rm3_A | 270 | MGLP, thermostable monoacylglycerol lipase; alpha/ | 5e-06 | |
| 1azw_A | 313 | Proline iminopeptidase; aminopeptidase, serine pro | 7e-06 | |
| 3dqz_A | 258 | Alpha-hydroxynitrIle lyase-like protein; A/B-hydrl | 3e-05 | |
| 1wm1_A | 317 | Proline iminopeptidase; complex with inhibitor, hy | 3e-05 | |
| 3pfb_A | 270 | Cinnamoyl esterase; alpha/beta hydrolase fold, hyd | 7e-05 | |
| 2wtm_A | 251 | EST1E; hydrolase; 1.60A {Clostridium proteoclastic | 3e-04 | |
| 3trd_A | 208 | Alpha/beta hydrolase; cellular processes; 1.50A {C | 4e-04 |
| >2puj_A 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrola; C-C bond hydrolase, hydrolase; HET: HPZ; 1.57A {Burkholderia xenovorans} PDB: 2pu7_A* 3v1m_A* 3v1l_A* 2puh_A* 3v1n_A* 3v1k_A* 2og1_A 2pu5_A 2rhw_A* 2rht_A* 2ri6_A Length = 286 | Back alignment and structure |
|---|
Score = 80.1 bits (198), Expect = 2e-20
Identities = 15/61 (24%), Positives = 29/61 (47%)
Query: 1 VKQKTLIIWGEDDQIISSKLAVRLHCELPNAIIRQIPDCGHLPHVEKPGAVAKLIVEFIQ 60
+K KT I WG DD+ + ++L + +A + CG E +L+++F++
Sbjct: 225 IKAKTFITWGRDDRFVPLDHGLKLLWNIDDARLHVFSKCGAWAQWEHADEFNRLVIDFLR 284
Query: 61 E 61
Sbjct: 285 H 285
|
| >1c4x_A BPHD, protein (2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoat hydrolase); PCB degradation; 2.40A {Rhodococcus SP} SCOP: c.69.1.10 Length = 285 | Back alignment and structure |
|---|
| >2wue_A 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrolase BPHD; HET: KEK; 1.80A {Mycobacterium tuberculosis} PDB: 2wud_A* 2wuf_A* 2wug_A* 2vf2_A Length = 291 | Back alignment and structure |
|---|
| >1iup_A META-cleavage product hydrolase; aromatic compounds, cumene, isopropylbenzene, META-cleavage compound hydrolase; 1.60A {Pseudomonas fluorescens} SCOP: c.69.1.10 PDB: 1iun_A 1iuo_A 1uk6_A 1uk7_A 1uk8_A 1uk9_A 1uka_A 1ukb_A 2d0d_A Length = 282 | Back alignment and structure |
|---|
| >1j1i_A META cleavage compound hydrolase; carbazole degradation, META cleavage product hydrolase, histidine tagged protein, alpha/beta-hydrolase; 1.86A {Janthinobacterium} SCOP: c.69.1.10 Length = 296 | Back alignment and structure |
|---|
| >3fsg_A Alpha/beta superfamily hydrolase; PF00561, MCSG, PSI, PSI-2, structural genomics, protein structure initiative, midwest for structural genomics; 2.00A {Oenococcus oeni} Length = 272 | Back alignment and structure |
|---|
| >1u2e_A 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase; alpha/beta hydrolase fold; 2.10A {Escherichia coli} Length = 289 | Back alignment and structure |
|---|
| >2xmz_A Hydrolase, alpha/beta hydrolase fold family; menaquinone biosynthesis, lyase; 1.94A {Staphylococcus aureus} Length = 269 | Back alignment and structure |
|---|
| >3e0x_A Lipase-esterase related protein; APC60309, clostridium acetobutylicum ATCC 824, structural genomics, PSI-2; HET: MSE; 1.45A {Clostridium acetobutylicum} Length = 245 | Back alignment and structure |
|---|
| >3kxp_A Alpha-(N-acetylaminomethylene)succinic acid hydrolase; alpha/beta hydrolase, PLP degradation, E-2- (acetamidomethylene)succinate; 2.26A {Mesorhizobium loti} Length = 314 | Back alignment and structure |
|---|
| >2wj6_A 1H-3-hydroxy-4-oxoquinaldine 2,4-dioxygenase; oxidoreductase, alpha/beta hydrolase; HET: ZZ8 SRT; 2.00A {Arthrobacter nitroguajacolicus} PDB: 2wj4_A* 2wj3_A* 2wm2_A* Length = 276 | Back alignment and structure |
|---|
| >1m33_A BIOH protein; alpha-betta-alpha sandwich, structural genomics, PSI, protei structure initiative; HET: MSE 3OH; 1.70A {Escherichia coli} SCOP: c.69.1.26 Length = 258 | Back alignment and structure |
|---|
| >2ocg_A Valacyclovir hydrolase; alpha beta hydrolase fold; 1.75A {Homo sapiens} PDB: 2oci_A* 2ock_A 2ocl_A Length = 254 | Back alignment and structure |
|---|
| >3oos_A Alpha/beta hydrolase family protein; APC67239.0, protein structure initiative, PSI-2, structural midwest center for structural genomics, MCSG; HET: MSE PG4; 1.65A {Bacillus anthracis} Length = 278 | Back alignment and structure |
|---|
| >4f0j_A Probable hydrolytic enzyme; alpha/beta hydrolase fold, structural genomics, joint center structural genomics, JCSG; HET: MSE; 1.50A {Pseudomonas aeruginosa} Length = 315 | Back alignment and structure |
|---|
| >1wom_A RSBQ, sigma factor SIGB regulation protein RSBQ; alpha/beta hydrolase, signaling protein; 2.50A {Bacillus subtilis} PDB: 1wpr_A* Length = 271 | Back alignment and structure |
|---|
| >3v48_A Aminohydrolase, putative aminoacrylate hydrolase RUTD; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.10A {Escherichia coli SE11} Length = 268 | Back alignment and structure |
|---|
| >2y6u_A Peroxisomal membrane protein LPX1; hydrolase, putative esterase, putative lipase; HET: CME CSO; 1.90A {Saccharomyces cerevisiae} PDB: 2y6v_A* Length = 398 | Back alignment and structure |
|---|
| >3bf7_A Esterase YBFF; thioesterase, helical CAP, hydrolase; 1.10A {Escherichia coli} PDB: 3bf8_A Length = 255 | Back alignment and structure |
|---|
| >3qvm_A OLEI00960; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta hydrolase fold, hydrolase; 2.00A {Oleispira antarctica} Length = 282 | Back alignment and structure |
|---|
| >2r11_A Carboxylesterase NP; 2632844, putative hydrolase, structural genomics, joint center for structural genomics, JCSG; HET: MSE PGE; 1.96A {Bacillus subtilis} Length = 306 | Back alignment and structure |
|---|
| >3hss_A Putative bromoperoxidase; alpha beta hydrolase, oxidoreductase, hydrolase; 1.90A {Mycobacterium tuberculosis} PDB: 3e3a_A 3hys_A 3hzo_A Length = 293 | Back alignment and structure |
|---|
| >1hkh_A Gamma lactamase; hydrolase, alpha/beta hydrolase, CO-factor free haloperoxidase,; 1.73A {Microbacterium} SCOP: c.69.1.12 PDB: 1hl7_A* Length = 279 | Back alignment and structure |
|---|
| >3fob_A Bromoperoxidase; structural genomics, IDP00046, bacillus ANT peroxidase, oxidoreductase; 1.74A {Bacillus anthracis str} Length = 281 | Back alignment and structure |
|---|
| >1q0r_A RDMC, aclacinomycin methylesterase; anthracycline, hydrolase, polyketide, tailoring enzyme, structural proteomics in europe, spine; HET: AKT 1PE; 1.45A {Streptomyces purpurascens} SCOP: c.69.1.28 PDB: 1q0z_A* Length = 298 | Back alignment and structure |
|---|
| >3c5v_A PME-1, protein phosphatase methylesterase 1; demethylase, PP2A, alternative splicing, hydrolase, phosphoprotein, serine esterase; 2.00A {Homo sapiens} PDB: 3c5w_P Length = 316 | Back alignment and structure |
|---|
| >1r3d_A Conserved hypothetical protein VC1974; structural genomics, hydrolase, NYSGXRC, NEW YORK SGX research center for structural genomics, PSI; 1.90A {Vibrio cholerae} SCOP: c.69.1.35 Length = 264 | Back alignment and structure |
|---|
| >1brt_A Bromoperoxidase A2; haloperoxidase, oxidoreductase, alpha/beta hydrolase fold, mutant M99T; 1.50A {Streptomyces aureofaciens} SCOP: c.69.1.12 PDB: 1bro_A 1a8u_A 1a7u_A Length = 277 | Back alignment and structure |
|---|
| >3vdx_A Designed 16NM tetrahedral protein CAGE containing bromoperoxidase BPO-A2 and matrix...; protein design, bionanotechnology; 3.00A {Streptomyces aureofaciens} PDB: 4d9j_A Length = 456 | Back alignment and structure |
|---|
| >1a88_A Chloroperoxidase L; haloperoxidase, oxidoreductase; 1.90A {Streptomyces lividans} SCOP: c.69.1.12 Length = 275 | Back alignment and structure |
|---|
| >3nwo_A PIP, proline iminopeptidase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, mycobac smegmatis; 1.90A {Mycobacterium smegmatis} Length = 330 | Back alignment and structure |
|---|
| >3g9x_A Haloalkane dehalogenase; alpha/beta hydrolase, helical CAP domain, catalytic triad (A His272, Glu130), mutant, I135F, haloalkanes; 0.95A {Rhodococcus SP} PDB: 3fwh_A 3fbw_A 3rlt_A 3rk4_A 1bn6_A 1bn7_A 1cqw_A 2v9z_A Length = 299 | Back alignment and structure |
|---|
| >1mtz_A Proline iminopeptidase; alpha-beta hydrolase, CAP domain, caged active site, prolyl peptidase; 1.80A {Thermoplasma acidophilum} SCOP: c.69.1.7 PDB: 1mt3_A 1mu0_A* 1xrr_A 1xrq_A 1xro_A 1xrn_A 1xrm_A 1xrp_A 1xrl_A* 1xqw_A* 1xqx_A* 1xqy_A 1xqv_A Length = 293 | Back alignment and structure |
|---|
| >1a8s_A Chloroperoxidase F; haloperoxidase, oxidoreductase, propionate complex; 1.80A {Pseudomonas fluorescens} SCOP: c.69.1.12 Length = 273 | Back alignment and structure |
|---|
| >3bwx_A Alpha/beta hydrolase; YP_496220.1, joint center for structural genomics, protein structure initiative, PSI-2; HET: MSE; 1.50A {Novosphingobium aromaticivorans} Length = 285 | Back alignment and structure |
|---|
| >3i28_A Epoxide hydrolase 2; aromatic hydrocarbons catabolism, detoxification, magnesium, metal-binding, peroxisome; HET: 34N; 1.95A {Homo sapiens} PDB: 1s8o_A* 1zd2_P* 1vj5_A* 1zd4_A* 1zd5_A* 3i1y_A* 1zd3_A* 3koo_A* 3otq_A* 1cqz_A 1cr6_A* 1ek1_A* 1ek2_A* 3ans_A* 3ant_A* 3pdc_A* Length = 555 | Back alignment and structure |
|---|
| >1zoi_A Esterase; alpha/beta hydrolase fold; 1.60A {Pseudomonas putida} PDB: 4dgq_A Length = 276 | Back alignment and structure |
|---|
| >3afi_E Haloalkane dehalogenase; A/B-hydrolase, hydrolase; 1.75A {Bradyrhizobium japonicum} PDB: 3a2m_A* 3a2n_A 3a2l_A* Length = 316 | Back alignment and structure |
|---|
| >3u1t_A DMMA haloalkane dehalogenase; alpha/beta-hydrolase, hydrolase; 2.20A {Unidentified} Length = 309 | Back alignment and structure |
|---|
| >3ia2_A Arylesterase; alpha-beta hydrolase fold, transition state analog, hydrolas oxidoreductase, peroxidase; 1.65A {Pseudomonas fluorescens} PDB: 1va4_A 3hi4_A 3hea_A Length = 271 | Back alignment and structure |
|---|
| >3bdi_A Uncharacterized protein TA0194; NP_393672.1, predicted CIB-like hydrolase, structural genomi center for structural genomics; HET: MSE; 1.45A {Thermoplasma acidophilum dsm 1728} Length = 207 | Back alignment and structure |
|---|
| >2yys_A Proline iminopeptidase-related protein; TTHA1809, structural genomics, unknown function; 2.20A {Thermus thermophilus} Length = 286 | Back alignment and structure |
|---|
| >2xua_A PCAD, 3-oxoadipate ENOL-lactonase; hydrolase, catechol metabolism; 1.90A {Burkholderia xenovorans} Length = 266 | Back alignment and structure |
|---|
| >3kda_A CFTR inhibitory factor (CIF); alpha/beta hydrolase, hydrolase; 1.50A {Pseudomonas aeruginosa ucbpp-pa14} PDB: 3kd2_A 3pi6_A Length = 301 | Back alignment and structure |
|---|
| >1imj_A CIB, CCG1-interacting factor B; alpha/beta hydrolase, CCG1 interactor; 2.20A {Homo sapiens} SCOP: c.69.1.23 Length = 210 | Back alignment and structure |
|---|
| >1a8q_A Bromoperoxidase A1; haloperoxidase, oxidoreductase; 1.75A {Streptomyces aureofaciens} SCOP: c.69.1.12 Length = 274 | Back alignment and structure |
|---|
| >3r0v_A Alpha/beta hydrolase fold protein; structural genomics, PSI-biology, protein structure initiati alpha/beta hydrolase; HET: MSE; 1.38A {Sphaerobacter thermophilus} Length = 262 | Back alignment and structure |
|---|
| >3p2m_A Possible hydrolase; alpha/beta hydrolase superfamily; 2.80A {Mycobacterium tuberculosis} Length = 330 | Back alignment and structure |
|---|
| >3om8_A Probable hydrolase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MES; 2.25A {Pseudomonas aeruginosa} Length = 266 | Back alignment and structure |
|---|
| >2cjp_A Epoxide hydrolase; HET: PG4 VPR; 1.95A {Solanum tuberosum} PDB: 3cxu_A* Length = 328 | Back alignment and structure |
|---|
| >2xt0_A Haloalkane dehalogenase; hydrolase, alpha-beta hydrolase fold; 1.90A {Plesiocystis pacifica} Length = 297 | Back alignment and structure |
|---|
| >2qmq_A Protein NDRG2, protein NDR2; alpha/beta-hydrolases fold, NDR family, developmental protei differentiation, neurogenesis, phosphorylation; HET: 2PE; 1.70A {Mus musculus} PDB: 2xmq_A 2xmr_A 2xms_A Length = 286 | Back alignment and structure |
|---|
| >1ehy_A Protein (soluble epoxide hydrolase); alpha/beta hydrolase fold, epoxide degradation, epichlorohydrin; 2.10A {Agrobacterium tumefaciens} SCOP: c.69.1.11 Length = 294 | Back alignment and structure |
