Citrus Sinensis ID: 037210


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70---
VKQKTLIIWGEDDQIISSKLAVRLHCELPNAIIRQIPDCGHLPHVEKPGAVAKLIVEFIQENCISEPQLVSQR
ccccEEEEEEcccccccHHHHHHHHHHccccEEEEEcccccccccccHHHHHHHHHHHHHHHccccccccccc
ccccEEEEEccccccccHHHHHHHHHHccccEEEEEcccccccccccHHHHHHHHHHHHHHcccccccccccc
VKQKTLIIWGEDDQIISSKLAVRLHCELPNAiirqipdcghlphvekpGAVAKLIVEFIQEncisepqlvsqr
vkqktliiwgeddqiiSSKLAVRLHCELPNAIIRQIPDCGHLPHVEKPGAVAKLIVEFIQEncisepqlvsqr
VKQKTLIIWGEDDQIISSKLAVRLHCELPNAIIRQIPDCGHLPHVEKPGAVAKLIVEFIQENCISEPQLVSQR
****TLIIWGEDDQIISSKLAVRLHCELPNAIIRQIPDCGHLPHVEKPGAVAKLIVEFIQENCI*********
VKQKTLIIWGEDDQIISSKLAVRLHCELPNAIIRQIPDCGHLPHVEKPGAVAKLIVEFIQ*************
VKQKTLIIWGEDDQIISSKLAVRLHCELPNAIIRQIPDCGHLPHVEKPGAVAKLIVEFIQENCISEPQLVSQR
VKQKTLIIWGEDDQIISSKLAVRLHCELPNAIIRQIPDCGHLPHVEKPGAVAKLIVEFIQENC**********
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
VKQKTLIIWGEDDQIISSKLAVRLHCELPNAIIRQIPDCGHLPHVEKPGAVAKLIVEFIQENCISEPQLVSQR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query73 2.2.26 [Sep-21-2011]
O05235273 Uncharacterized hydrolase yes no 0.821 0.219 0.35 6e-07
Q8KZP5286 2-hydroxy-6-oxononadiened yes no 0.808 0.206 0.322 4e-05
Q2VLB9286 2-hydroxy-6-oxo-6-phenylh N/A no 0.808 0.206 0.322 4e-05
Q476M7289 2-hydroxy-6-oxononadiened yes no 0.808 0.204 0.322 8e-05
Q8R2Y0336 Monoacylglycerol lipase A yes no 0.808 0.175 0.372 0.0002
Q1LZ86337 Monoacylglycerol lipase A yes no 0.808 0.175 0.355 0.0002
A4JPX5288 2-hydroxy-6-oxononadiened yes no 0.821 0.208 0.3 0.0002
Q9BV23337 Monoacylglycerol lipase A yes no 0.808 0.175 0.355 0.0002
Q5XI64337 Monoacylglycerol lipase A yes no 0.808 0.175 0.355 0.0002
Q400K3286 2-hydroxy-6-oxononadiened no no 0.821 0.209 0.283 0.0003
>sp|O05235|YUGF_BACSU Uncharacterized hydrolase YugF OS=Bacillus subtilis (strain 168) GN=yugF PE=3 SV=1 Back     alignment and function desciption
 Score = 52.8 bits (125), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 40/60 (66%)

Query: 1   VKQKTLIIWGEDDQIISSKLAVRLHCELPNAIIRQIPDCGHLPHVEKPGAVAKLIVEFIQ 60
           + +  L+IWGE+D+I+  ++  RLH +LPN+++  +   GHL   E+P  +++ I +FI+
Sbjct: 214 MNKPALLIWGEEDRIVPMEIGKRLHADLPNSVLYSLGQTGHLVPEERPELISEHIADFIK 273





Bacillus subtilis (strain 168) (taxid: 224308)
EC: 3EC: .EC: 1EC: .EC: -EC: .EC: -
>sp|Q8KZP5|MHPC_COMTE 2-hydroxy-6-oxononadienedioate/2-hydroxy-6-oxononatrienedioate hydrolase OS=Comamonas testosteroni GN=mhpC PE=1 SV=1 Back     alignment and function description
>sp|Q2VLB9|BPHD_BURCE 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase OS=Burkholderia cepacia GN=bphD PE=3 SV=1 Back     alignment and function description
>sp|Q476M7|MHPC_CUPPJ 2-hydroxy-6-oxononadienedioate/2-hydroxy-6-oxononatrienedioate hydrolase OS=Cupriavidus pinatubonensis (strain JMP134 / LMG 1197) GN=mhpC PE=3 SV=1 Back     alignment and function description
>sp|Q8R2Y0|ABHD6_MOUSE Monoacylglycerol lipase ABHD6 OS=Mus musculus GN=Abhd6 PE=2 SV=1 Back     alignment and function description
>sp|Q1LZ86|ABHD6_BOVIN Monoacylglycerol lipase ABHD6 OS=Bos taurus GN=ABHD6 PE=2 SV=1 Back     alignment and function description
>sp|A4JPX5|MHPC_BURVG 2-hydroxy-6-oxononadienedioate/2-hydroxy-6-oxononatrienedioate hydrolase OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=mhpC PE=3 SV=1 Back     alignment and function description
>sp|Q9BV23|ABHD6_HUMAN Monoacylglycerol lipase ABHD6 OS=Homo sapiens GN=ABHD6 PE=2 SV=1 Back     alignment and function description
>sp|Q5XI64|ABHD6_RAT Monoacylglycerol lipase ABHD6 OS=Rattus norvegicus GN=Abhd6 PE=1 SV=1 Back     alignment and function description