|---|
| >2qvb_A Haloalkane dehalogenase 3; RV2579, alpha-beta hydrolase protei structural genomics consortium, TBSGC, hydrolase; 1.19A {Mycobacterium tuberculosis} PDB: 2o2i_A 2o2h_A Length = 297 | Back alignment and structure |
|---|
| >3ibt_A 1H-3-hydroxy-4-oxoquinoline 2,4-dioxygenase; QDO, oxidoreductase; 2.60A {Pseudomonas putida} Length = 264 | Back alignment and structure |
|---|
| >1b6g_A Haloalkane dehalogenase; hydrolase, alpha/beta-hydrolase; 1.15A {Xanthobacter autotrophicus} SCOP: c.69.1.8 PDB: 1be0_A 1cij_A 2yxp_X 1edd_A 1edb_A 2dhc_A 2dhe_A 2eda_A 2edc_A 2had_A 1ede_A 2pky_X 1bez_A 1bee_A 2dhd_A* 1hde_A Length = 310 | Back alignment and structure |
|---|
| >1mj5_A 1,3,4,6-tetrachloro-1,4-cyclohexadiene hydrolase; LINB, haloalkane dehalogenase, 1, 3, 4, 4-cyclohexadiene dehalogenase; 0.95A {Sphingomonas paucimobilis} SCOP: c.69.1.8 PDB: 1cv2_A 1d07_A 2bfn_A 1g42_A* 1g4h_A* 1g5f_A* 1iz7_A 1iz8_A* 1k5p_A 1k63_A 1k6e_A Length = 302 | Back alignment and structure |
|---|
| >3qit_A CURM TE, polyketide synthase; thioesterase, alpha/beta hydrolase, decarboxylase, sulfate elimination, terminal alkene production; 1.68A {Lyngbya majuscula 19L} Length = 286 | Back alignment and structure |
|---|
| >3l80_A Putative uncharacterized protein SMU.1393C; alpha/beta hydrolase fold, carboxylesterase, Ser- hydrolase; 2.00A {Streptococcus mutans} Length = 292 | Back alignment and structure |
|---|
| >2e3j_A Epoxide hydrolase EPHB; epoxide hydrolase B, structural mycobacterium tuberculosis structural proteomics project, X hydrolase; 2.10A {Mycobacterium tuberculosis} PDB: 2zjf_A* Length = 356 | Back alignment and structure |
|---|
| >3r40_A Fluoroacetate dehalogenase; FACD, defluorinase, alpha/beta hydrolase, hydrolase; 1.05A {Rhodopseudomonas palustris} PDB: 3r3w_A 3r3x_A 3r3v_A 3r3u_A 3r3z_A 3r41_A 3r3y_A Length = 306 | Back alignment and structure |
|---|
| >1tqh_A Carboxylesterase precursor; tetrahedral intermediate, alpha/beta hydrolase; 1.63A {Geobacillus stearothermophilus} SCOP: c.69.1.29 PDB: 1r1d_A* 4diu_A Length = 247 | Back alignment and structure |
|---|
| >3b12_A Fluoroacetate dehalogenase; dehalogease, hydrolase; 1.20A {Burkholderia SP} PDB: 1y37_A Length = 304 | Back alignment and structure |
|---|
| >2psd_A Renilla-luciferin 2-monooxygenase; alpha/beta-hydrolase, luciferase, oxidoreductase; 1.40A {Renilla reniformis} PDB: 2pse_A 2psj_A* 2psh_A 2psf_A Length = 318 | Back alignment and structure |
|---|
| >3qyj_A ALR0039 protein; alpha/beta fold, hydrolase; 1.78A {Nostoc SP} Length = 291 | Back alignment and structure |
|---|
| >2wfl_A Polyneuridine-aldehyde esterase; alkaloid metabolism, monoterpenoid indole alkaloids, PNAE, hydrolase, serine esterase; HET: CME; 2.10A {Rauvolfia serpentina} PDB: 2wfm_A 3gzj_A* Length = 264 | Back alignment and structure |
|---|
| >1xkl_A SABP2, salicylic acid-binding protein 2; alpha-beta protein, structural genomics, protein structure initiative, PSI; HET: STH; 2.00A {Nicotiana tabacum} SCOP: c.69.1.20 PDB: 1y7i_A* 1y7h_A* Length = 273 | Back alignment and structure |
|---|
| >3dkr_A Esterase D; alpha beta hydrolase, mechanism, catalytic triad, rotation; 1.60A {Lactobacillus rhamnosus} PDB: 3dlt_A 3dyi_A 3dyv_A 3e1g_A Length = 251 | Back alignment and structure |
|---|
| >3sty_A Methylketone synthase 1; alpha/beta hydrolase, decarboxylase, hydrolase; HET: DKA; 1.70A {Lycopersicon hirsutum F} PDB: 3stu_A* 3stt_A* 3stv_A* 3stw_A* 3stx_A* Length = 267 | Back alignment and structure |
|---|
| >3c6x_A Hydroxynitrilase; atomic resolution, hydroxynitril lyase, catalysis, protonation state, AB initio calculations, substrate bindin; 1.05A {Hevea brasiliensis} SCOP: c.69.1.20 PDB: 1sc9_A 1yas_A* 2g4l_A* 2yas_A 1qj4_A 3c6y_A 3c6z_A 3c70_A 3yas_A 4yas_A 5yas_A* 6yas_A 7yas_A* 1yb6_A* 1yb7_A 1sck_A 1sci_A 1scq_A 1dwo_A 1dwp_A ... Length = 257 | Back alignment and structure |
|---|
| >3rm3_A MGLP, thermostable monoacylglycerol lipase; alpha/beta hydrolase fold, hydrolase; 1.20A {Bacillus SP} Length = 270 | Back alignment and structure |
|---|
| >1azw_A Proline iminopeptidase; aminopeptidase, serine protease, xanthomonas campestris; 2.70A {Xanthomonas citri} SCOP: c.69.1.7 Length = 313 | Back alignment and structure |
|---|
| >3dqz_A Alpha-hydroxynitrIle lyase-like protein; A/B-hydrloase fold, cyanogenesis; 2.50A {Arabidopsis thaliana} Length = 258 | Back alignment and structure |
|---|
| >1wm1_A Proline iminopeptidase; complex with inhibitor, hydrolase; HET: PTB; 2.10A {Serratia marcescens} SCOP: c.69.1.7 PDB: 1qtr_A* 1x2b_A* 1x2e_A* Length = 317 | Back alignment and structure |
|---|
| >3pfb_A Cinnamoyl esterase; alpha/beta hydrolase fold, hydrolase, cinnamoyl/Fe esterase, hydroxycinammates, extracellular; HET: ZYC; 1.58A {Lactobacillus johnsonii} PDB: 3pf9_A* 3pfc_A* 3s2z_A* 3pf8_A 3qm1_A* Length = 270 | Back alignment and structure |
|---|
| >2wtm_A EST1E; hydrolase; 1.60A {Clostridium proteoclasticum} PDB: 2wtn_A* Length = 251 | Back alignment and structure |
|---|
| >3trd_A Alpha/beta hydrolase; cellular processes; 1.50A {Coxiella burnetii} Length = 208 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 73 | |||
| 3v48_A | 268 | Aminohydrolase, putative aminoacrylate hydrolase R | 99.66 | |
| 3fob_A | 281 | Bromoperoxidase; structural genomics, IDP00046, ba | 99.61 | |
| 1iup_A | 282 | META-cleavage product hydrolase; aromatic compound | 99.61 | |
| 3om8_A | 266 | Probable hydrolase; structural genomics, PSI-2, pr | 99.61 | |
| 2puj_A | 286 | 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrola; | 99.61 | |
| 3c6x_A | 257 | Hydroxynitrilase; atomic resolution, hydroxynitril | 99.6 | |
| 1c4x_A | 285 | BPHD, protein (2-hydroxy-6-OXO-6-phenylhexa-2,4-di | 99.59 | |
| 2ocg_A | 254 | Valacyclovir hydrolase; alpha beta hydrolase fold; | 99.59 | |
| 3bf7_A | 255 | Esterase YBFF; thioesterase, helical CAP, hydrolas | 99.59 | |
| 1u2e_A | 289 | 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase | 99.59 | |
| 3afi_E | 316 | Haloalkane dehalogenase; A/B-hydrolase, hydrolase; | 99.59 | |
| 1j1i_A | 296 | META cleavage compound hydrolase; carbazole degrad | 99.58 | |
| 1xkl_A | 273 | SABP2, salicylic acid-binding protein 2; alpha-bet | 99.58 | |
| 3ia2_A | 271 | Arylesterase; alpha-beta hydrolase fold, transitio | 99.57 | |
| 2wue_A | 291 | 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrolas | 99.57 | |
| 1brt_A | 277 | Bromoperoxidase A2; haloperoxidase, oxidoreductase | 99.57 | |
| 3nwo_A | 330 | PIP, proline iminopeptidase; structural genomics, | 99.57 | |
| 2wfl_A | 264 | Polyneuridine-aldehyde esterase; alkaloid metaboli | 99.56 | |
| 1wom_A | 271 | RSBQ, sigma factor SIGB regulation protein RSBQ; a | 99.56 | |
| 2xua_A | 266 | PCAD, 3-oxoadipate ENOL-lactonase; hydrolase, cate | 99.55 | |
| 2yys_A | 286 | Proline iminopeptidase-related protein; TTHA1809, | 99.55 | |
| 1tqh_A | 247 | Carboxylesterase precursor; tetrahedral intermedia | 99.55 | |
| 1mtz_A | 293 | Proline iminopeptidase; alpha-beta hydrolase, CAP | 99.55 | |
| 1b6g_A | 310 | Haloalkane dehalogenase; hydrolase, alpha/beta-hyd | 99.55 | |
| 2e3j_A | 356 | Epoxide hydrolase EPHB; epoxide hydrolase B, struc | 99.54 | |
| 3dqz_A | 258 | Alpha-hydroxynitrIle lyase-like protein; A/B-hydrl | 99.54 | |
| 1a8s_A | 273 | Chloroperoxidase F; haloperoxidase, oxidoreductase | 99.54 | |
| 1ehy_A | 294 | Protein (soluble epoxide hydrolase); alpha/beta hy | 99.54 | |
| 3sty_A | 267 | Methylketone synthase 1; alpha/beta hydrolase, dec | 99.53 | |
| 3u1t_A | 309 | DMMA haloalkane dehalogenase; alpha/beta-hydrolase | 99.53 | |
| 2xmz_A | 269 | Hydrolase, alpha/beta hydrolase fold family; menaq | 99.53 | |
| 2wtm_A | 251 | EST1E; hydrolase; 1.60A {Clostridium proteoclastic | 99.53 | |
| 1a8q_A | 274 | Bromoperoxidase A1; haloperoxidase, oxidoreductase | 99.53 | |
| 1m33_A | 258 | BIOH protein; alpha-betta-alpha sandwich, structur | 99.53 | |
| 3fsg_A | 272 | Alpha/beta superfamily hydrolase; PF00561, MCSG, P | 99.52 | |
| 1a88_A | 275 | Chloroperoxidase L; haloperoxidase, oxidoreductase | 99.52 | |
| 1zoi_A | 276 | Esterase; alpha/beta hydrolase fold; 1.60A {Pseudo | 99.52 | |
| 3hss_A | 293 | Putative bromoperoxidase; alpha beta hydrolase, ox | 99.52 | |
| 3g9x_A | 299 | Haloalkane dehalogenase; alpha/beta hydrolase, hel | 99.51 | |
| 3oos_A | 278 | Alpha/beta hydrolase family protein; APC67239.0, p | 99.51 | |
| 3p2m_A | 330 | Possible hydrolase; alpha/beta hydrolase superfami | 99.51 | |
| 4fbl_A | 281 | LIPS lipolytic enzyme; thermostable, structural ge | 99.51 | |
| 3kxp_A | 314 | Alpha-(N-acetylaminomethylene)succinic acid hydrol | 99.49 | |
| 1hkh_A | 279 | Gamma lactamase; hydrolase, alpha/beta hydrolase, | 99.49 | |
| 3kda_A | 301 | CFTR inhibitory factor (CIF); alpha/beta hydrolase | 99.49 | |
| 4dnp_A | 269 | DAD2; alpha/beta hydrolase, hydrolase; 2.15A {Petu | 99.48 | |
| 2y6u_A | 398 | Peroxisomal membrane protein LPX1; hydrolase, puta | 99.48 | |
| 4f0j_A | 315 | Probable hydrolytic enzyme; alpha/beta hydrolase f | 99.48 | |
| 2pl5_A | 366 | Homoserine O-acetyltransferase; alpha/beta hydrola | 99.48 | |
| 2cjp_A | 328 | Epoxide hydrolase; HET: PG4 VPR; 1.95A {Solanum tu | 99.47 | |
| 2b61_A | 377 | Homoserine O-acetyltransferase; acyl-enzyme, aspar | 99.46 | |
| 3bwx_A | 285 | Alpha/beta hydrolase; YP_496220.1, joint center fo | 99.46 | |
| 3qvm_A | 282 | OLEI00960; structural genomics, PSI-biology, midwe | 99.46 | |
| 4g9e_A | 279 | AHL-lactonase, alpha/beta hydrolase fold protein; | 99.46 | |
| 2vat_A | 444 | Acetyl-COA--deacetylcephalosporin C acetyltransfer | 99.46 | |
| 2r11_A | 306 | Carboxylesterase NP; 2632844, putative hydrolase, | 99.45 | |
| 2xt0_A | 297 | Haloalkane dehalogenase; hydrolase, alpha-beta hyd | 99.44 | |
| 3i1i_A | 377 | Homoserine O-acetyltransferase; structural genomic | 99.44 | |
| 3e0x_A | 245 | Lipase-esterase related protein; APC60309, clostri | 99.43 | |
| 3pfb_A | 270 | Cinnamoyl esterase; alpha/beta hydrolase fold, hyd | 99.43 | |
| 1mj5_A | 302 | 1,3,4,6-tetrachloro-1,4-cyclohexadiene hydrolase; | 99.42 | |
| 2qvb_A | 297 | Haloalkane dehalogenase 3; RV2579, alpha-beta hydr | 99.42 | |
| 3i28_A | 555 | Epoxide hydrolase 2; aromatic hydrocarbons catabol | 99.42 | |
| 1k8q_A | 377 | Triacylglycerol lipase, gastric; APHA beta hydrola | 99.41 | |
| 1wm1_A | 317 | Proline iminopeptidase; complex with inhibitor, hy | 99.4 | |
| 2qmq_A | 286 | Protein NDRG2, protein NDR2; alpha/beta-hydrolases | 99.4 | |
| 2psd_A | 318 | Renilla-luciferin 2-monooxygenase; alpha/beta-hydr | 99.39 | |
| 3r0v_A | 262 | Alpha/beta hydrolase fold protein; structural geno | 99.39 | |
| 1q0r_A | 298 | RDMC, aclacinomycin methylesterase; anthracycline, | 99.38 | |
| 3bdi_A | 207 | Uncharacterized protein TA0194; NP_393672.1, predi | 99.37 | |
| 2qs9_A | 194 | Retinoblastoma-binding protein 9; B5T overexpresse | 99.37 | |
| 3r40_A | 306 | Fluoroacetate dehalogenase; FACD, defluorinase, al | 99.37 | |
| 3vdx_A | 456 | Designed 16NM tetrahedral protein CAGE containing | 99.36 | |
| 3pe6_A | 303 | Monoglyceride lipase; alpha-beta hydrolase fold, 2 | 99.35 | |
| 3rm3_A | 270 | MGLP, thermostable monoacylglycerol lipase; alpha/ | 99.35 | |
| 3qit_A | 286 | CURM TE, polyketide synthase; thioesterase, alpha/ | 99.34 | |
| 3fla_A | 267 | RIFR; alpha-beta hydrolase thioesterase, hydrolase | 99.34 | |
| 3dkr_A | 251 | Esterase D; alpha beta hydrolase, mechanism, catal | 99.34 | |
| 3bdv_A | 191 | Uncharacterized protein DUF1234; DUF1234 family pr | 99.32 | |
| 3hju_A | 342 | Monoglyceride lipase; alpha/beta hydrolase, hydrol | 99.31 | |
| 3ibt_A | 264 | 1H-3-hydroxy-4-oxoquinoline 2,4-dioxygenase; QDO, | 99.31 | |
| 3c5v_A | 316 | PME-1, protein phosphatase methylesterase 1; demet | 99.31 | |