>sp|Q400K3|MHPC2_PSEPU 2-hydroxy-6-oxononadienedioate/2-hydroxy-6-oxononatrienedioate hydrolase 2 OS=Pseudomonas putida GN=mhpC2 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query73
225423481 340 PREDICTED: uncharacterized hydrolase yug 0.986 0.211 0.791 3e-26
224108884 335 predicted protein [Populus trichocarpa] 0.986 0.214 0.791 4e-26
356577153 346 PREDICTED: uncharacterized hydrolase yug 0.972 0.205 0.732 7e-24
357475035 331 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoat 0.958 0.211 0.728 2e-23
255542046 340 alpha/beta hydrolase, putative [Ricinus 0.931 0.2 0.735 2e-23
359806911 344 uncharacterized protein LOC100800197 [Gl 0.986 0.209 0.694 2e-23
449452861 338 PREDICTED: uncharacterized hydrolase Yug 0.986 0.213 0.722 1e-22
356494991 343 PREDICTED: 2-hydroxy-6-oxononadienedioat 0.986 0.209 0.680 2e-22
357487589 355 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoat 0.986 0.202 0.694 2e-21
8778385 633 F16A14.4 [Arabidopsis thaliana] 0.863 0.099 0.730 8e-21
>gi|225423481|ref|XP_002274292.1| PREDICTED: uncharacterized hydrolase yugF [Vitis vinifera] gi|297738082|emb|CBI27283.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  122 bits (306), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 57/72 (79%), Positives = 65/72 (90%)

Query: 1   VKQKTLIIWGEDDQIISSKLAVRLHCELPNAIIRQIPDCGHLPHVEKPGAVAKLIVEFIQ 60
           VK+KTLIIWGEDDQIIS+KLAVRLHCELPNAII QIPDCGHLPHVEKP +V+KLI+EF+Q
Sbjct: 268 VKKKTLIIWGEDDQIISNKLAVRLHCELPNAIISQIPDCGHLPHVEKPHSVSKLIMEFVQ 327

Query: 61  ENCISEPQLVSQ 72
           E+   E Q +SQ
Sbjct: 328 EDSYKEAQCISQ 339




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|224108884|ref|XP_002315003.1| predicted protein [Populus trichocarpa] gi|222864043|gb|EEF01174.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356577153|ref|XP_003556692.1| PREDICTED: uncharacterized hydrolase yugF-like [Glycine max] Back     alignment and taxonomy information
>gi|357475035|ref|XP_003607803.1| 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase [Medicago truncatula] gi|355508858|gb|AES90000.1| 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase [Medicago truncatula] Back     alignment and taxonomy information
>gi|255542046|ref|XP_002512087.1| alpha/beta hydrolase, putative [Ricinus communis] gi|223549267|gb|EEF50756.1| alpha/beta hydrolase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|359806911|ref|NP_001241322.1| uncharacterized protein LOC100800197 [Glycine max] gi|255639051|gb|ACU19826.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|449452861|ref|XP_004144177.1| PREDICTED: uncharacterized hydrolase YugF-like [Cucumis sativus] gi|449529427|ref|XP_004171701.1| PREDICTED: uncharacterized hydrolase YugF-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|356494991|ref|XP_003516364.1| PREDICTED: 2-hydroxy-6-oxononadienedioate/2-hydroxy-6- oxononatrienedioate hydrolase-like [Glycine max] Back     alignment and taxonomy information
>gi|357487589|ref|XP_003614082.1| 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase [Medicago truncatula] gi|355515417|gb|AES97040.1| 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase [Medicago truncatula] Back     alignment and taxonomy information
>gi|8778385|gb|AAF79393.1|AC068197_3 F16A14.4 [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query73
TAIR|locus:2014774339 AT1G13820 [Arabidopsis thalian 0.863 0.185 0.730 4.9e-21
TAIR|locus:2157260330 AT5G39220 [Arabidopsis thalian 0.794 0.175 0.534 7.3e-14
UNIPROTKB|Q74EB1302 GSU1052 "Hydrolase or acyltran 0.794 0.192 0.465 1.3e-07
TIGR_CMR|GSU_1052302 GSU_1052 "hydrolase, alpha/bet 0.794 0.192 0.465 1.3e-07
UNIPROTKB|E2QVK3337 ABHD6 "Uncharacterized protein 0.808 0.175 0.372 1.2e-05
TAIR|locus:2194744314 AT1G78210 [Arabidopsis thalian 0.917 0.213 0.385 1.3e-05
UNIPROTKB|Q81K69279 BAS4774 "Hydrolase, alpha/beta 0.794 0.207 0.379 1.3e-05
TIGR_CMR|BA_5136279 BA_5136 "hydrolase, alpha/beta 0.794 0.207 0.379 1.3e-05
MGI|MGI:1913332336 Abhd6 "abhydrolase domain cont 0.808 0.175 0.372 1.5e-05
UNIPROTKB|Q1LZ86337 ABHD6 "Monoacylglycerol lipase 0.808 0.175 0.355 1.5e-05
TAIR|locus:2014774 AT1G13820 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 247 (92.0 bits), Expect = 4.9e-21, P = 4.9e-21
 Identities = 46/63 (73%), Positives = 53/63 (84%)

Query:     1 VKQKTLIIWGEDDQIISSKLAVRLHCELPNAIIRQIPDCGHLPHVEKPGAVAKLIVEFIQ 60
             V QKTLI+WGEDDQIIS+KLA RLH EL NA ++QI +CGHLPHVEKP AV KLI EF++
Sbjct:   268 VSQKTLILWGEDDQIISNKLAWRLHGELSNARVKQISNCGHLPHVEKPAAVTKLIAEFVR 327

Query:    61 ENC 63
             E C
Sbjct:   328 ETC 330




GO:0003824 "catalytic activity" evidence=IEA
GO:0005737 "cytoplasm" evidence=ISM
GO:0016787 "hydrolase activity" evidence=ISS
TAIR|locus:2157260 AT5G39220 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q74EB1 GSU1052 "Hydrolase or acyltransferase, alpha/beta fold family" [Geobacter sulfurreducens PCA (taxid:243231)] Back     alignment and assigned GO terms
TIGR_CMR|GSU_1052 GSU_1052 "hydrolase, alpha/beta fold family" [Geobacter sulfurreducens PCA (taxid:243231)] Back     alignment and assigned GO terms
UNIPROTKB|E2QVK3 ABHD6 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
TAIR|locus:2194744 AT1G78210 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q81K69 BAS4774 "Hydrolase, alpha/beta fold family" [Bacillus anthracis (taxid:1392)] Back     alignment and assigned GO terms
TIGR_CMR|BA_5136 BA_5136 "hydrolase, alpha/beta fold family" [Bacillus anthracis str. Ames (taxid:198094)] Back     alignment and assigned GO terms
MGI|MGI:1913332 Abhd6 "abhydrolase domain containing 6" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|Q1LZ86 ABHD6 "Monoacylglycerol lipase ABHD6" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query73
COG0596282 COG0596, MhpC, Predicted hydrolases or acyltransfe 7e-13
PRK14875371 PRK14875, PRK14875, acetoin dehydrogenase E2 subun 5e-12
pfam12697187 pfam12697, Abhydrolase_6, Alpha/beta hydrolase fam 6e-12
pfam00561226 pfam00561, Abhydrolase_1, alpha/beta hydrolase fol 6e-10
TIGR03343282 TIGR03343, biphenyl_bphD, 2-hydroxy-6-oxo-6-phenyl 4e-07
TIGR03695252 TIGR03695, menH_SHCHC, 2-succinyl-6-hydroxy-2,4-cy 4e-07
TIGR03056278 TIGR03056, bchO_mg_che_rel, putative magnesium che 1e-06
TIGR01250289 TIGR01250, pro_imino_pep_2, proline-specific pepti 4e-06
TIGR02427251 TIGR02427, protocat_pcaD, 3-oxoadipate enol-lacton 3e-05
TIGR02240276 TIGR02240, PHA_depoly_arom, poly(3-hydroxyalkanoat 5e-05
PLN02578354 PLN02578, PLN02578, hydrolase 0.002
COG2267298 COG2267, PldB, Lysophospholipase [Lipid metabolism 0.002
>gnl|CDD|223669 COG0596, MhpC, Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) [General function prediction only] Back     alignment and domain information
 Score = 60.8 bits (146), Expect = 7e-13
 Identities = 27/57 (47%), Positives = 37/57 (64%), Gaps = 1/57 (1%)

Query: 5   TLIIWGEDDQIISSKLAVRLHCELPN-AIIRQIPDCGHLPHVEKPGAVAKLIVEFIQ 60
           TLII GEDD ++ ++LA RL   LPN A +  IP  GH PH+E P A A  ++ F++
Sbjct: 224 TLIIHGEDDPVVPAELARRLAAALPNDARLVVIPGAGHFPHLEAPEAFAAALLAFLE 280


Length = 282

>gnl|CDD|184875 PRK14875, PRK14875, acetoin dehydrogenase E2 subunit dihydrolipoyllysine-residue acetyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|221720 pfam12697, Abhydrolase_6, Alpha/beta hydrolase family Back     alignment and domain information