| 1azw_A | 313 | Proline iminopeptidase; aminopeptidase, serine pro | 99.3 | |
| 1imj_A | 210 | CIB, CCG1-interacting factor B; alpha/beta hydrola | 99.3 | |
| 3h04_A | 275 | Uncharacterized protein; protein with unknown func | 99.29 | |
| 3llc_A | 270 | Putative hydrolase; structural genomics, joint cen | 99.28 | |
| 3qyj_A | 291 | ALR0039 protein; alpha/beta fold, hydrolase; 1.78A | 99.27 | |
| 2k2q_B | 242 | Surfactin synthetase thioesterase subunit; A/B-hyd | 99.27 | |
| 3b12_A | 304 | Fluoroacetate dehalogenase; dehalogease, hydrolase | 98.91 | |
| 1pja_A | 302 | Palmitoyl-protein thioesterase 2 precursor; hydrol | 99.26 | |
| 1tht_A | 305 | Thioesterase; 2.10A {Vibrio harveyi} SCOP: c.69.1. | 99.25 | |
| 2i3d_A | 249 | AGR_C_3351P, hypothetical protein ATU1826; structu | 99.25 | |
| 2wj6_A | 276 | 1H-3-hydroxy-4-oxoquinaldine 2,4-dioxygenase; oxid | 99.25 | |
| 1uxo_A | 192 | YDEN protein; hydrolase, A/B hydrolase, esterase, | 99.25 | |
| 1jfr_A | 262 | Lipase; serine hydrolase; 1.90A {Streptomyces exfo | 99.22 | |
| 1ufo_A | 238 | Hypothetical protein TT1662; alpha-beta fold, hydr | 99.22 | |
| 2fx5_A | 258 | Lipase; alpha-beta hydrolase; HET: TLA; 1.80A {Pse | 99.21 | |
| 3trd_A | 208 | Alpha/beta hydrolase; cellular processes; 1.50A {C | 99.21 | |
| 3ksr_A | 290 | Putative serine hydrolase; catalytic triad, struct | 99.2 | |
| 3l80_A | 292 | Putative uncharacterized protein SMU.1393C; alpha/ | 99.2 | |
| 1r3d_A | 264 | Conserved hypothetical protein VC1974; structural | 99.2 | |
| 1zi8_A | 236 | Carboxymethylenebutenolidase; alpha and beta prote | 99.16 | |
| 2qjw_A | 176 | Uncharacterized protein XCC1541; putative hydrolas | 99.15 | |
| 2fuk_A | 220 | XC6422 protein; A/B hydrolase, structural genomics | 99.14 | |
| 2o2g_A | 223 | Dienelactone hydrolase; YP_324580.1, structural ge | 99.12 | |
| 4fle_A | 202 | Esterase; structural genomics, PSI-biology, northe | 99.11 | |
| 2rau_A | 354 | Putative esterase; NP_343859.1, putative lipase, s | 99.11 | |
| 1vkh_A | 273 | Putative serine hydrolase; structural genomics, jo | 99.11 | |
| 1qlw_A | 328 | Esterase; anisotropic refinement, atomic resolutio | 99.1 | |
| 3vis_A | 306 | Esterase; alpha/beta-hydrolase fold, polyethylene | 99.08 | |
| 2pbl_A | 262 | Putative esterase/lipase/thioesterase; alpha/beta- | 99.07 | |
| 4i19_A | 388 | Epoxide hydrolase; structural genomics, PSI-biolog | 99.05 | |
| 3hxk_A | 276 | Sugar hydrolase; alpha-beta protein., structural g | 99.05 | |
| 3f67_A | 241 | Putative dienelactone hydrolase; alpha-beta-alpha | 99.04 | |
| 3qmv_A | 280 | Thioesterase, REDJ; alpha/beta hydrolase fold, hyd | 99.03 | |
| 3ils_A | 265 | PKS, aflatoxin biosynthesis polyketide synthase; A | 99.02 | |
| 1isp_A | 181 | Lipase; alpha/beta hydrolase fold, hydrolase; 1.30 | 99.01 | |
| 2jbw_A | 386 | Dhpon-hydrolase, 2,6-dihydroxy-pseudo-oxynicotine | 99.0 | |
| 1fj2_A | 232 | Protein (acyl protein thioesterase 1); alpha/beta | 99.0 | |
| 1ycd_A | 243 | Hypothetical 27.3 kDa protein in AAP1-SMF2 interge | 98.99 | |
| 1auo_A | 218 | Carboxylesterase; hydrolase; 1.80A {Pseudomonas fl | 98.98 | |
| 3fcy_A | 346 | Xylan esterase 1; alpha/beta hydrolase, carbohydra | 98.98 | |
| 2z3z_A | 706 | Dipeptidyl aminopeptidase IV; peptidase family S9, | 98.97 | |
| 3o4h_A | 582 | Acylamino-acid-releasing enzyme; alpha/beta hydrol | 98.97 | |
| 3fnb_A | 405 | Acylaminoacyl peptidase SMU_737; alpha-beta-alpha | 98.96 | |
| 1whs_B | 153 | Serine carboxypeptidase II; HET: NAG FUC; 2.00A {T | 98.96 | |
| 3bjr_A | 283 | Putative carboxylesterase; structural genomics, jo | 98.96 | |
| 2zsh_A | 351 | Probable gibberellin receptor GID1L1; plant hormon | 98.96 | |
| 2o7r_A | 338 | CXE carboxylesterase; alpha/beta hydrolase; 1.40A | 98.94 | |
| 3bxp_A | 277 | Putative lipase/esterase; putative carboxylesteras | 98.94 | |
| 2qru_A | 274 | Uncharacterized protein; alpha/beta-hydrolase, str | 98.94 | |
| 1xfd_A | 723 | DIP, dipeptidyl aminopeptidase-like protein 6, dip | 98.93 | |
| 3g02_A | 408 | Epoxide hydrolase; alpha/beta hydrolase fold, enan | 98.93 | |
| 3k2i_A | 422 | Acyl-coenzyme A thioesterase 4; alpha/beta hydrola | 98.91 | |
| 2r8b_A | 251 | AGR_C_4453P, uncharacterized protein ATU2452; APC6 | 98.89 | |
| 2q0x_A | 335 | Protein DUF1749, uncharacterized protein; alpha/be | 98.89 | |
| 3cn9_A | 226 | Carboxylesterase; alpha/beta hydrolase fold super- | 98.88 | |
| 2ecf_A | 741 | Dipeptidyl peptidase IV; prolyl oligopeptidase fam | 98.88 | |
| 2hdw_A | 367 | Hypothetical protein PA2218; alpha/beta hydrolase | 98.87 | |
| 3azo_A | 662 | Aminopeptidase; POP family, hydrolase; 2.00A {Stre | 98.87 | |
| 1l7a_A | 318 | Cephalosporin C deacetylase; structural genomics, | 98.87 | |
| 3d7r_A | 326 | Esterase; alpha/beta fold, hydrolase; 2.01A {Staph | 98.85 | |
| 1kez_A | 300 | Erythronolide synthase; polyketide synthase, modul | 98.85 | |
| 3hlk_A | 446 | Acyl-coenzyme A thioesterase 2, mitochondrial; alp | 98.84 | |
| 1vlq_A | 337 | Acetyl xylan esterase; TM0077, structural genomics | 98.79 | |
| 2h1i_A | 226 | Carboxylesterase; structural genomics, PSI-2, prot | 98.77 | |
| 3u0v_A | 239 | Lysophospholipase-like protein 1; alpha, beta hydr | 98.75 | |
| 1z68_A | 719 | Fibroblast activation protein, alpha subunit; sepr | 98.75 | |
| 4az3_B | 155 | Lysosomal protective protein 20 kDa chain; hydrola | 98.71 | |
| 2cb9_A | 244 | Fengycin synthetase; thioesterase, non-ribosomal p | 98.67 | |
| 1jmk_C | 230 | SRFTE, surfactin synthetase; thioesterase, non-rib | 98.66 | |
| 4a5s_A | 740 | Dipeptidyl peptidase 4 soluble form; hydrolase, ty | 98.65 | |
| 2c7b_A | 311 | Carboxylesterase, ESTE1; carboxyesterase, thermoph | 98.64 | |
| 3ebl_A | 365 | Gibberellin receptor GID1; alpha/beta hydrolase, l | 98.62 | |
| 4e15_A | 303 | Kynurenine formamidase; alpha/beta hydrolase fold, | 98.61 | |
| 3lcr_A | 319 | Tautomycetin biosynthetic PKS; alpha-beta hydrolas | 98.59 | |
| 3ain_A | 323 | 303AA long hypothetical esterase; carboxylesterase | 98.58 | |
| 3k6k_A | 322 | Esterase/lipase; alpha/beta hydrolase fold; 2.20A | 98.55 | |
| 3mve_A | 415 | FRSA, UPF0255 protein VV1_0328; FRSA,fermentation/ | 98.55 | |
| 4ao6_A | 259 | Esterase; hydrolase, thermo label; 1.60A {Unidenti | 98.54 | |
| 1lzl_A | 323 | Heroin esterase; alpha/beta hydrolase; 1.30A {Rhod | 98.53 | |
| 3b5e_A | 223 | MLL8374 protein; NP_108484.1, carboxylesterase, st | 98.52 | |
| 1yr2_A | 741 | Prolyl oligopeptidase; prolyl endopeptidase, mecha | 98.5 | |
| 2hfk_A | 319 | Pikromycin, type I polyketide synthase pikaiv; alp | 98.49 | |
| 1lns_A | 763 | X-prolyl dipeptidyl aminopetidase; alpha beta hydr | 98.49 | |
| 2bkl_A | 695 | Prolyl endopeptidase; mechanistic study, celiac sp | 98.47 | |
| 1jkm_A | 361 | Brefeldin A esterase; serine hydrolase, degradatio | 98.46 | |
| 2xdw_A | 710 | Prolyl endopeptidase; alpha/beta-hydrolase, amnesi | 98.45 | |
| 1jji_A | 311 | Carboxylesterase; alpha-beta hydrolase fold, hydro | 98.43 | |
| 1gxs_B | 158 | P-(S)-hydroxymandelonitrIle lyase chain B; inhibit | 98.42 | |
| 3qh4_A | 317 | Esterase LIPW; structural genomics, ssgcid, seattl | 98.4 | |
| 2wir_A | 313 | Pesta, alpha/beta hydrolase fold-3 domain protein; | 98.4 | |
| 2hm7_A | 310 | Carboxylesterase; alpha/beta hydrolase fold, hydro | 98.39 | |
| 2xe4_A | 751 | Oligopeptidase B; hydrolase-inhibitor complex, hyd | 98.36 | |
| 4h0c_A | 210 | Phospholipase/carboxylesterase; PSI-biology, midwe | 98.34 | |
| 3tej_A | 329 | Enterobactin synthase component F; nonribosomal pe | 98.32 | |
| 3fak_A | 322 | Esterase/lipase, ESTE5; HSL, hydrolase; 1.90A {Unc | 98.31 | |
| 4f21_A | 246 | Carboxylesterase/phospholipase family protein; str | 98.31 | |
| 3ga7_A | 326 | Acetyl esterase; phosphoserine, IDP00896, hydrolas | 98.3 | |
| 3og9_A | 209 | Protein YAHD A copper inducible hydrolase; alpha/b | 98.29 | |
| 3iuj_A | 693 | Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas | 98.29 | |
| 4fhz_A | 285 | Phospholipase/carboxylesterase; alpha/beta hydrola | 98.23 | |
| 1ac5_A | 483 | KEX1(delta)P; carboxypeptidase, hydrolase, glycopr | 98.2 | |
| 4hvt_A | 711 | Ritya.17583.B, post-proline cleaving enzyme; ssgci | 98.15 | |
| 1cpy_A | 421 | Serine carboxypeptidase; hydrolase (carboxypeptida | 98.08 | |
| 3d59_A | 383 | Platelet-activating factor acetylhydrolase; secret | 98.07 | |
| 1ivy_A | 452 | Human protective protein; carboxypeptidase, serine | 98.05 | |
| 3tjm_A | 283 | Fatty acid synthase; thioesterase domain, fatty ac | 98.04 | |
| 3lp5_A | 250 | Putative cell surface hydrolase; structural genom | 98.02 | |
| 3i6y_A | 280 | Esterase APC40077; lipase, structural genomics, PS | 98.02 | |
| 3ds8_A | 254 | LIN2722 protein; unkonwn function, structural geno | 98.02 | |
| 3ls2_A | 280 | S-formylglutathione hydrolase; psychrophilic organ | 98.02 | |
| 4ezi_A | 377 | Uncharacterized protein; alpha-beta hydrolases fol | 97.96 | |
| 3guu_A | 462 | Lipase A; protein structure, hydrolase; HET: 1PE; | 97.91 | |
| 2d81_A | 318 | PHB depolymerase; alpha/beta hydrolase fold, circu | 97.85 | |
| 3fcx_A | 282 | FGH, esterase D, S-formylglutathione hydrolase; re | 97.85 | |
| 3doh_A | 380 | Esterase; alpha-beta hydrolase, beta sheet; 2.60A | 97.85 | |
| 1jjf_A | 268 | Xylanase Z, endo-1,4-beta-xylanase Z, 1,4-beta-D-x | 97.64 | |
| 4b6g_A | 283 | Putative esterase; hydrolase, formaldehyde detoxif | 97.61 | |
| 3e4d_A | 278 | Esterase D; S-formylglutathione hydrolase, hydrola | 97.61 | |
| 3h2g_A | 397 | Esterase; xanthomonas oryzae PV. oryzae, cell WALL | 97.58 | |
| 3fle_A | 249 | SE_1780 protein; structural genomics, APC61035.1, | 97.5 | |
| 2uz0_A | 263 | Esterase, tributyrin esterase; alpha/beta hydrolas | 97.46 | |
| 3d0k_A | 304 | Putative poly(3-hydroxybutyrate) depolymerase LPQ; | 96.95 | |
| 2px6_A | 316 | Thioesterase domain; thioesaterse domain, orlistat | 96.85 | |
| 1tca_A | 317 | Lipase; hydrolase(carboxylic esterase); HET: NAG; | 96.76 | |
| 1ei9_A | 279 | Palmitoyl protein thioesterase 1; alpha/beta hydro | 96.31 | |
| 2qm0_A | 275 | BES; alpha-beta structure, structural genomics, PS | 96.03 | |
| 2vsq_A | 1304 | Surfactin synthetase subunit 3; ligase, peptidyl c | 95.7 | |
| 2b9v_A | 652 | Alpha-amino acid ester hydrolase; catalytic triad, | 95.14 | |
| 3gff_A | 331 | IROE-like serine hydrolase; NP_718593.1, structura | 94.92 | |
| 1sfr_A | 304 | Antigen 85-A; alpha/beta hydrolase, structural gen | 94.79 | |
| 1mpx_A | 615 | Alpha-amino acid ester hydrolase; alpha/beta hydro | 94.52 | |
| 1r88_A | 280 | MPT51/MPB51 antigen; ALFA/beta hydrolase fold, FBP | 92.91 | |
| 3c8d_A | 403 | Enterochelin esterase; alpha-beta-alpha sandwich, | 92.78 | |
| 2gzs_A | 278 | IROE protein; enterobactin, salmochelin, DFP, hydr | 91.6 | |
| 1dqz_A | 280 | 85C, protein (antigen 85-C); fibronectin, structur | 91.42 | |
| 3pic_A | 375 | CIP2; alpha/beta hydrolase fold, glucuronoyl ester | 90.78 | |
| 4g4g_A | 433 | 4-O-methyl-glucuronoyl methylesterase; alpha/beta | 90.25 | |
| 1gkl_A | 297 | Endo-1,4-beta-xylanase Y; hydrolase, esterase fami | 88.19 | |
| 3iii_A | 560 | COCE/NOND family hydrolase; structural genomics, c | 87.26 | |
| 2vz8_A | 2512 | Fatty acid synthase; transferase, phosphopantethei | 85.99 |
| >3v48_A Aminohydrolase, putative aminoacrylate hydrolase RUTD; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.10A {Escherichia coli SE11} | Back alignment and structure |
|---|
Probab=99.66 E-value=2.7e-16 Score=85.68 Aligned_cols=62 Identities=23% Similarity=0.382 Sum_probs=58.8
Q ss_pred CCccEEEEEcCCCcccCHHHHHHHHhhCCCcEEEEeCCCCccCCccChHHHHHHHHHHHhhc
Q 037210 1 VKQKTLIIWGEDDQIISSKLAVRLHCELPNAIIRQIPDCGHLPHVEKPGAVAKLIVEFIQEN 62 (73)
Q Consensus 1 i~~p~l~i~g~~d~~~~~~~~~~~~~~~~~~~~~~~~~~~H~~~~~~~~~~~~~~~~~~~~~ 62 (73)
|++|+++|+|++|.+++.+..+.+.+.+|+.++..++++||+++.|+|+.+++.+..|+...