>gnl|CDD|201306 pfam00561, Abhydrolase_1, alpha/beta hydrolase fold Back     alignment and domain information
>gnl|CDD|132386 TIGR03343, biphenyl_bphD, 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase Back     alignment and domain information
>gnl|CDD|234315 TIGR03695, menH_SHCHC, 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Back     alignment and domain information
>gnl|CDD|132100 TIGR03056, bchO_mg_che_rel, putative magnesium chelatase accessory protein Back     alignment and domain information
>gnl|CDD|188121 TIGR01250, pro_imino_pep_2, proline-specific peptidase, Bacillus coagulans-type subfamily Back     alignment and domain information
>gnl|CDD|131480 TIGR02427, protocat_pcaD, 3-oxoadipate enol-lactonase Back     alignment and domain information
>gnl|CDD|131294 TIGR02240, PHA_depoly_arom, poly(3-hydroxyalkanoate) depolymerase Back     alignment and domain information
>gnl|CDD|215315 PLN02578, PLN02578, hydrolase Back     alignment and domain information
>gnl|CDD|225176 COG2267, PldB, Lysophospholipase [Lipid metabolism] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 73
PLN02965255 Probable pheophorbidase 99.61
TIGR03343282 biphenyl_bphD 2-hydroxy-6-oxo-6-phenylhexa-2,4-die 99.6
TIGR01738245 bioH putative pimeloyl-BioC--CoA transferase BioH. 99.58
PRK10349256 carboxylesterase BioH; Provisional 99.57
PLN02679360 hydrolase, alpha/beta fold family protein 99.54
PLN02824294 hydrolase, alpha/beta fold family protein 99.54
KOG1454326 consensus Predicted hydrolase/acyltransferase (alp 99.53
TIGR03056278 bchO_mg_che_rel putative magnesium chelatase acces 99.52
PRK10673255 acyl-CoA esterase; Provisional 99.52
PLN03087481 BODYGUARD 1 domain containing hydrolase; Provision 99.5
TIGR03611257 RutD pyrimidine utilization protein D. This protei 99.5
PRK03592295 haloalkane dehalogenase; Provisional 99.5
PRK03204286 haloalkane dehalogenase; Provisional 99.5
TIGR02240276 PHA_depoly_arom poly(3-hydroxyalkanoate) depolymer 99.49
PRK07581339 hypothetical protein; Validated 99.47
PRK00870302 haloalkane dehalogenase; Provisional 99.47
PLN02578354 hydrolase 99.46
PRK08775343 homoserine O-acetyltransferase; Provisional 99.46
PRK06489360 hypothetical protein; Provisional 99.45
TIGR02427251 protocat_pcaD 3-oxoadipate enol-lactonase. Members 99.45
PRK00175379 metX homoserine O-acetyltransferase; Provisional 99.44
TIGR01392351 homoserO_Ac_trn homoserine O-acetyltransferase. Th 99.42
PLN03084383 alpha/beta hydrolase fold protein; Provisional 99.41
PLN02385349 hydrolase; alpha/beta fold family protein 99.41
TIGR01250288 pro_imino_pep_2 proline-specific peptidases, Bacil 99.39
PHA02857276 monoglyceride lipase; Provisional 99.34
PLN02298330 hydrolase, alpha/beta fold family protein 99.31
TIGR03695251 menH_SHCHC 2-succinyl-6-hydroxy-2,4-cyclohexadiene 99.31
PF12697228 Abhydrolase_6: Alpha/beta hydrolase family; PDB: 3 99.31
KOG2382315 consensus Predicted alpha/beta hydrolase [General 99.29
PF00561230 Abhydrolase_1: alpha/beta hydrolase fold A web pag 99.28
PRK06765389 homoserine O-acetyltransferase; Provisional 99.28
PLN02894402 hydrolase, alpha/beta fold family protein 99.27
PRK11126242 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxyl 99.27
PLN029801655 2-oxoglutarate decarboxylase/ hydro-lyase/ magnesi 99.26
PLN02211273 methyl indole-3-acetate methyltransferase 99.25
PRK10749330 lysophospholipase L2; Provisional 99.24
KOG2984277 consensus Predicted hydrolase [General function pr 99.24
PRK14875371 acetoin dehydrogenase E2 subunit dihydrolipoyllysi 99.22
PLN02652395 hydrolase; alpha/beta fold family protein 99.2