T Consensus 199 i~~P~Lii~G~~D~~~p~~~~~~l~~~~p~~~~~~~~~~GH~~~~e~p~~~~~~i~~fl~~~ 260 (268)
T 3v48_A 199 IRCPVQIICASDDLLVPTACSSELHAALPDSQKMVMPYGGHACNVTDPETFNALLLNGLASL 260 (268)
T ss_dssp CCSCEEEEEETTCSSSCTHHHHHHHHHCSSEEEEEESSCCTTHHHHCHHHHHHHHHHHHHHH
T ss_pred CCCCeEEEEeCCCcccCHHHHHHHHHhCCcCeEEEeCCCCcchhhcCHHHHHHHHHHHHHHh
Confidence 57999999999999999999999999999999999999999999999999999999999764
|
| >3fob_A Bromoperoxidase; structural genomics, IDP00046, bacillus ANT peroxidase, oxidoreductase; 1.74A {Bacillus anthracis str} SCOP: c.69.1.0 | Back alignment and structure |
|---|
| >1iup_A META-cleavage product hydrolase; aromatic compounds, cumene, isopropylbenzene, META-cleavage compound hydrolase; 1.60A {Pseudomonas fluorescens} SCOP: c.69.1.10 PDB: 1iun_A 1iuo_A 1uk6_A 1uk7_A 1uk8_A 1uk9_A 1uka_A 1ukb_A 2d0d_A | Back alignment and structure |
|---|
| >3om8_A Probable hydrolase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MES; 2.25A {Pseudomonas aeruginosa} SCOP: c.69.1.0 | Back alignment and structure |
|---|
| >2puj_A 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrola; C-C bond hydrolase, hydrolase; HET: HPZ; 1.57A {Burkholderia xenovorans} PDB: 2pu7_A* 3v1m_A* 3v1l_A* 2puh_A* 3v1n_A* 3v1k_A* 2og1_A 2pu5_A 2rhw_A* 2rht_A* 2ri6_A | Back alignment and structure |
|---|
| >3c6x_A Hydroxynitrilase; atomic resolution, hydroxynitril lyase, catalysis, protonation state, AB initio calculations, substrate bindin; 1.05A {Hevea brasiliensis} SCOP: c.69.1.20 PDB: 1sc9_A 1yas_A* 2g4l_A* 2yas_A 1qj4_A 3c6y_A 3c6z_A 3c70_A 3yas_A 4yas_A 5yas_A* 6yas_A 7yas_A* 1yb6_A* 1yb7_A 1sck_A 1sci_A 1scq_A 1dwo_A 1dwp_A ... | Back alignment and structure |
|---|
| >1c4x_A BPHD, protein (2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoat hydrolase); PCB degradation; 2.40A {Rhodococcus SP} SCOP: c.69.1.10 | Back alignment and structure |
|---|
| >2ocg_A Valacyclovir hydrolase; alpha beta hydrolase fold; 1.75A {Homo sapiens} PDB: 2oci_A* 2ock_A 2ocl_A | Back alignment and structure |
|---|
| >3bf7_A Esterase YBFF; thioesterase, helical CAP, hydrolase; 1.10A {Escherichia coli} PDB: 3bf8_A | Back alignment and structure |
|---|
| >1u2e_A 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase; alpha/beta hydrolase fold; 2.10A {Escherichia coli} | Back alignment and structure |
|---|
| >3afi_E Haloalkane dehalogenase; A/B-hydrolase, hydrolase; 1.75A {Bradyrhizobium japonicum} PDB: 3a2m_A* 3a2n_A 3a2l_A* | Back alignment and structure |
|---|
| >1j1i_A META cleavage compound hydrolase; carbazole degradation, META cleavage product hydrolase, histidine tagged protein, alpha/beta-hydrolase; 1.86A {Janthinobacterium} SCOP: c.69.1.10 | Back alignment and structure |
|---|
| >1xkl_A SABP2, salicylic acid-binding protein 2; alpha-beta protein, structural genomics, protein structure initiative, PSI; HET: STH; 2.00A {Nicotiana tabacum} SCOP: c.69.1.20 PDB: 1y7i_A* 1y7h_A* | Back alignment and structure |
|---|
| >3ia2_A Arylesterase; alpha-beta hydrolase fold, transition state analog, hydrolas oxidoreductase, peroxidase; 1.65A {Pseudomonas fluorescens} SCOP: c.69.1.12 PDB: 1va4_A 3t52_A* 3t4u_A* 3hi4_A 3hea_A | Back alignment and structure |
|---|
| >2wue_A 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrolase BPHD; HET: KEK; 1.80A {Mycobacterium tuberculosis} PDB: 2wud_A* 2wuf_A* 2wug_A* 2vf2_A | Back alignment and structure |
|---|
| >1brt_A Bromoperoxidase A2; haloperoxidase, oxidoreductase, alpha/beta hydrolase fold, mutant M99T; 1.50A {Streptomyces aureofaciens} SCOP: c.69.1.12 PDB: 1bro_A 1a8u_A 1a7u_A | Back alignment and structure |
|---|
| >3nwo_A PIP, proline iminopeptidase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, mycobac smegmatis; 1.90A {Mycobacterium smegmatis} | Back alignment and structure |
|---|
| >2wfl_A Polyneuridine-aldehyde esterase; alkaloid metabolism, monoterpenoid indole alkaloids, PNAE, hydrolase, serine esterase; HET: CME; 2.10A {Rauvolfia serpentina} PDB: 2wfm_A 3gzj_A* | Back alignment and structure |
|---|
| >1wom_A RSBQ, sigma factor SIGB regulation protein RSBQ; alpha/beta hydrolase, signaling protein; 2.50A {Bacillus subtilis} PDB: 1wpr_A* | Back alignment and structure |
|---|
| >2xua_A PCAD, 3-oxoadipate ENOL-lactonase; hydrolase, catechol metabolism; 1.90A {Burkholderia xenovorans} | Back alignment and structure |
|---|
| >2yys_A Proline iminopeptidase-related protein; TTHA1809, structural genomics, unknown function; 2.20A {Thermus thermophilus} | Back alignment and structure |
|---|
| >1tqh_A Carboxylesterase precursor; tetrahedral intermediate, alpha/beta hydrolase; 1.63A {Geobacillus stearothermophilus} SCOP: c.69.1.29 PDB: 1r1d_A* 4diu_A | Back alignment and structure |
|---|
| >1mtz_A Proline iminopeptidase; alpha-beta hydrolase, CAP domain, caged active site, prolyl peptidase; 1.80A {Thermoplasma acidophilum} SCOP: c.69.1.7 PDB: 1mt3_A 1mu0_A* 1xrr_A 1xrq_A 1xro_A 1xrn_A 1xrm_A 1xrp_A 1xrl_A* 1xqw_A* 1xqx_A* 1xqy_A 1xqv_A | Back alignment and structure |
|---|
| >1b6g_A Haloalkane dehalogenase; hydrolase, alpha/beta-hydrolase; 1.15A {Xanthobacter autotrophicus} SCOP: c.69.1.8 PDB: 1be0_A 1cij_A 2yxp_X 1edd_A 1edb_A 2dhc_A 2dhe_A 2eda_A 2edc_A 2had_A 1ede_A 2pky_X 1bez_A 1bee_A 2dhd_A* 1hde_A | Back alignment and structure |
|---|
| >2e3j_A Epoxide hydrolase EPHB; epoxide hydrolase B, structural mycobacterium tuberculosis structural proteomics project, X hydrolase; 2.10A {Mycobacterium tuberculosis} PDB: 2zjf_A* | Back alignment and structure |
|---|
| >3dqz_A Alpha-hydroxynitrIle lyase-like protein; A/B-hydrloase fold, cyanogenesis; 2.50A {Arabidopsis thaliana} SCOP: c.69.1.0 | Back alignment and structure |
|---|
| >1a8s_A Chloroperoxidase F; haloperoxidase, oxidoreductase, propionate complex; 1.80A {Pseudomonas fluorescens} SCOP: c.69.1.12 | Back alignment and structure |
|---|
| >1ehy_A Protein (soluble epoxide hydrolase); alpha/beta hydrolase fold, epoxide degradation, epichlorohydrin; 2.10A {Agrobacterium tumefaciens} SCOP: c.69.1.11 | Back alignment and structure |
|---|
| >3sty_A Methylketone synthase 1; alpha/beta hydrolase, decarboxylase, hydrolase; HET: DKA; 1.70A {Lycopersicon hirsutum F} PDB: 3stu_A* 3stt_A* 3stv_A* 3stw_A* 3stx_A* | Back alignment and structure |
|---|
| >3u1t_A DMMA haloalkane dehalogenase; alpha/beta-hydrolase, hydrolase; 2.20A {Unidentified} | Back alignment and structure |
|---|
| >2xmz_A Hydrolase, alpha/beta hydrolase fold family; menaquinone biosynthesis, lyase; 1.94A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >2wtm_A EST1E; hydrolase; 1.60A {Clostridium proteoclasticum} PDB: 2wtn_A* | Back alignment and structure |
|---|
| >1a8q_A Bromoperoxidase A1; haloperoxidase, oxidoreductase; 1.75A {Streptomyces aureofaciens} SCOP: c.69.1.12 | Back alignment and structure |
|---|
| >1m33_A BIOH protein; alpha-betta-alpha sandwich, structural genomics, PSI, protei structure initiative; HET: MSE 3OH; 1.70A {Escherichia coli} SCOP: c.69.1.26 | Back alignment and structure |
|---|
| >3fsg_A Alpha/beta superfamily hydrolase; PF00561, MCSG, PSI, PSI-2, structural genomics, protein structure initiative, midwest for structural genomics; 2.00A {Oenococcus oeni} | Back alignment and structure |
|---|
| >1a88_A Chloroperoxidase L; haloperoxidase, oxidoreductase; 1.90A {Streptomyces lividans} SCOP: c.69.1.12 | Back alignment and structure |
|---|
| >1zoi_A Esterase; alpha/beta hydrolase fold; 1.60A {Pseudomonas putida} PDB: 4dgq_A | Back alignment and structure |
|---|
| >3hss_A Putative bromoperoxidase; alpha beta hydrolase, oxidoreductase, hydrolase; 1.90A {Mycobacterium tuberculosis} PDB: 3e3a_A 3hys_A 3hzo_A | Back alignment and structure |
|---|
| >3g9x_A Haloalkane dehalogenase; alpha/beta hydrolase, helical CAP domain, catalytic triad (A His272, Glu130), mutant, I135F, haloalkanes; 0.95A {Rhodococcus SP} SCOP: c.69.1.8 PDB: 3fwh_A 3fbw_A 3rlt_A 3rk4_A 1bn6_A 1bn7_A 4fwb_A 1cqw_A 3sk0_A 2v9z_A | Back alignment and structure |
|---|
| >3oos_A Alpha/beta hydrolase family protein; APC67239.0, protein structure initiative, PSI-2, structural midwest center for structural genomics, MCSG; HET: MSE PG4; 1.65A {Bacillus anthracis} | Back alignment and structure |
|---|
| >3p2m_A Possible hydrolase; alpha/beta hydrolase superfamily; 2.80A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >4fbl_A LIPS lipolytic enzyme; thermostable, structural genomics, enzyme function initiativ structural proteomics in europe, spine; HET: SPD; 1.99A {Unidentified} PDB: 4fbm_A | Back alignment and structure |
|---|
| >3kxp_A Alpha-(N-acetylaminomethylene)succinic acid hydrolase; alpha/beta hydrolase, PLP degradation, E-2- (acetamidomethylene)succinate; 2.26A {Mesorhizobium loti} | Back alignment and structure |
|---|
| >1hkh_A Gamma lactamase; hydrolase, alpha/beta hydrolase, CO-factor free haloperoxidase,; 1.73A {Microbacterium} SCOP: c.69.1.12 PDB: 1hl7_A* | Back alignment and structure |
|---|
| >3kda_A CFTR inhibitory factor (CIF); alpha/beta hydrolase, hydrolase; 1.50A {Pseudomonas aeruginosa ucbpp-pa14} PDB: 3kd2_A 3pi6_A | Back alignment and structure |
|---|
| >4dnp_A DAD2; alpha/beta hydrolase, hydrolase; 2.15A {Petunia hybrida} PDB: 4dnq_A | Back alignment and structure |
|---|
| >2y6u_A Peroxisomal membrane protein LPX1; hydrolase, putative esterase, putative lipase; HET: CME CSO; 1.90A {Saccharomyces cerevisiae} PDB: 2y6v_A* | Back alignment and structure |
|---|
| >4f0j_A Probable hydrolytic enzyme; alpha/beta hydrolase fold, structural genomics, joint center structural genomics, JCSG; HET: MSE; 1.50A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >2pl5_A Homoserine O-acetyltransferase; alpha/beta hydrolase superfa transferase; 2.20A {Leptospira interrogans} SCOP: c.69.1.40 | Back alignment and structure |
|---|
| >2cjp_A Epoxide hydrolase; HET: PG4 VPR; 1.95A {Solanum tuberosum} PDB: 3cxu_A* | Back alignment and structure |
|---|
| >2b61_A Homoserine O-acetyltransferase; acyl-enzyme, aspartate pathway, coenzyme A, structure-functi studies, alpha-beta hydrolase fold; 1.65A {Haemophilus influenzae} SCOP: c.69.1.40 | Back alignment and structure |
|---|
| >3bwx_A Alpha/beta hydrolase; YP_496220.1, joint center for structural genomics, protein structure initiative, PSI-2; HET: MSE; 1.50A {Novosphingobium aromaticivorans} | Back alignment and structure |
|---|
| >3qvm_A OLEI00960; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta hydrolase fold, hydrolase; 2.00A {Oleispira antarctica} | Back alignment and structure |
|---|
| >4g9e_A AHL-lactonase, alpha/beta hydrolase fold protein; AHL-binding; HET: C4L; 1.09A {Ochrobactrum} PDB: 4g5x_A* 4g8b_A* 4g8d_A 4g8c_A* 4g9g_A | Back alignment and structure |
|---|
| >2vat_A Acetyl-COA--deacetylcephalosporin C acetyltransferase; A/B- hydrolase fold, acyltransferase, acetyl coenzyme A, antibiotic biosynthesis; HET: COA; 2.2A {Acremonium chrysogenum} SCOP: c.69.1.40 PDB: 2vav_A* 2vax_A* | Back alignment and structure |
|---|
| >2r11_A Carboxylesterase NP; 2632844, putative hydrolase, structural genomics, joint center for structural genomics, JCSG; HET: MSE PGE; 1.96A {Bacillus subtilis} | Back alignment and structure |
|---|
| >2xt0_A Haloalkane dehalogenase; hydrolase, alpha-beta hydrolase fold; 1.90A {Plesiocystis pacifica} | Back alignment and structure |
|---|
| >3i1i_A Homoserine O-acetyltransferase; structural genomics, IDP01610, O-acetyltransfera bacillus anthracis; HET: MSE; 2.44A {Bacillus anthracis str} | Back alignment and structure |
|---|
| >3e0x_A Lipase-esterase related protein; APC60309, clostridium acetobutylicum ATCC 824, structural genomics, PSI-2; HET: MSE; 1.45A {Clostridium acetobutylicum} | Back alignment and structure |
|---|
| >3pfb_A Cinnamoyl esterase; alpha/beta hydrolase fold, hydrolase, cinnamoyl/Fe esterase, hydroxycinammates, extracellular; HET: ZYC; 1.58A {Lactobacillus johnsonii} PDB: 3pf9_A* 3pfc_A* 3s2z_A* 3pf8_A 3qm1_A* | Back alignment and structure |
|---|
| >1mj5_A 1,3,4,6-tetrachloro-1,4-cyclohexadiene hydrolase; LINB, haloalkane dehalogenase, 1, 3, 4, 4-cyclohexadiene dehalogenase; 0.95A {Sphingomonas paucimobilis} SCOP: c.69.1.8 PDB: 1cv2_A 1d07_A 2bfn_A 1g42_A* 1g4h_A* 1g5f_A* 1iz7_A 1iz8_A* 1k5p_A 1k63_A 1k6e_A | Back alignment and structure |
|---|
| >2qvb_A Haloalkane dehalogenase 3; RV2579, alpha-beta hydrolase protei structural genomics consortium, TBSGC, hydrolase; 1.19A {Mycobacterium tuberculosis} PDB: 2o2i_A 2o2h_A | Back alignment and structure |
|---|
| >3i28_A Epoxide hydrolase 2; aromatic hydrocarbons catabolism, detoxification, magnesium, metal-binding, peroxisome; HET: 34N; 1.95A {Homo sapiens} PDB: 1s8o_A* 1zd2_P* 1vj5_A* 1zd4_A* 1zd5_A* 3i1y_A* 1zd3_A* 3koo_A* 3otq_A* 4hai_A* 1cqz_A 1cr6_A* 1ek1_A* 1ek2_A* 3ans_A* 3ant_A* 3pdc_A* | Back alignment and structure |
|---|
| >1k8q_A Triacylglycerol lipase, gastric; APHA beta hydrolase fold, hydrolase; HET: NAG BOG C11; 2.70A {Canis lupus familiaris} SCOP: c.69.1.6 PDB: 1hlg_A* | Back alignment and structure |
|---|
| >1wm1_A Proline iminopeptidase; complex with inhibitor, hydrolase; HET: PTB; 2.10A {Serratia marcescens} SCOP: c.69.1.7 PDB: 1qtr_A* 1x2b_A* 1x2e_A* | Back alignment and structure |
|---|
| >2qmq_A Protein NDRG2, protein NDR2; alpha/beta-hydrolases fold, NDR family, developmental protei differentiation, neurogenesis, phosphorylation; HET: 2PE; 1.70A {Mus musculus} PDB: 2xmq_A 2xmr_A 2xms_A | Back alignment and structure |
|---|
| >2psd_A Renilla-luciferin 2-monooxygenase; alpha/beta-hydrolase, luciferase, oxidoreductase; 1.40A {Renilla reniformis} PDB: 2pse_A 2psj_A* 2psh_A 2psf_A | Back alignment and structure |
|---|
| >3r0v_A Alpha/beta hydrolase fold protein; structural genomics, PSI-biology, protein structure initiati alpha/beta hydrolase; HET: MSE; 1.38A {Sphaerobacter thermophilus} | Back alignment and structure |
|---|
| >1q0r_A RDMC, aclacinomycin methylesterase; anthracycline, hydrolase, polyketide, tailoring enzyme, structural proteomics in europe, spine; HET: AKT 1PE; 1.45A {Streptomyces purpurascens} SCOP: c.69.1.28 PDB: 1q0z_A* | Back alignment and structure |
|---|
| >3bdi_A Uncharacterized protein TA0194; NP_393672.1, predicted CIB-like hydrolase, structural genomi center for structural genomics; HET: MSE; 1.45A {Thermoplasma acidophilum dsm 1728} | Back alignment and structure |
|---|
| >2qs9_A Retinoblastoma-binding protein 9; B5T overexpressed gene protein, BOG, RBBP9, RBBP10, HR2978, NESG, structural genomics, PSI-2; 1.72A {Homo sapiens} | Back alignment and structure |
|---|
| >3r40_A Fluoroacetate dehalogenase; FACD, defluorinase, alpha/beta hydrolase, hydrolase; 1.05A {Rhodopseudomonas palustris} PDB: 3r3w_A 3r3x_A 3r3v_A 3r3u_A 3r3z_A 3r41_A 3r3y_A | Back alignment and structure |
|---|
| >3vdx_A Designed 16NM tetrahedral protein CAGE containing bromoperoxidase BPO-A2 and matrix...; protein design, bionanotechnology; 3.00A {Streptomyces aureofaciens} PDB: 4d9j_A | Back alignment and structure |
|---|
| >3pe6_A Monoglyceride lipase; alpha-beta hydrolase fold, 2-arachidonyl-glycerol, M associated, hydrolase, hydrolase-hydrolase inhibitor comple; HET: ZYH; 1.35A {Homo sapiens} PDB: 3jw8_A 3jwe_A* | Back alignment and structure |
|---|
| >3rm3_A MGLP, thermostable monoacylglycerol lipase; alpha/beta hydrolase fold, hydrolase; 1.20A {Bacillus SP} PDB: 3rli_A | Back alignment and structure |
|---|
| >3qit_A CURM TE, polyketide synthase; thioesterase, alpha/beta hydrolase, decarboxylase, sulfate elimination, terminal alkene production; 1.68A {Lyngbya majuscula 19L} | Back alignment and structure |
|---|
| >3fla_A RIFR; alpha-beta hydrolase thioesterase, hydrolase; HET: MSE; 1.80A {Amycolatopsis mediterranei} PDB: 3flb_A* | Back alignment and structure |
|---|
| >3dkr_A Esterase D; alpha beta hydrolase, mechanism, catalytic triad, rotation; 1.60A {Lactobacillus rhamnosus} SCOP: c.69.1.0 PDB: 3dlt_A 3dyi_A 3dyv_A 3e1g_A | Back alignment and structure |
|---|
| >3bdv_A Uncharacterized protein DUF1234; DUF1234 family protein, alpha/beta-hydrolases fold, structur genomics; HET: MSE; 1.66A {Pectobacterium atrosepticum SCRI1043} | Back alignment and structure |
|---|
| >3hju_A Monoglyceride lipase; alpha/beta hydrolase, hydrolase, serine esterase; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >3ibt_A 1H-3-hydroxy-4-oxoquinoline 2,4-dioxygenase; QDO, oxidoreductase; 2.60A {Pseudomonas putida} | Back alignment and structure |
|---|
| >3c5v_A PME-1, protein phosphatase methylesterase 1; demethylase, PP2A, alternative splicing, hydrolase, phosphoprotein, serine esterase; 2.00A {Homo sapiens} PDB: 3c5w_P | Back alignment and structure |
|---|
| >1azw_A Proline iminopeptidase; aminopeptidase, serine protease, xanthomonas campestris; 2.70A {Xanthomonas citri} SCOP: c.69.1.7 | Back alignment and structure |
|---|
| >1imj_A CIB, CCG1-interacting factor B; alpha/beta hydrolase, CCG1 interactor; 2.20A {Homo sapiens} SCOP: c.69.1.23 | Back alignment and structure |
|---|
| >3h04_A Uncharacterized protein; protein with unknown function, structural genomics, MCSG, PS protein structure initiative; 1.90A {Staphylococcus aureus subsp} | Back alignment and structure |
|---|
| >3llc_A Putative hydrolase; structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE PG4; 1.80A {Agrobacterium vitis} | Back alignment and structure |
|---|
| >3qyj_A ALR0039 protein; alpha/beta fold, hydrolase; 1.78A {Nostoc SP} | Back alignment and structure |
|---|
| >2k2q_B Surfactin synthetase thioesterase subunit; A/B-hydrolase, NRPS, non-ribosomal peptide synthetase, type II thioesterase, antibiotic biosynthesis; NMR {Bacillus subtilis} PDB: 2ron_A | Back alignment and structure |
|---|
| >3b12_A Fluoroacetate dehalogenase; dehalogease, hydrolase; 1.20A {Burkholderia SP} PDB: 1y37_A | Back alignment and structure |
|---|
| >1pja_A Palmitoyl-protein thioesterase 2 precursor; hydrolase, glycoprotein, lysosome; HET: NAG; 2.70A {Homo sapiens} SCOP: c.69.1.13 | Back alignment and structure |
|---|
| >1tht_A Thioesterase; 2.10A {Vibrio harveyi} SCOP: c.69.1.13 | Back alignment and structure |
|---|
| >2i3d_A AGR_C_3351P, hypothetical protein ATU1826; structural genomics, APC5865, hydrolase, PSI-2, protein STRU initiative; HET: MSE; 1.50A {Agrobacterium tumefaciens str} SCOP: c.69.1.36 | Back alignment and structure |
|---|
| >2wj6_A 1H-3-hydroxy-4-oxoquinaldine 2,4-dioxygenase; oxidoreductase, alpha/beta hydrolase; HET: ZZ8 SRT; 2.00A {Arthrobacter nitroguajacolicus} PDB: 2wj4_A* 2wj3_A* 2wm2_A* | Back alignment and structure |
|---|
| >1uxo_A YDEN protein; hydrolase, A/B hydrolase, esterase, PSI, protein structure initiative, MCSG, midwest center for structural genomics; 1.8A {Bacillus subtilis} SCOP: c.69.1.31 | Back alignment and structure |
|---|
| >1jfr_A Lipase; serine hydrolase; 1.90A {Streptomyces exfoliatus} SCOP: c.69.1.16 | Back alignment and structure |
|---|
| >1ufo_A Hypothetical protein TT1662; alpha-beta fold, hydrolase, structural genomics, riken structural genomics/proteomics initiative, RSGI; 1.60A {Thermus thermophilus} SCOP: c.69.1.27 | Back alignment and structure |
|---|
| >2fx5_A Lipase; alpha-beta hydrolase; HET: TLA; 1.80A {Pseudomonas mendocina} | Back alignment and structure |
|---|
| >3trd_A Alpha/beta hydrolase; cellular processes; 1.50A {Coxiella burnetii} | Back alignment and structure |
|---|
| >3ksr_A Putative serine hydrolase; catalytic triad, structural genomics, JOIN for structural genomics, JCSG; 2.69A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >3l80_A Putative uncharacterized protein SMU.1393C; alpha/beta hydrolase fold, carboxylesterase, Ser- hydrolase; 2.00A {Streptococcus mutans} | Back alignment and structure |
|---|
| >1r3d_A Conserved hypothetical protein VC1974; structural genomics, hydrolase, NYSGXRC, NEW YORK SGX research center for structural genomics, PSI; 1.90A {Vibrio cholerae} SCOP: c.69.1.35 | Back alignment and structure |
|---|
| >1zi8_A Carboxymethylenebutenolidase; alpha and beta proteins, 3-D structure, serine esterase, HYD aromatic hydrocarbons, catabolism; 1.40A {Pseudomonas putida} PDB: 1zj5_A* 1zi9_A 1zi6_A 1zj4_A* 1din_A 1ziy_A* 1zic_A 1zix_A 1ggv_A* | Back alignment and structure |
|---|
| >2qjw_A Uncharacterized protein XCC1541; putative hydrolase of the alpha/beta superfamily, structural genomics; HET: MSE TLA P6G; 1.35A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >2fuk_A XC6422 protein; A/B hydrolase, structural genomics, X-RAY diffraction; 1.60A {Xanthomonas campestris} SCOP: c.69.1.36 | Back alignment and structure |
|---|
| >2o2g_A Dienelactone hydrolase; YP_324580.1, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.92A {Anabaena variabilis} | Back alignment and structure |
|---|
| >4fle_A Esterase; structural genomics, PSI-biology, northeast structural genom consortium, NESG, alpha-beta protein, rossmann fold, HY; 2.10A {Yersinia enterocolitica subsp} | Back alignment and structure |
|---|
| >2rau_A Putative esterase; NP_343859.1, putative lipase, structural genomics, joint CEN structural genomics, JCSG; HET: PG4 UNL; 1.85A {Sulfolobus solfataricus P2} | Back alignment and structure |
|---|
| >1vkh_A Putative serine hydrolase; structural genomics, joint center structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.85A {Saccharomyces cerevisiae} SCOP: c.69.1.32 | Back alignment and structure |
|---|
| >1qlw_A Esterase; anisotropic refinement, atomic resolution, alpha/beta hydrolase; 1.09A {Alcaligenes SP} SCOP: c.69.1.15 PDB: 2wkw_A* | Back alignment and structure |
|---|
| >3vis_A Esterase; alpha/beta-hydrolase fold, polyethylene terephthal hydrolase; HET: PE4; 1.76A {Thermobifida alba} | Back alignment and structure |
|---|
| >2pbl_A Putative esterase/lipase/thioesterase; alpha/beta-hydrolases fold, structural genomics, joint cente structural genomics, JCSG; 1.79A {Silicibacter SP} SCOP: c.69.1.2 | Back alignment and structure |
|---|
| >4i19_A Epoxide hydrolase; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics, MCSG; 2.15A {Streptomyces carzinostaticus subsp} | Back alignment and structure |
|---|
| >3hxk_A Sugar hydrolase; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 3.20A {Lactococcus lactis subsp} | Back alignment and structure |
|---|
| >3f67_A Putative dienelactone hydrolase; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; 1.74A {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
| >3qmv_A Thioesterase, REDJ; alpha/beta hydrolase fold, hydrolase; 2.12A {Streptomyces coelicolor} PDB: 3qmw_A* | Back alignment and structure |
|---|
| >3ils_A PKS, aflatoxin biosynthesis polyketide synthase; A/B hydrolase, thioesterase, norsolorinic acid, P polyketide, acyltransferase; 1.70A {Aspergillus parasiticus} | Back alignment and structure |
|---|
| >1isp_A Lipase; alpha/beta hydrolase fold, hydrolase; 1.30A {Bacillus subtilis} SCOP: c.69.1.18 PDB: 1i6w_A 1r4z_A* 1r50_A* 2qxu_A 2qxt_A 1t4m_A 1t2n_A 3d2a_A 3qzu_A 3d2b_A 3d2c_A 3qmm_A | Back alignment and structure |
|---|
| >2jbw_A Dhpon-hydrolase, 2,6-dihydroxy-pseudo-oxynicotine hydrolase; alpha/beta hydrolase, META-cleavage pathway; 2.1A {Arthrobacter nicotinovorans} SCOP: c.69.1.41 | Back alignment and structure |
|---|
| >1fj2_A Protein (acyl protein thioesterase 1); alpha/beta hydrolase, serine hydrolase, SAD, anomalous diffr hydrolase; 1.50A {Homo sapiens} SCOP: c.69.1.14 | Back alignment and structure |
|---|
| >1ycd_A Hypothetical 27.3 kDa protein in AAP1-SMF2 intergenic region; esterase, lipase, serine hydrolase, structural genomics; HET: LI5; 1.70A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1auo_A Carboxylesterase; hydrolase; 1.80A {Pseudomonas fluorescens} SCOP: c.69.1.14 PDB: 1aur_A* | Back alignment and structure |
|---|
| >3fcy_A Xylan esterase 1; alpha/beta hydrolase, carbohydrate esterase, CE7; 2.10A {Thermoanaerobacterium SP} | Back alignment and structure |
|---|
| >2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* | Back alignment and structure |
|---|
| >3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A | Back alignment and structure |
|---|
| >3fnb_A Acylaminoacyl peptidase SMU_737; alpha-beta-alpha sandwich, helix bundle, structural genomics protein structure initiative; HET: PGE; 2.12A {Streptococcus mutans} | Back alignment and structure |
|---|
| >1whs_B Serine carboxypeptidase II; HET: NAG FUC; 2.00A {Triticum aestivum} SCOP: c.69.1.5 PDB: 1wht_B* 1bcs_B* 1bcr_B* 3sc2_B* | Back alignment and structure |
|---|
| >3bjr_A Putative carboxylesterase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 2.09A {Lactobacillus plantarum WCFS1} | Back alignment and structure |
|---|
| >2zsh_A Probable gibberellin receptor GID1L1; plant hormone receptor, gibberellin, gibberellin signaling pathway, hydrolase, nucleus, receptor, developmental protein; HET: GA3; 1.80A {Arabidopsis thaliana} PDB: 2zsi_A* | Back alignment and structure |
|---|
| >2o7r_A CXE carboxylesterase; alpha/beta hydrolase; 1.40A {Actinidia eriantha} PDB: 2o7v_A | Back alignment and structure |
|---|
| >3bxp_A Putative lipase/esterase; putative carboxylesterase, structural genomics, joint center structural genomics, JCSG; HET: EPE; 1.70A {Lactobacillus plantarum WCFS1} PDB: 3d3n_A* | Back alignment and structure |
|---|
| >2qru_A Uncharacterized protein; alpha/beta-hydrolase, structural GENO PSI-2, protein structure initiative, midwest center for STR genomics, MCSG; 1.65A {Enterococcus faecalis} | Back alignment and structure |
|---|
| >1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 | Back alignment and structure |
|---|
| >3g02_A Epoxide hydrolase; alpha/beta hydrolase fold, enantioselective, mutant, directed evolution; 1.50A {Aspergillus niger} SCOP: c.69.1.11 PDB: 1qo7_A 3g0i_A* | Back alignment and structure |
|---|
| >3k2i_A Acyl-coenzyme A thioesterase 4; alpha/beta hydrolase fold seven-stranded beta-sandwich, structural genomics, structural genomics consortium, SGC; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >2r8b_A AGR_C_4453P, uncharacterized protein ATU2452; APC6088, agrobacterium tumefaciens STR. C58 structural genomics, PSI-2; 2.56A {Agrobacterium tumefaciens str} SCOP: c.69.1.14 | Back alignment and structure |
|---|
| >2q0x_A Protein DUF1749, uncharacterized protein; alpha/beta hydrolase fold, structural genomics, structural G of pathogenic protozoa consortium; 2.20A {Trypanosoma brucei} | Back alignment and structure |
|---|
| >3cn9_A Carboxylesterase; alpha/beta hydrolase fold super-family, hydrolase; HET: 2PE; 2.09A {Pseudomonas aeruginosa} PDB: 3cn7_A* | Back alignment and structure |
|---|
| >2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} | Back alignment and structure |
|---|
| >2hdw_A Hypothetical protein PA2218; alpha/beta hydrolase fold, structural genomics, PSI, structure initiative; 2.00A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A | Back alignment and structure |
|---|
| >1l7a_A Cephalosporin C deacetylase; structural genomics, alpha-beta-alpha sandwich, PSI, protein structure initiative; 1.50A {Bacillus subtilis} SCOP: c.69.1.25 PDB: 1odt_C 1ods_A 3fvt_A 3fvr_A 3fyu_A* 2xlb_A 2xlc_A 3fyt_A* 3fyu_B* | Back alignment and structure |