KOG4178322 consensus Soluble epoxide hydrolase [Lipid transpo 99.19
PRK05855 582 short chain dehydrogenase; Validated 99.17
PLN02511388 hydrolase 99.17
TIGR01249306 pro_imino_pep_1 proline iminopeptidase, Neisseria- 99.03
KOG4409365 consensus Predicted hydrolase/acyltransferase (alp 98.98
PRK10985324 putative hydrolase; Provisional 98.96
PRK05077414 frsA fermentation/respiration switch protein; Revi 98.91
TIGR01607332 PST-A Plasmodium subtelomeric family (PST-A). Thes 98.88
PRK07868 994 acyl-CoA synthetase; Validated 98.86
COG0596282 MhpC Predicted hydrolases or acyltransferases (alp 98.83
PF08386103 Abhydrolase_4: TAP-like protein; InterPro: IPR0135 98.82
PF00326213 Peptidase_S9: Prolyl oligopeptidase family This fa 98.81
COG3208244 GrsT Predicted thioesterase involved in non-riboso 98.81
PLN02872395 triacylglycerol lipase 98.79
TIGR03100274 hydr1_PEP hydrolase, ortholog 1, exosortase system 98.76
TIGR01836350 PHA_synth_III_C poly(R)-hydroxyalkanoic acid synth 98.72
COG2267298 PldB Lysophospholipase [Lipid metabolism] 98.69
TIGR01838532 PHA_synth_I poly(R)-hydroxyalkanoic acid synthase, 98.65
COG1647243 Esterase/lipase [General function prediction only] 98.6
KOG1552258 consensus Predicted alpha/beta hydrolase [General 98.53
PRK13604307 luxD acyl transferase; Provisional 98.51
PRK11071190 esterase YqiA; Provisional 98.51
COG1506620 DAP2 Dipeptidyl aminopeptidases/acylaminoacyl-pept 98.49
PRK11460232 putative hydrolase; Provisional 98.47
PRK10566249 esterase; Provisional 98.46
PF12695145 Abhydrolase_5: Alpha/beta hydrolase family; PDB: 3 98.44
KOG1455313 consensus Lysophospholipase [Lipid transport and m 98.42
KOG2551230 consensus Phospholipase/carboxyhydrolase [Amino ac 98.41
PF01738218 DLH: Dienelactone hydrolase family; InterPro: IPR0 98.39
COG0429345 Predicted hydrolase of the alpha/beta-hydrolase fo 98.32
KOG4391300 consensus Predicted alpha/beta hydrolase BEM46 [Ge 98.23
KOG4667269 consensus Predicted esterase [Lipid transport and 98.23
PF00450415 Peptidase_S10: Serine carboxypeptidase; InterPro: 98.17
KOG2931326 consensus Differentiation-related gene 1 protein ( 98.12
PF02230216 Abhydrolase_2: Phospholipase/Carboxylesterase; Int 98.1
PF03096283 Ndr: Ndr family; InterPro: IPR004142 This family c 98.09
PF03959212 FSH1: Serine hydrolase (FSH1); InterPro: IPR005645 98.07
PTZ00472462 serine carboxypeptidase (CBP1); Provisional 98.06
PF05705240 DUF829: Eukaryotic protein of unknown function (DU 98.05
PF06821171 Ser_hydrolase: Serine hydrolase; InterPro: IPR0106 97.97
PF10142367 PhoPQ_related: PhoPQ-activated pathogenicity-relat 97.96
TIGR01849406 PHB_depoly_PhaZ polyhydroxyalkanoate depolymerase, 97.95
PF08840213 BAAT_C: BAAT / Acyl-CoA thioester hydrolase C term 97.94
COG2945210 Predicted hydrolase of the alpha/beta superfamily 97.94
KOG3043242 consensus Predicted hydrolase related to dienelact 97.91
PLN02213319 sinapoylglucose-malate O-sinapoyltransferase/ carb 97.89
PLN02209437 serine carboxypeptidase 97.83
PF05448320 AXE1: Acetyl xylan esterase (AXE1); InterPro: IPR0 97.79
COG1073299 Hydrolases of the alpha/beta superfamily [General 97.77
PLN03016433 sinapoylglucose-malate O-sinapoyltransferase 97.77
KOG1282454 consensus Serine carboxypeptidases (lysosomal cath 97.76
PF09752348 DUF2048: Uncharacterized conserved protein (DUF204 97.73
COG2021368 MET2 Homoserine acetyltransferase [Amino acid tran 97.69
KOG1838409 consensus Alpha/beta hydrolase [General function p 97.47
COG0400207 Predicted esterase [General function prediction on 97.46
PLN02442283 S-formylglutathione hydrolase 97.46
COG0412236 Dienelactone hydrolase and related enzymes [Second 97.43