|---|
| >3d7r_A Esterase; alpha/beta fold, hydrolase; 2.01A {Staphylococcus aureus subsp} | Back alignment and structure |
|---|
| >1kez_A Erythronolide synthase; polyketide synthase, modular polyketide synthase, thioesterase, 6-DEB, TE, DEBS, alpha, beta-hydrolase; 2.80A {Saccharopolyspora erythraea} SCOP: c.69.1.22 PDB: 1mo2_A | Back alignment and structure |
|---|
| >3hlk_A Acyl-coenzyme A thioesterase 2, mitochondrial; alpha/beta hydrolase, alternative splicing, hydrolase, mitochondrion, polymorphism, serine esterase; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >1vlq_A Acetyl xylan esterase; TM0077, structural genomics, JCSG, PR structure initiative, PSI, joint center for structural GENO hydrolase; 2.10A {Thermotoga maritima} SCOP: c.69.1.25 PDB: 3m81_A 3m83_A* 3m82_A* | Back alignment and structure |
|---|
| >2h1i_A Carboxylesterase; structural genomics, PSI-2, protein struct initiative, midwest center for structural genomics, MCSG, H; HET: MSE; 2.80A {Bacillus cereus} SCOP: c.69.1.14 | Back alignment and structure |
|---|
| >3u0v_A Lysophospholipase-like protein 1; alpha, beta hydrolase fold, hydrolase; 1.72A {Homo sapiens} | Back alignment and structure |
|---|
| >1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >4az3_B Lysosomal protective protein 20 kDa chain; hydrolase, drug discovery, carboxypeptidase, cardiovascular; HET: NAG S35; 2.04A {Homo sapiens} PDB: 4az0_B* | Back alignment and structure |
|---|
| >2cb9_A Fengycin synthetase; thioesterase, non-ribosomal peptide synthesis, alpha/beta- hydrolases, catalytic triade, hydrolase; 1.8A {Bacillus subtilis} PDB: 2cbg_A* | Back alignment and structure |
|---|
| >1jmk_C SRFTE, surfactin synthetase; thioesterase, non-ribosomal peptide synthesis, alpha-beta hydrolase, cyclic peptide; 1.71A {Bacillus subtilis} SCOP: c.69.1.22 | Back alignment and structure |
|---|
| >4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... | Back alignment and structure |
|---|
| >2c7b_A Carboxylesterase, ESTE1; carboxyesterase, thermophilic enzyme, hydrolase, HSL, alpha/beta hydrolase fold; 2.3A {Uncultured archaeon} | Back alignment and structure |
|---|
| >3ebl_A Gibberellin receptor GID1; alpha/beta hydrolase, lipase, gibberellin signaling pathway, hydrolase, nucleus, hydrolase receptor; HET: GA4; 1.90A {Oryza sativa subsp} PDB: 3ed1_A* | Back alignment and structure |
|---|
| >4e15_A Kynurenine formamidase; alpha/beta hydrolase fold, hydrolase-hydrolase inhibitor COM; HET: SEB; 1.50A {Drosophila melanogaster} PDB: 4e14_A* 4e11_A | Back alignment and structure |
|---|
| >3lcr_A Tautomycetin biosynthetic PKS; alpha-beta hydrolase, thioesterase, polyketide synthase, phosphopantetheine, transferase, hydrolase; 2.00A {Streptomyces SP} | Back alignment and structure |
|---|
| >3ain_A 303AA long hypothetical esterase; carboxylesterase, thermophilic, dimer, archaea, R267G, hydro; 1.65A {Sulfolobus tokodaii} PDB: 3aio_A 3ail_A 3aik_A 3aim_A | Back alignment and structure |
|---|
| >3k6k_A Esterase/lipase; alpha/beta hydrolase fold; 2.20A {Uncultured bacterium} PDB: 3dnm_A | Back alignment and structure |
|---|
| >3mve_A FRSA, UPF0255 protein VV1_0328; FRSA,fermentation/respiration switch protein, hydrolase ACTI lyase; 2.20A {Vibrio vulnificus} PDB: 3our_A | Back alignment and structure |
|---|
| >4ao6_A Esterase; hydrolase, thermo label; 1.60A {Unidentified} PDB: 4ao7_A 4ao8_A | Back alignment and structure |
|---|
| >1lzl_A Heroin esterase; alpha/beta hydrolase; 1.30A {Rhodococcus SP} SCOP: c.69.1.2 PDB: 1lzk_A | Back alignment and structure |
|---|
| >3b5e_A MLL8374 protein; NP_108484.1, carboxylesterase, structural genomics, joint CE structural genomics, JCSG, protein structure initiative; 1.75A {Mesorhizobium loti} SCOP: c.69.1.14 | Back alignment and structure |
|---|
| >1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} | Back alignment and structure |
|---|
| >2hfk_A Pikromycin, type I polyketide synthase pikaiv; alpha/beta hydrolase, thioesterase; HET: E4H; 1.79A {Streptomyces venezuelae} PDB: 2h7x_A* 2h7y_A* 2hfj_A* 1mna_A 1mn6_A 1mnq_A | Back alignment and structure |
|---|
| >1lns_A X-prolyl dipeptidyl aminopetidase; alpha beta hydrolase fold; 2.20A {Lactococcus lactis} SCOP: a.40.2.1 b.18.1.13 c.69.1.21 | Back alignment and structure |
|---|
| >2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} | Back alignment and structure |
|---|
| >1jkm_A Brefeldin A esterase; serine hydrolase, degradation of brefeldin A, alpha/beta hydrolase family; 1.85A {Bacillus subtilis} SCOP: c.69.1.2 | Back alignment and structure |
|---|
| >2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* | Back alignment and structure |
|---|
| >1jji_A Carboxylesterase; alpha-beta hydrolase fold, hydrolase; HET: EPE; 2.20A {Archaeoglobus fulgidus} SCOP: c.69.1.2 | Back alignment and structure |
|---|
| >1gxs_B P-(S)-hydroxymandelonitrIle lyase chain B; inhibitor complex, cyanogenesis mechanism; HET: NAG FUL DKA; 2.3A {Sorghum bicolor} SCOP: c.69.1.5 | Back alignment and structure |
|---|
| >3qh4_A Esterase LIPW; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, tuberculosis, O LIPW, heroin esterase; 1.75A {Mycobacterium marinum} | Back alignment and structure |
|---|
| >2hm7_A Carboxylesterase; alpha/beta hydrolase fold, hydrolase; 2.00A {Alicyclobacillus acidocaldarius} PDB: 1evq_A* 1u4n_A 1qz3_A | Back alignment and structure |
|---|
| >2xe4_A Oligopeptidase B; hydrolase-inhibitor complex, hydrolase, protease inhibitor trypanosomes, CLAN SC; HET: FC0 RGL; 1.65A {Leishmania major} | Back alignment and structure |
|---|
| >4h0c_A Phospholipase/carboxylesterase; PSI-biology, midwest center for structural genomics, MCSG, hydrolase; HET: CIT; 1.62A {Dyadobacter fermentans} | Back alignment and structure |
|---|
| >3tej_A Enterobactin synthase component F; nonribosomal peptide, thioesterase, carrier domain, ATP- BIN enterobactin biosynthesis, ION transport, iron; HET: UF0; 1.90A {Escherichia coli} PDB: 2roq_A | Back alignment and structure |
|---|
| >3fak_A Esterase/lipase, ESTE5; HSL, hydrolase; 1.90A {Uncultured bacterium} PDB: 3g9t_A 3g9u_A 3g9z_A 3h17_A* 3h18_A* 3h19_A 3h1a_A 3h1b_A 3l1h_A 3l1i_A 3l1j_A 3v9a_A | Back alignment and structure |
|---|
| >4f21_A Carboxylesterase/phospholipase family protein; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.50A {Francisella tularensis subsp} | Back alignment and structure |
|---|
| >3ga7_A Acetyl esterase; phosphoserine, IDP00896, hydrolase, serine structural genomics, center for structural genomics of INFE diseases, csgid; HET: SEP MSE; 1.55A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >3og9_A Protein YAHD A copper inducible hydrolase; alpha/beta hydrolase, copper homeostasis, malic acid; 1.88A {Lactococcus lactis subsp} SCOP: c.69.1.0 | Back alignment and structure |
|---|
| >3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* | Back alignment and structure |
|---|
| >4fhz_A Phospholipase/carboxylesterase; alpha/beta hydrolase superfamily, central beta-STR sheet, flanked alpha helices, hydrolase; 2.01A {Rhodobacter sphaeroides} PDB: 4ftw_A* | Back alignment and structure |
|---|
| >1ac5_A KEX1(delta)P; carboxypeptidase, hydrolase, glycoprotein, transmembrane; HET: NAG; 2.40A {Saccharomyces cerevisiae} SCOP: c.69.1.5 | Back alignment and structure |
|---|
| >4hvt_A Ritya.17583.B, post-proline cleaving enzyme; ssgcid, structural genomics, S structural genomics center for infectious disease; 1.70A {Rickettsia typhi} | Back alignment and structure |
|---|
| >1cpy_A Serine carboxypeptidase; hydrolase (carboxypeptidase); HET: NAG; 2.60A {Saccharomyces cerevisiae} SCOP: c.69.1.5 PDB: 1wpx_A* 1ysc_A* | Back alignment and structure |
|---|
| >3d59_A Platelet-activating factor acetylhydrolase; secreted protein, alpha/beta-hydrolase-fold, LDL-bound, lipoprotein associated phospholipase A2, LP-PLA2; 1.50A {Homo sapiens} PDB: 3d5e_A 3f97_A* 3f98_A 3f9c_A* 3f96_A* | Back alignment and structure |
|---|
| >1ivy_A Human protective protein; carboxypeptidase, serine carboxypeptidase, protective protei glycoprotein, zymogen; HET: NAG NDG; 2.20A {Homo sapiens} SCOP: c.69.1.5 | Back alignment and structure |
|---|
| >3tjm_A Fatty acid synthase; thioesterase domain, fatty acid synthesis, hydrolase-hydrola inhibitor complex; HET: 7FA; 1.48A {Homo sapiens} PDB: 1xkt_A | Back alignment and structure |
|---|
| >3lp5_A Putative cell surface hydrolase; structural genom PSI2, MCSG, protein structure initiative, midwest center FO structural genomics; 2.00A {Lactobacillus plantarum} | Back alignment and structure |
|---|
| >3i6y_A Esterase APC40077; lipase, structural genomics, PSI-2, PR structure initiative, midwest center for structural genomic hydrolase; HET: MSE; 1.75A {Oleispira antarctica} PDB: 3s8y_A | Back alignment and structure |
|---|
| >3ds8_A LIN2722 protein; unkonwn function, structural genomics, PSI, MCSG, P structure initiative; 1.80A {Listeria innocua} | Back alignment and structure |
|---|
| >3ls2_A S-formylglutathione hydrolase; psychrophilic organism; 2.20A {Pseudoalteromonas haloplanktis} SCOP: c.69.1.0 | Back alignment and structure |
|---|
| >4ezi_A Uncharacterized protein; alpha-beta hydrolases fold, structural genomics, joint cente structural genomics, JCSG; HET: MSE; 1.15A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >3guu_A Lipase A; protein structure, hydrolase; HET: 1PE; 2.10A {Candida antarctica} PDB: 2veo_A* | Back alignment and structure |
|---|
| >2d81_A PHB depolymerase; alpha/beta hydrolase fold, circular permutation, hydrolase; HET: NAG RB3; 1.66A {Penicillium funiculosum} SCOP: c.69.1.37 PDB: 2d80_A* | Back alignment and structure |
|---|
| >3fcx_A FGH, esterase D, S-formylglutathione hydrolase; retinoblastoma, genetic marker, cytoplasm, cytoplasmic vesicle, polymorphism, serine esterase; 1.50A {Homo sapiens} SCOP: c.69.1.0 | Back alignment and structure |
|---|
| >3doh_A Esterase; alpha-beta hydrolase, beta sheet; 2.60A {Thermotoga maritima} PDB: 3doi_A | Back alignment and structure |
|---|
| >1jjf_A Xylanase Z, endo-1,4-beta-xylanase Z, 1,4-beta-D-xylan; feruloyl esterase, ferulic acid esterase, FAE_XYNZ, XYNZ, structural genomics; 1.75A {Clostridium thermocellum} SCOP: c.69.1.2 PDB: 1jt2_A* | Back alignment and structure |
|---|
| >4b6g_A Putative esterase; hydrolase, formaldehyde detoxification, alpha/beta serine HY; 1.40A {Neisseria meningitidis MC58} | Back alignment and structure |
|---|
| >3e4d_A Esterase D; S-formylglutathione hydrolase, hydrolase fold family, catalytic triad, kinetics, proposed reaction mechanism; HET: MSE; 2.01A {Agrobacterium tumefaciens} SCOP: c.69.1.0 | Back alignment and structure |
|---|
| >3h2g_A Esterase; xanthomonas oryzae PV. oryzae, cell WALL degrading enzyme, RICE, virulence, innate immune responses, pathogenesis; 1.86A {Xanthomonas oryzae PV} PDB: 3h2j_A 3h2k_A* 3h2h_A 3h2i_A | Back alignment and structure |
|---|
| >3fle_A SE_1780 protein; structural genomics, APC61035.1, PSI-2, protein structure in midwest center for structural genomics, MCSG; 2.01A {Staphylococcus epidermidis} | Back alignment and structure |
|---|
| >2uz0_A Esterase, tributyrin esterase; alpha/beta hydrolase, hydrolase, A virulence facto LUNG infection; HET: MSE; 1.7A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >3d0k_A Putative poly(3-hydroxybutyrate) depolymerase LPQ; alpha-beta-alpha sandwich, structural genomics, PSI-2; 1.83A {Bordetella parapertussis 12822} | Back alignment and structure |
|---|
| >2px6_A Thioesterase domain; thioesaterse domain, orlistat, fatty acid synthase, drug complex, tetrahydrolipstatin, transferase; HET: DH9; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >1tca_A Lipase; hydrolase(carboxylic esterase); HET: NAG; 1.55A {Candida antarctica} SCOP: c.69.1.17 PDB: 1lbs_A* 1lbt_A* 1tcb_A* 1tcc_A* | Back alignment and structure |
|---|
| >1ei9_A Palmitoyl protein thioesterase 1; alpha/beta hydrolase, glycoprotein, hydrolase; HET: NDG NAG; 2.25A {Bos taurus} SCOP: c.69.1.13 PDB: 1eh5_A* 1exw_A* 3gro_A | Back alignment and structure |
|---|
| >2qm0_A BES; alpha-beta structure, structural genomics, PSI-2, protein ST initiative, midwest center for structural genomics, MCSG; HET: SVY; 1.84A {Bacillus cereus atcc 14579} | Back alignment and structure |
|---|
| >2vsq_A Surfactin synthetase subunit 3; ligase, peptidyl carrier protein, ligase phosphoprotein, TER module, phosphopantetheine; 2.60A {Bacillus subtilis} | Back alignment and structure |
|---|
| >2b9v_A Alpha-amino acid ester hydrolase; catalytic triad, alpha/beta-hydrolase; 2.00A {Acetobacter pasteurianus} SCOP: b.18.1.13 c.69.1.21 PDB: 2b4k_A 1nx9_A* 1ryy_A | Back alignment and structure |
|---|
| >3gff_A IROE-like serine hydrolase; NP_718593.1, structural genomics center for structural genomics, JCSG, protein structure INI PSI-2; 2.12A {Shewanella oneidensis} | Back alignment and structure |
|---|
| >1sfr_A Antigen 85-A; alpha/beta hydrolase, structural genomics, PSI, protein structure initiative, TB structural genomics consortium, TBSGC; 2.70A {Mycobacterium tuberculosis} SCOP: c.69.1.3 | Back alignment and structure |
|---|
| >1mpx_A Alpha-amino acid ester hydrolase; alpha/beta hydrolase, jellyroll, selenomethionine; 1.90A {Xanthomonas citri} SCOP: b.18.1.13 c.69.1.21 | Back alignment and structure |
|---|
| >1r88_A MPT51/MPB51 antigen; ALFA/beta hydrolase fold, FBPC1, immune system; 1.71A {Mycobacterium tuberculosis} SCOP: c.69.1.3 | Back alignment and structure |