KOG2564343 consensus Predicted acetyltransferases and hydrola 97.31
COG4757281 Predicted alpha/beta hydrolase [General function p 97.26
COG3243445 PhaC Poly(3-hydroxyalkanoate) synthetase [Lipid me 97.17
PRK05371 767 x-prolyl-dipeptidyl aminopeptidase; Provisional 97.13
PF08538303 DUF1749: Protein of unknown function (DUF1749); In 97.12
PRK10162318 acetyl esterase; Provisional 97.08
TIGR01839560 PHA_synth_II poly(R)-hydroxyalkanoic acid synthase 97.02
TIGR02821275 fghA_ester_D S-formylglutathione hydrolase. This m 96.91
KOG3975301 consensus Uncharacterized conserved protein [Funct 96.74
COG3571213 Predicted hydrolase of the alpha/beta-hydrolase fo 96.73
COG3545181 Predicted esterase of the alpha/beta hydrolase fol 96.71
KOG3253 784 consensus Predicted alpha/beta hydrolase [General 96.69
PF02273294 Acyl_transf_2: Acyl transferase; InterPro: IPR0031 96.64
PF06850202 PHB_depo_C: PHB de-polymerase C-terminus; InterPro 96.63
PF05728187 UPF0227: Uncharacterised protein family (UPF0227); 96.62
PF07859211 Abhydrolase_3: alpha/beta hydrolase fold A web pag 96.49
PF00975229 Thioesterase: Thioesterase domain; InterPro: IPR00 96.36
PRK10115686 protease 2; Provisional 96.33
KOG1551371 consensus Uncharacterized conserved protein [Funct 96.28
KOG1515336 consensus Arylacetamide deacetylase [Defense mecha 96.13
PF06342297 DUF1057: Alpha/beta hydrolase of unknown function 96.08
PF03583290 LIP: Secretory lipase ; InterPro: IPR005152 This e 96.02
PF06500411 DUF1100: Alpha/beta hydrolase of unknown function 95.66
COG0657312 Aes Esterase/lipase [Lipid metabolism] 95.39
COG4287 507 PqaA PhoPQ-activated pathogenicity-related protein 95.35
PF06057192 VirJ: Bacterial virulence protein (VirJ); InterPro 95.31
KOG2565469 consensus Predicted hydrolases or acyltransferases 95.24
COG3458321 Acetyl esterase (deacetylase) [Secondary metabolit 95.0
PF11339 581 DUF3141: Protein of unknown function (DUF3141); In 94.92
PF04301213 DUF452: Protein of unknown function (DUF452); Inte 94.73
PLN00021313 chlorophyllase 94.15
KOG2100755 consensus Dipeptidyl aminopeptidase [Posttranslati 94.14
PF10230266 DUF2305: Uncharacterised conserved protein (DUF230 94.12
KOG2624403 consensus Triglyceride lipase-cholesterol esterase 93.99
KOG2112206 consensus Lysophospholipase [Lipid transport and m 93.67
PF05576448 Peptidase_S37: PS-10 peptidase S37; InterPro: IPR0 93.05
COG4188365 Predicted dienelactone hydrolase [General function 92.93
PF07519474 Tannase: Tannase and feruloyl esterase; InterPro: 92.41
KOG4627270 consensus Kynurenine formamidase [Amino acid trans 91.37
smart00824212 PKS_TE Thioesterase. Peptide synthetases are invol 91.11
TIGR01840212 esterase_phb esterase, PHB depolymerase family. Th 90.6
PRK102521296 entF enterobactin synthase subunit F; Provisional 88.73
COG2939498 Carboxypeptidase C (cathepsin A) [Amino acid trans 88.54
PF02129272 Peptidase_S15: X-Pro dipeptidyl-peptidase (S15 fam 88.46
COG4553415 DepA Poly-beta-hydroxyalkanoate depolymerase [Lipi 88.42
PF06028255 DUF915: Alpha/beta hydrolase of unknown function ( 87.54
KOG2521350 consensus Uncharacterized conserved protein [Funct 86.91
PRK04940180 hypothetical protein; Provisional 84.63
PF10503220 Esterase_phd: Esterase PHB depolymerase 84.38
COG3946456 VirJ Type IV secretory pathway, VirJ component [In 80.87
>PLN02965 Probable pheophorbidase Back     alignment and domain information
Probab=99.61  E-value=6.5e-15  Score=81.15  Aligned_cols=62  Identities=13%  Similarity=0.136  Sum_probs=58.6

Q ss_pred             CCccEEEEEcCCCcccCHHHHHHHHhhCCCcEEEEeCCCCccCCccChHHHHHHHHHHHhhc
Q 037210            1 VKQKTLIIWGEDDQIISSKLAVRLHCELPNAIIRQIPDCGHLPHVEKPGAVAKLIVEFIQEN   62 (73)
Q Consensus         1 i~~p~l~i~g~~d~~~~~~~~~~~~~~~~~~~~~~~~~~~H~~~~~~~~~~~~~~~~~~~~~   62 (73)
                      +++|+++++|++|..+++...+.+.+.+++.++.+++++||+++.|+|+.+++.+.+|++..
T Consensus       192 i~vP~lvi~g~~D~~~~~~~~~~~~~~~~~a~~~~i~~~GH~~~~e~p~~v~~~l~~~~~~~  253 (255)
T PLN02965        192 EKVPRVYIKTAKDNLFDPVRQDVMVENWPPAQTYVLEDSDHSAFFSVPTTLFQYLLQAVSSL  253 (255)
T ss_pred             CCCCEEEEEcCCCCCCCHHHHHHHHHhCCcceEEEecCCCCchhhcCHHHHHHHHHHHHHHh
Confidence            57999999999999999999999999999999999999999999999999999999998764



>TIGR03343 biphenyl_bphD 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase Back     alignment and domain information
>TIGR01738 bioH putative pimeloyl-BioC--CoA transferase BioH Back     alignment and domain information
>PRK10349 carboxylesterase BioH; Provisional Back     alignment and domain information
>PLN02679 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>PLN02824 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>KOG1454 consensus Predicted hydrolase/acyltransferase (alpha/beta hydrolase superfamily) [General function prediction only] Back     alignment and domain information
>TIGR03056 bchO_mg_che_rel putative magnesium chelatase accessory protein Back     alignment and domain information
>PRK10673 acyl-CoA esterase; Provisional Back     alignment and domain information
>PLN03087 BODYGUARD 1 domain containing hydrolase; Provisional Back     alignment and domain information
>TIGR03611 RutD pyrimidine utilization protein D Back     alignment and domain information
>PRK03592 haloalkane dehalogenase; Provisional Back     alignment and domain information
>PRK03204 haloalkane dehalogenase; Provisional Back     alignment and domain information
>TIGR02240 PHA_depoly_arom poly(3-hydroxyalkanoate) depolymerase Back     alignment and domain information
>PRK07581 hypothetical protein; Validated Back     alignment and domain information
>PRK00870 haloalkane dehalogenase; Provisional Back     alignment and domain information
>PLN02578 hydrolase Back     alignment and domain information
>PRK08775 homoserine O-acetyltransferase; Provisional Back     alignment and domain information
>PRK06489 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02427 protocat_pcaD 3-oxoadipate enol-lactonase Back     alignment and domain information
>PRK00175 metX homoserine O-acetyltransferase; Provisional Back     alignment and domain information
>TIGR01392 homoserO_Ac_trn homoserine O-acetyltransferase Back     alignment and domain information
>PLN03084 alpha/beta hydrolase fold protein; Provisional Back     alignment and domain information
>PLN02385 hydrolase; alpha/beta fold family protein Back     alignment and domain information
>TIGR01250 pro_imino_pep_2 proline-specific peptidases, Bacillus coagulans-type subfamily Back     alignment and domain information
>PHA02857 monoglyceride lipase; Provisional Back     alignment and domain information
>PLN02298 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>TIGR03695 menH_SHCHC 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Back     alignment and domain information
>PF12697 Abhydrolase_6: Alpha/beta hydrolase family; PDB: 3LLC_A 3A2N_E 3A2M_A 3A2L_A 3AFI_F 3C5V_A 3C5W_P 3E0X_A 2ZJF_A 3QYJ_A Back     alignment and domain information
>KOG2382 consensus Predicted alpha/beta hydrolase [General function prediction only] Back     alignment and domain information
>PF00561 Abhydrolase_1: alpha/beta hydrolase fold A web page of Esterases and alpha/beta hydrolases Back     alignment and domain information