|---|
| >3c8d_A Enterochelin esterase; alpha-beta-alpha sandwich, IROD, iron aquisition, structural genomics, PSI-2, protein structure initiative; HET: CIT; 1.80A {Shigella flexneri 2a str} SCOP: b.1.18.20 c.69.1.2 PDB: 2b20_A 3c87_A* 3c8h_A 3mga_A* | Back alignment and structure |
|---|
| >2gzs_A IROE protein; enterobactin, salmochelin, DFP, hydrolase, catalytic DYAD; HET: DFP; 1.40A {Escherichia coli} SCOP: c.69.1.38 PDB: 2gzr_A* | Back alignment and structure |
|---|
| >1dqz_A 85C, protein (antigen 85-C); fibronectin, structural genomics, PSI, protein structure initiative, TB structural genomics consortium; 1.50A {Mycobacterium tuberculosis} SCOP: c.69.1.3 PDB: 3hrh_A 1dqy_A 1va5_A* 1f0n_A* 1f0p_A* | Back alignment and structure |
|---|
| >3pic_A CIP2; alpha/beta hydrolase fold, glucuronoyl esterase, carbohydrat esterase family 15 (CE-15), N-linked glycosylation, secrete hydrolase; HET: NAG; 1.90A {Hypocrea jecorina} | Back alignment and structure |
|---|
| >4g4g_A 4-O-methyl-glucuronoyl methylesterase; alpha/beta hydrolase, 3-layer alpha/beta/alpha sandwich, ROS fold, glucuronoyl esterase; 1.55A {Myceliophthora thermophila} PDB: 4g4i_A 4g4j_A* | Back alignment and structure |
|---|
| >1gkl_A Endo-1,4-beta-xylanase Y; hydrolase, esterase family 1, inactive mutant; HET: FER; 1.4A {Clostridium thermocellum} SCOP: c.69.1.2 PDB: 1wb4_A* 1wb5_A* 1wb6_A* 1gkk_A* | Back alignment and structure |
|---|
| >3iii_A COCE/NOND family hydrolase; structural genomics, center for structural genomi infectious diseases, csgid; HET: MSE PLM; 1.95A {Staphylococcus aureus subsp} PDB: 3ib3_A* | Back alignment and structure |
|---|
| >2vz8_A Fatty acid synthase; transferase, phosphopantetheine, multienzyme, megasynthase, fatty acid synthesis; 3.2A {Sus scrofa} PDB: 2vz9_A* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 73 | ||||
| d2rhwa1 | 283 | c.69.1.10 (A:4-286) 2-hydroxy-6-oxo-6-phenylhexa-2 | 9e-17 | |
| d1zd3a2 | 322 | c.69.1.11 (A:225-547) Mammalian epoxide hydrolase, | 4e-16 | |
| d1uk8a_ | 271 | c.69.1.10 (A:) Meta-cleavage product hydrolase Cum | 2e-15 | |
| d1q0ra_ | 297 | c.69.1.28 (A:) Aclacinomycin methylesterase RdmC { | 3e-15 | |
| d1j1ia_ | 268 | c.69.1.10 (A:) Meta cleavage compound hydrolase Ca | 5e-15 | |
| d1bn7a_ | 291 | c.69.1.8 (A:) Haloalkane dehalogenase {Rhodococcus | 1e-14 | |
| d1c4xa_ | 281 | c.69.1.10 (A:) 2-hydroxy-6-oxo-6-phenylhexa-2,4-di | 2e-14 | |
| d1mtza_ | 290 | c.69.1.7 (A:) Tricorn interacting factor F1 {Archa | 8e-14 | |
| d1a8sa_ | 273 | c.69.1.12 (A:) Chloroperoxidase F {Pseudomonas flu | 6e-13 | |
| d1xkla_ | 258 | c.69.1.20 (A:) Salicylic acid-binding protein 2 (S | 2e-12 | |
| d1b6ga_ | 310 | c.69.1.8 (A:) Haloalkane dehalogenase {Xanthobacte | 3e-12 | |
| d1k8qa_ | 377 | c.69.1.6 (A:) Gastric lipase {Dog (Canis familiari | 4e-12 | |
| d1r3da_ | 264 | c.69.1.35 (A:) Hypothetical protein VC1974 {Vibrio | 4e-12 | |
| d1ehya_ | 293 | c.69.1.11 (A:) Bacterial epoxide hydrolase {Agroba | 4e-12 | |
| d1hkha_ | 279 | c.69.1.12 (A:) Gamma-lactamase {Aureobacterium sp. | 4e-12 | |
| d3c70a1 | 256 | c.69.1.20 (A:2-257) Hydroxynitrile lyase {Rubber t | 4e-12 | |
| d1brta_ | 277 | c.69.1.12 (A:) Bromoperoxidase A2 {Streptomyces au | 5e-12 | |
| d1va4a_ | 271 | c.69.1.12 (A:) Arylesterase {Pseudomonas fluoresce | 1e-11 | |
| d1a88a_ | 275 | c.69.1.12 (A:) Chloroperoxidase L {Streptomyces li | 1e-11 | |
| d1m33a_ | 256 | c.69.1.26 (A:) Biotin biosynthesis protein BioH {E | 1e-11 | |
| d1wm1a_ | 313 | c.69.1.7 (A:) Proline aminopeptidase {Serratia mar | 3e-11 | |
| d1azwa_ | 313 | c.69.1.7 (A:) Proline iminopeptidase {Xanthomonas | 4e-11 | |
| d1mj5a_ | 298 | c.69.1.8 (A:) Haloalkane dehalogenase {Sphingomona | 6e-11 | |
| d1imja_ | 208 | c.69.1.23 (A:) Ccg1/TafII250-interacting factor B | 2e-10 | |
| d1qo7a_ | 394 | c.69.1.11 (A:) Bacterial epoxide hydrolase {Asperg | 2e-10 | |
| d1a8qa_ | 274 | c.69.1.12 (A:) Bromoperoxidase A1 {Streptomyces au | 4e-09 | |
| d1qlwa_ | 318 | c.69.1.15 (A:) A novel bacterial esterase {Alcalig | 7e-08 | |
| d1pjaa_ | 268 | c.69.1.13 (A:) Palmitoyl protein thioesterase 2 {H | 1e-07 | |
| d1tqha_ | 242 | c.69.1.29 (A:) Carboxylesterase Est {Bacillus stea | 6e-07 | |
| d2h7xa1 | 283 | c.69.1.22 (A:9-291) Picromycin polyketide synthase | 2e-04 | |
| d1uxoa_ | 186 | c.69.1.31 (A:) Hypothetical protein YdeN {Bacillus | 3e-04 | |
| d1l7aa_ | 318 | c.69.1.25 (A:) Cephalosporin C deacetylase {Bacill | 0.001 | |
| d2jbwa1 | 360 | c.69.1.41 (A:8-367) 2,6-dihydropseudooxynicotine h | 0.002 |
| >d2rhwa1 c.69.1.10 (A:4-286) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) {Burkholderia xenovorans [TaxId: 36873]} Length = 283 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: alpha/beta-Hydrolases superfamily: alpha/beta-Hydrolases family: Carbon-carbon bond hydrolase domain: 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) species: Burkholderia xenovorans [TaxId: 36873]
Score = 69.5 bits (168), Expect = 9e-17
Identities = 16/61 (26%), Positives = 30/61 (49%)
Query: 1 VKQKTLIIWGEDDQIISSKLAVRLHCELPNAIIRQIPDCGHLPHVEKPGAVAKLIVEFIQ 60
+K KT I WG DD+ + ++L + +A + CGH E +L+++F++
Sbjct: 222 IKAKTFITWGRDDRFVPLDHGLKLLWNIDDARLHVFSKCGHWAQWEHADEFNRLVIDFLR 281
Query: 61 E 61
Sbjct: 282 H 282
|
| >d1zd3a2 c.69.1.11 (A:225-547) Mammalian epoxide hydrolase, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 322 | Back information, alignment and structure |
|---|
| >d1uk8a_ c.69.1.10 (A:) Meta-cleavage product hydrolase CumD {Pseudomonas fluorescens [TaxId: 294]} Length = 271 | Back information, alignment and structure |
|---|
| >d1q0ra_ c.69.1.28 (A:) Aclacinomycin methylesterase RdmC {Streptomyces purpurascens [TaxId: 1924]} Length = 297 | Back information, alignment and structure |
|---|
| >d1j1ia_ c.69.1.10 (A:) Meta cleavage compound hydrolase CarC {Janthinobacterium sp. J3 [TaxId: 213804]} Length = 268 | Back information, alignment and structure |
|---|
| >d1bn7a_ c.69.1.8 (A:) Haloalkane dehalogenase {Rhodococcus sp. [TaxId: 1831]} Length = 291 | Back information, alignment and structure |
|---|
| >d1c4xa_ c.69.1.10 (A:) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) {Rhodococcus sp., strain rha1 [TaxId: 1831]} Length = 281 | Back information, alignment and structure |
|---|
| >d1mtza_ c.69.1.7 (A:) Tricorn interacting factor F1 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 290 | Back information, alignment and structure |
|---|
| >d1a8sa_ c.69.1.12 (A:) Chloroperoxidase F {Pseudomonas fluorescens [TaxId: 294]} Length = 273 | Back information, alignment and structure |
|---|
| >d1xkla_ c.69.1.20 (A:) Salicylic acid-binding protein 2 (SABP2) {Common tobacco (Nicotiana tabacum) [TaxId: 4097]} Length = 258 | Back information, alignment and structure |
|---|
| >d1b6ga_ c.69.1.8 (A:) Haloalkane dehalogenase {Xanthobacter autotrophicus [TaxId: 280]} Length = 310 | Back information, alignment and structure |
|---|
| >d1k8qa_ c.69.1.6 (A:) Gastric lipase {Dog (Canis familiaris) [TaxId: 9615]} Length = 377 | Back information, alignment and structure |
|---|
| >d1r3da_ c.69.1.35 (A:) Hypothetical protein VC1974 {Vibrio cholerae [TaxId: 666]} Length = 264 | Back information, alignment and structure |
|---|
| >d1ehya_ c.69.1.11 (A:) Bacterial epoxide hydrolase {Agrobacterium radiobacter [TaxId: 358]} Length = 293 | Back information, alignment and structure |
|---|
| >d1hkha_ c.69.1.12 (A:) Gamma-lactamase {Aureobacterium sp. [TaxId: 51671]} Length = 279 | Back information, alignment and structure |
|---|
| >d3c70a1 c.69.1.20 (A:2-257) Hydroxynitrile lyase {Rubber tree (Hevea brasiliensis) [TaxId: 3981]} Length = 256 | Back information, alignment and structure |
|---|
| >d1brta_ c.69.1.12 (A:) Bromoperoxidase A2 {Streptomyces aureofaciens [TaxId: 1894]} Length = 277 | Back information, alignment and structure |
|---|
| >d1va4a_ c.69.1.12 (A:) Arylesterase {Pseudomonas fluorescens [TaxId: 294]} Length = 271 | Back information, alignment and structure |
|---|
| >d1a88a_ c.69.1.12 (A:) Chloroperoxidase L {Streptomyces lividans [TaxId: 1916]} Length = 275 | Back information, alignment and structure |
|---|
| >d1m33a_ c.69.1.26 (A:) Biotin biosynthesis protein BioH {Escherichia coli [TaxId: 562]} Length = 256 | Back information, alignment and structure |
|---|
| >d1wm1a_ c.69.1.7 (A:) Proline aminopeptidase {Serratia marcescens [TaxId: 615]} Length = 313 | Back information, alignment and structure |
|---|
| >d1azwa_ c.69.1.7 (A:) Proline iminopeptidase {Xanthomonas campestris, pv. citri [TaxId: 339]} Length = 313 | Back information, alignment and structure |
|---|
| >d1mj5a_ c.69.1.8 (A:) Haloalkane dehalogenase {Sphingomonas paucimobilis, UT26, LinB [TaxId: 13689]} Length = 298 | Back information, alignment and structure |
|---|
| >d1imja_ c.69.1.23 (A:) Ccg1/TafII250-interacting factor B (Cib) {Human (Homo sapiens) [TaxId: 9606]} Length = 208 | Back information, alignment and structure |
|---|
| >d1qo7a_ c.69.1.11 (A:) Bacterial epoxide hydrolase {Aspergillus niger [TaxId: 5061]} Length = 394 | Back information, alignment and structure |
|---|
| >d1a8qa_ c.69.1.12 (A:) Bromoperoxidase A1 {Streptomyces aureofaciens [TaxId: 1894]} Length = 274 | Back information, alignment and structure |
|---|
| >d1qlwa_ c.69.1.15 (A:) A novel bacterial esterase {Alcaligenes sp. [TaxId: 512]} Length = 318 | Back information, alignment and structure |
|---|
| >d1pjaa_ c.69.1.13 (A:) Palmitoyl protein thioesterase 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 268 | Back information, alignment and structure |
|---|
| >d1tqha_ c.69.1.29 (A:) Carboxylesterase Est {Bacillus stearothermophilus [TaxId: 1422]} Length = 242 | Back information, alignment and structure |
|---|
| >d2h7xa1 c.69.1.22 (A:9-291) Picromycin polyketide synthase {Streptomyces venezuelae [TaxId: 54571]} Length = 283 | Back information, alignment and structure |
|---|
| >d1uxoa_ c.69.1.31 (A:) Hypothetical protein YdeN {Bacillus subtilis [TaxId: 1423]} Length = 186 | Back information, alignment and structure |
|---|
| >d1l7aa_ c.69.1.25 (A:) Cephalosporin C deacetylase {Bacillus subtilis [TaxId: 1423]} Length = 318 | Back information, alignment and structure |
|---|
| >d2jbwa1 c.69.1.41 (A:8-367) 2,6-dihydropseudooxynicotine hydrolase {Arthrobacter nicotinovorans [TaxId: 29320]} Length = 360 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 73 | |||
| d1uk8a_ | 271 | Meta-cleavage product hydrolase CumD {Pseudomonas | 99.64 | |
| d1j1ia_ | 268 | Meta cleavage compound hydrolase CarC {Janthinobac | 99.64 | |
| d1c4xa_ | 281 | 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolas | 99.63 | |
| d1m33a_ | 256 | Biotin biosynthesis protein BioH {Escherichia coli | 99.63 | |
| d1xkla_ | 258 | Salicylic acid-binding protein 2 (SABP2) {Common t | 99.62 | |
| d1q0ra_ | 297 | Aclacinomycin methylesterase RdmC {Streptomyces pu | 99.62 | |
| d2rhwa1 | 283 | 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolas | 99.62 | |
| d1zd3a2 | 322 | Mammalian epoxide hydrolase, C-terminal domain {Hu | 99.62 | |
| d1bn7a_ | 291 | Haloalkane dehalogenase {Rhodococcus sp. [TaxId: 1 | 99.61 | |
| d3c70a1 | 256 | Hydroxynitrile lyase {Rubber tree (Hevea brasilien | 99.61 | |
| d1mtza_ | 290 | Tricorn interacting factor F1 {Archaeon Thermoplas | 99.56 | |
| d1a8sa_ | 273 | Chloroperoxidase F {Pseudomonas fluorescens [TaxId | 99.55 | |
| d1brta_ | 277 | Bromoperoxidase A2 {Streptomyces aureofaciens [Tax | 99.54 | |
| d1va4a_ | 271 | Arylesterase {Pseudomonas fluorescens [TaxId: 294] | 99.52 | |
| d1a88a_ | 275 | Chloroperoxidase L {Streptomyces lividans [TaxId: | 99.52 | |
| d1ehya_ | 293 | Bacterial epoxide hydrolase {Agrobacterium radioba | 99.51 | |
| d1hkha_ | 279 | Gamma-lactamase {Aureobacterium sp. [TaxId: 51671] | 99.51 | |
| d1a8qa_ | 274 | Bromoperoxidase A1 {Streptomyces aureofaciens [Tax | 99.5 | |
| d1b6ga_ | 310 | Haloalkane dehalogenase {Xanthobacter autotrophicu | 99.49 | |
| d1tqha_ | 242 | Carboxylesterase Est {Bacillus stearothermophilus | 99.47 | |
| d1imja_ | 208 | Ccg1/TafII250-interacting factor B (Cib) {Human (H | 99.42 | |
| d1wm1a_ | 313 | Proline aminopeptidase {Serratia marcescens [TaxId | 99.38 | |
| d1azwa_ | 313 | Proline iminopeptidase {Xanthomonas campestris, pv | 99.36 | |
| d1mj5a_ | 298 | Haloalkane dehalogenase {Sphingomonas paucimobilis | 99.3 | |
| d1r3da_ | 264 | Hypothetical protein VC1974 {Vibrio cholerae [TaxI | 99.25 | |
| d1k8qa_ | 377 | Gastric lipase {Dog (Canis familiaris) [TaxId: 961 | 99.23 | |
| d2fuka1 | 218 | XC6422 protein {Xanthomonas campestris [TaxId: 339 | 99.19 | |
| d1qo7a_ | 394 | Bacterial epoxide hydrolase {Aspergillus niger [Ta | 99.18 | |
| d1l7aa_ | 318 | Cephalosporin C deacetylase {Bacillus subtilis [Ta | 99.16 | |
| d1qlwa_ | 318 | A novel bacterial esterase {Alcaligenes sp. [TaxId | 99.1 | |
| d1uxoa_ | 186 | Hypothetical protein YdeN {Bacillus subtilis [TaxI | 99.06 | |
| d2hu7a2 | 260 | Acylamino-acid-releasing enzyme, C-terminal donain | 98.88 | |
| d1jmkc_ | 230 | Surfactin synthetase, SrfA {Bacillus subtilis [Tax | 98.85 | |
| d2vata1 | 376 | Acetyl-CoA:deacetylcephalosporin C acetyltransfera | 98.82 | |
| d1dina_ | 233 | Dienelactone hydrolase {Pseudomonas sp., B13 [TaxI | 98.79 | |
| d2jbwa1 | 360 | 2,6-dihydropseudooxynicotine hydrolase {Arthrobact | 98.78 | |
| d1vlqa_ | 322 | Acetyl xylan esterase TM0077 {Thermotoga maritima | 98.78 | |
| d1thta_ | 302 | Myristoyl-ACP-specific thioesterase {Vibrio harvey | 98.77 | |
| d2h7xa1 | 283 | Picromycin polyketide synthase {Streptomyces venez | 98.76 | |
| d2i3da1 | 218 | Hypothetical protein Atu1826 {Agrobacterium tumefa | 98.72 | |
| d2bgra2 | 258 | Dipeptidyl peptidase IV/CD26, C-terminal domain {P | 98.69 | |
| d1ufoa_ | 238 | Hypothetical protein TT1662 {Thermus thermophilus | 98.68 | |
| d1xfda2 | 258 | Dipeptidyl aminopeptidase-like protein 6, DPP6, C- | 98.57 | |
| d1jfra_ | 260 | Lipase {Streptomyces exfoliatus [TaxId: 1905]} | 98.54 | |
| g1wht.1 | 409 | Serine carboxypeptidase II {Wheat (Triticum vulgar | 98.53 | |
| d1qfma2 | 280 | Prolyl oligopeptidase, C-terminal domain {Pig (Sus | 98.51 | |
| d1pjaa_ | 268 | Palmitoyl protein thioesterase 2 {Human (Homo sapi | 98.49 | |
| d2pl5a1 | 362 | Homoserine O-acetyltransferase {Leptospira interro | 98.43 | |
| d1ivya_ | 452 | Human 'protective protein', HPP {Human (Homo sapie | 98.4 | |
| d1wpxa1 | 421 | Serine carboxypeptidase II {Baker's yeast (Sacchar | 98.39 | |
| d2b61a1 | 357 | Homoserine O-acetyltransferase {Haemophilus influe | 98.38 | |
| g1gxs.1 | 425 | Hydroxynitrile lyase {Sorghum (Sorghum bicolor) [T | 98.37 | |
| d1ac5a_ | 483 | Serine carboxypeptidase II {Baker's yeast (Sacchar | 98.35 | |
| d1fj2a_ | 229 | Acyl protein thioesterase 1 {Human (Homo sapiens) | 98.23 | |
| d1vkha_ | 263 | Putative serine hydrolase Ydr428c {Baker's yeast ( | 98.2 | |
| d2h1ia1 | 202 | Carboxylesterase {Bacillus cereus [TaxId: 1396]} | 98.19 | |
| d2r8ba1 | 203 | Uncharacterized protein Atu2452 {Agrobacterium tum | 98.14 | |
| d1xkta_ | 286 | Fatty acid synthase {Human (Homo sapiens) [TaxId: | 97.98 | |
| d1auoa_ | 218 | Carboxylesterase {Pseudomonas fluorescens [TaxId: | 97.98 | |
| d1ispa_ | 179 | Lipase A {Bacillus subtilis [TaxId: 1423]} | 97.82 | |
| d3b5ea1 | 209 | Uncharacterized protein Mll8374 {Mesorhizobium lot | 97.66 | |
| d1mo2a_ | 255 | Erythromycin polyketide synthase {Saccharopolyspor | 97.65 | |
| d1u4na_ | 308 | Carboxylesterase {Alicyclobacillus acidocaldarius | 97.58 | |
| d1lzla_ | 317 | Heroin esterase {Rhodococcus sp. [TaxId: 1831]} | 97.56 | |
| d1jkma_ | 358 | Carboxylesterase {Bacillus subtilis, brefeldin A e | 97.38 | |
| d1jjia_ | 311 | Carboxylesterase {Archaeon Archaeoglobus fulgidus | 97.31 | |
| d2pbla1 | 261 | Uncharacterized protein TM1040_2492 {Silicibacter | 97.24 | |
| d2d81a1 | 318 | Polyhydroxybutyrate depolymerase {Penicillium funi | 97.22 | |
| d1jjfa_ | 255 | Feruloyl esterase domain of the cellulosomal xylan | 96.92 | |
| d1lnsa3 | 405 | X-Prolyl dipeptidyl aminopeptidase PepX, middle do | 96.58 | |
| d2gzsa1 | 265 | Enterobactin and salmochelin hydrolase IroE {Esche | 94.24 | |
| d3c8da2 | 246 | Enterochelin esterase, catalytic domain {Shigella | 94.21 | |
| d1ju3a2 | 347 | Bacterial cocaine esterase N-terminal domain {Rhod | 92.82 | |
| d1mpxa2 | 381 | Alpha-amino acid ester hydrolase {Xanthomonas citr | 88.66 |
| >d1uk8a_ c.69.1.10 (A:) Meta-cleavage product hydrolase CumD {Pseudomonas fluorescens [TaxId: 294]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: alpha/beta-Hydrolases superfamily: alpha/beta-Hydrolases family: Carbon-carbon bond hydrolase domain: Meta-cleavage product hydrolase CumD species: Pseudomonas fluorescens [TaxId: 294]
Probab=99.64 E-value=3.4e-16 Score=83.06 Aligned_cols=61 Identities=31% Similarity=0.580 Sum_probs=58.1
Q ss_pred CCccEEEEEcCCCcccCHHHHHHHHhhCCCcEEEEeCCCCccCCccChHHHHHHHHHHHhh
Q 037210 1 VKQKTLIIWGEDDQIISSKLAVRLHCELPNAIIRQIPDCGHLPHVEKPGAVAKLIVEFIQE 61 (73)
Q Consensus 1 i~~p~l~i~g~~d~~~~~~~~~~~~~~~~~~~~~~~~~~~H~~~~~~~~~~~~~~~~~~~~ 61 (73)
+++|+++++|++|..++.+..+.+.+.+++.++..++++||+++.++|+++++.+.+||++
T Consensus 210 i~~P~lii~G~~D~~~~~~~~~~~~~~~~~~~~~~~~~~gH~~~~e~p~~~~~~i~~Fl~e 270 (271)
T d1uk8a_ 210 LPNETLIIHGREDQVVPLSSSLRLGELIDRAQLHVFGRCGHWTQIEQTDRFNRLVVEFFNE 270 (271)
T ss_dssp CCSCEEEEEETTCSSSCHHHHHHHHHHCTTEEEEEESSCCSCHHHHTHHHHHHHHHHHHHT
T ss_pred hccceeEEecCCCCCcCHHHHHHHHHhCCCCEEEEECCCCCchHHHCHHHHHHHHHHHHhc
Confidence 5799999999999999999999999999999999999999999999999999999999975
|
| >d1j1ia_ c.69.1.10 (A:) Meta cleavage compound hydrolase CarC {Janthinobacterium sp. J3 [TaxId: 213804]} | Back information, alignment and structure |
|---|
| >d1c4xa_ c.69.1.10 (A:) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) {Rhodococcus sp., strain rha1 [TaxId: 1831]} | Back information, alignment and structure |
|---|
| >d1m33a_ c.69.1.26 (A:) Biotin biosynthesis protein BioH {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1xkla_ c.69.1.20 (A:) Salicylic acid-binding protein 2 (SABP2) {Common tobacco (Nicotiana tabacum) [TaxId: 4097]} | Back information, alignment and structure |
|---|
| >d1q0ra_ c.69.1.28 (A:) Aclacinomycin methylesterase RdmC {Streptomyces purpurascens [TaxId: 1924]} | Back information, alignment and structure |
|---|
| >d2rhwa1 c.69.1.10 (A:4-286) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) {Burkholderia xenovorans [TaxId: 36873]} | Back information, alignment and structure |
|---|
| >d1zd3a2 c.69.1.11 (A:225-547) Mammalian epoxide hydrolase, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bn7a_ c.69.1.8 (A:) Haloalkane dehalogenase {Rhodococcus sp. [TaxId: 1831]} | Back information, alignment and structure |
|---|
| >d3c70a1 c.69.1.20 (A:2-257) Hydroxynitrile lyase {Rubber tree (Hevea brasiliensis) [TaxId: 3981]} | Back information, alignment and structure |
|---|
| >d1mtza_ c.69.1.7 (A:) Tricorn interacting factor F1 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d1a8sa_ c.69.1.12 (A:) Chloroperoxidase F {Pseudomonas fluorescens [TaxId: 294]} | Back information, alignment and structure |
|---|
| >d1brta_ c.69.1.12 (A:) Bromoperoxidase A2 {Streptomyces aureofaciens [TaxId: 1894]} | Back information, alignment and structure |
|---|
| >d1va4a_ c.69.1.12 (A:) Arylesterase {Pseudomonas fluorescens [TaxId: 294]} | Back information, alignment and structure |
|---|
| >d1a88a_ c.69.1.12 (A:) Chloroperoxidase L {Streptomyces lividans [TaxId: 1916]} | Back information, alignment and structure |
|---|
| >d1ehya_ c.69.1.11 (A:) Bacterial epoxide hydrolase {Agrobacterium radiobacter [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1hkha_ c.69.1.12 (A:) Gamma-lactamase {Aureobacterium sp. [TaxId: 51671]} | Back information, alignment and structure |
|---|
| >d1a8qa_ c.69.1.12 (A:) Bromoperoxidase A1 {Streptomyces aureofaciens [TaxId: 1894]} | Back information, alignment and structure |
|---|
| >d1b6ga_ c.69.1.8 (A:) Haloalkane dehalogenase {Xanthobacter autotrophicus [TaxId: 280]} | Back information, alignment and structure |
|---|
| >d1tqha_ c.69.1.29 (A:) Carboxylesterase Est {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1imja_ c.69.1.23 (A:) Ccg1/TafII250-interacting factor B (Cib) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wm1a_ c.69.1.7 (A:) Proline aminopeptidase {Serratia marcescens [TaxId: 615]} | Back information, alignment and structure |
|---|
| >d1azwa_ c.69.1.7 (A:) Proline iminopeptidase {Xanthomonas campestris, pv. citri [TaxId: 339]} | Back information, alignment and structure |
|---|
| >d1mj5a_ c.69.1.8 (A:) Haloalkane dehalogenase {Sphingomonas paucimobilis, UT26, LinB [TaxId: 13689]} | Back information, alignment and structure |
|---|
| >d1r3da_ c.69.1.35 (A:) Hypothetical protein VC1974 {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d1k8qa_ c.69.1.6 (A:) Gastric lipase {Dog (Canis familiaris) [TaxId: 9615]} | Back information, alignment and structure |
|---|
| >d2fuka1 c.69.1.36 (A:3-220) XC6422 protein {Xanthomonas campestris [TaxId: 339]} | Back information, alignment and structure |
|---|
| >d1qo7a_ c.69.1.11 (A:) Bacterial epoxide hydrolase {Aspergillus niger [TaxId: 5061]} | Back information, alignment and structure |
|---|
| >d1l7aa_ c.69.1.25 (A:) Cephalosporin C deacetylase {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1qlwa_ c.69.1.15 (A:) A novel bacterial esterase {Alcaligenes sp. [TaxId: 512]} | Back information, alignment and structure |
|---|
| >d1uxoa_ c.69.1.31 (A:) Hypothetical protein YdeN {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2hu7a2 c.69.1.33 (A:322-581) Acylamino-acid-releasing enzyme, C-terminal donain {Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d1jmkc_ c.69.1.22 (C:) Surfactin synthetase, SrfA {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2vata1 c.69.1.40 (A:7-382) Acetyl-CoA:deacetylcephalosporin C acetyltransferase CefG {Acremonium chrysogenum [TaxId: 5044]} | Back information, alignment and structure |
|---|
| >d1dina_ c.69.1.9 (A:) Dienelactone hydrolase {Pseudomonas sp., B13 [TaxId: 306]} | Back information, alignment and structure |
|---|
| >d2jbwa1 c.69.1.41 (A:8-367) 2,6-dihydropseudooxynicotine hydrolase {Arthrobacter nicotinovorans [TaxId: 29320]} | Back information, alignment and structure |
|---|
| >d1vlqa_ c.69.1.25 (A:) Acetyl xylan esterase TM0077 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1thta_ c.69.1.13 (A:) Myristoyl-ACP-specific thioesterase {Vibrio harveyi [TaxId: 669]} | Back information, alignment and structure |
|---|
| >d2h7xa1 c.69.1.22 (A:9-291) Picromycin polyketide synthase {Streptomyces venezuelae [TaxId: 54571]} | Back information, alignment and structure |
|---|
| >d2i3da1 c.69.1.36 (A:2-219) Hypothetical protein Atu1826 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d2bgra2 c.69.1.24 (A:509-766) Dipeptidyl peptidase IV/CD26, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1ufoa_ c.69.1.27 (A:) Hypothetical protein TT1662 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1xfda2 c.69.1.24 (A:592-849) Dipeptidyl aminopeptidase-like protein 6, DPP6, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jfra_ c.69.1.16 (A:) Lipase {Streptomyces exfoliatus [TaxId: 1905]} | Back information, alignment and structure |
|---|
| >d1qfma2 c.69.1.4 (A:431-710) Prolyl oligopeptidase, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1pjaa_ c.69.1.13 (A:) Palmitoyl protein thioesterase 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2pl5a1 c.69.1.40 (A:5-366) Homoserine O-acetyltransferase {Leptospira interrogans [TaxId: 173]} | Back information, alignment and structure |
|---|
| >d1ivya_ c.69.1.5 (A:) Human 'protective protein', HPP {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wpxa1 c.69.1.5 (A:1-421) Serine carboxypeptidase II {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2b61a1 c.69.1.40 (A:2-358) Homoserine O-acetyltransferase {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1ac5a_ c.69.1.5 (A:) Serine carboxypeptidase II {Baker's yeast (Saccharomyces cerevisiae), kex1(delta)p [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1fj2a_ c.69.1.14 (A:) Acyl protein thioesterase 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vkha_ c.69.1.32 (A:) Putative serine hydrolase Ydr428c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2h1ia1 c.69.1.14 (A:1-202) Carboxylesterase {Bacillus cereus [TaxId: 1396]} | Back information, alignment and structure |
|---|
| >d2r8ba1 c.69.1.14 (A:44-246) Uncharacterized protein Atu2452 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1xkta_ c.69.1.22 (A:) Fatty acid synthase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1auoa_ c.69.1.14 (A:) Carboxylesterase {Pseudomonas fluorescens [TaxId: 294]} | Back information, alignment and structure |
|---|
| >d1ispa_ c.69.1.18 (A:) Lipase A {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d3b5ea1 c.69.1.14 (A:7-215) Uncharacterized protein Mll8374 {Mesorhizobium loti [TaxId: 381]} | Back information, alignment and structure |
|---|
| >d1mo2a_ c.69.1.22 (A:) Erythromycin polyketide synthase {Saccharopolyspora erythraea [TaxId: 1836]} | Back information, alignment and structure |
|---|
| >d1u4na_ c.69.1.2 (A:) Carboxylesterase {Alicyclobacillus acidocaldarius [TaxId: 405212]} | Back information, alignment and structure |
|---|
| >d1lzla_ c.69.1.2 (A:) Heroin esterase {Rhodococcus sp. [TaxId: 1831]} | Back information, alignment and structure |
|---|
| >d1jkma_ c.69.1.2 (A:) Carboxylesterase {Bacillus subtilis, brefeldin A esterase [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1jjia_ c.69.1.2 (A:) Carboxylesterase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d2pbla1 c.69.1.2 (A:1-261) Uncharacterized protein TM1040_2492 {Silicibacter sp. tm1040 [TaxId: 292414]} | Back information, alignment and structure |
|---|
| >d2d81a1 c.69.1.37 (A:21-338) Polyhydroxybutyrate depolymerase {Penicillium funiculosum [TaxId: 28572]} | Back information, alignment and structure |
|---|
| >d1jjfa_ c.69.1.2 (A:) Feruloyl esterase domain of the cellulosomal xylanase z {Clostridium thermocellum [TaxId: 1515]} | Back information, alignment and structure |
|---|
| >d1lnsa3 c.69.1.21 (A:146-550) X-Prolyl dipeptidyl aminopeptidase PepX, middle domain {Lactococcus lactis [TaxId: 1358]} | Back information, alignment and structure |
|---|
| >d2gzsa1 c.69.1.38 (A:41-305) Enterobactin and salmochelin hydrolase IroE {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d3c8da2 c.69.1.2 (A:151-396) Enterochelin esterase, catalytic domain {Shigella flexneri 2a str. 2457T [TaxId: 198215]} | Back information, alignment and structure |
|---|
| >d1ju3a2 c.69.1.21 (A:5-351) Bacterial cocaine esterase N-terminal domain {Rhodococcus sp. mb1 [TaxId: 51612]} | Back information, alignment and structure |
|---|
| >d1mpxa2 c.69.1.21 (A:24-404) Alpha-amino acid ester hydrolase {Xanthomonas citri [TaxId: 346]} | Back information, alignment and structure |
|---|