>PRK06765 homoserine O-acetyltransferase; Provisional Back     alignment and domain information
>PLN02894 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>PRK11126 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase; Provisional Back     alignment and domain information
>PLN02980 2-oxoglutarate decarboxylase/ hydro-lyase/ magnesium ion binding / thiamin pyrophosphate binding Back     alignment and domain information
>PLN02211 methyl indole-3-acetate methyltransferase Back     alignment and domain information
>PRK10749 lysophospholipase L2; Provisional Back     alignment and domain information
>KOG2984 consensus Predicted hydrolase [General function prediction only] Back     alignment and domain information
>PRK14875 acetoin dehydrogenase E2 subunit dihydrolipoyllysine-residue acetyltransferase; Provisional Back     alignment and domain information
>PLN02652 hydrolase; alpha/beta fold family protein Back     alignment and domain information
>KOG4178 consensus Soluble epoxide hydrolase [Lipid transport and metabolism] Back     alignment and domain information
>PRK05855 short chain dehydrogenase; Validated Back     alignment and domain information
>PLN02511 hydrolase Back     alignment and domain information
>TIGR01249 pro_imino_pep_1 proline iminopeptidase, Neisseria-type subfamily Back     alignment and domain information
>KOG4409 consensus Predicted hydrolase/acyltransferase (alpha/beta hydrolase superfamily) [General function prediction only] Back     alignment and domain information
>PRK10985 putative hydrolase; Provisional Back     alignment and domain information
>PRK05077 frsA fermentation/respiration switch protein; Reviewed Back     alignment and domain information
>TIGR01607 PST-A Plasmodium subtelomeric family (PST-A) Back     alignment and domain information
>PRK07868 acyl-CoA synthetase; Validated Back     alignment and domain information
>COG0596 MhpC Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) [General function prediction only] Back     alignment and domain information
>PF08386 Abhydrolase_4: TAP-like protein; InterPro: IPR013595 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF00326 Peptidase_S9: Prolyl oligopeptidase family This family belongs to family S9 of the peptidase classification Back     alignment and domain information
>COG3208 GrsT Predicted thioesterase involved in non-ribosomal peptide biosynthesis [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PLN02872 triacylglycerol lipase Back     alignment and domain information
>TIGR03100 hydr1_PEP hydrolase, ortholog 1, exosortase system type 1 associated Back     alignment and domain information
>TIGR01836 PHA_synth_III_C poly(R)-hydroxyalkanoic acid synthase, class III, PhaC subunit Back     alignment and domain information
>COG2267 PldB Lysophospholipase [Lipid metabolism] Back     alignment and domain information
>TIGR01838 PHA_synth_I poly(R)-hydroxyalkanoic acid synthase, class I Back     alignment and domain information
>COG1647 Esterase/lipase [General function prediction only] Back     alignment and domain information
>KOG1552 consensus Predicted alpha/beta hydrolase [General function prediction only] Back     alignment and domain information
>PRK13604 luxD acyl transferase; Provisional Back     alignment and domain information
>PRK11071 esterase YqiA; Provisional Back     alignment and domain information
>COG1506 DAP2 Dipeptidyl aminopeptidases/acylaminoacyl-peptidases [Amino acid transport and metabolism] Back     alignment and domain information
>PRK11460 putative hydrolase; Provisional Back     alignment and domain information
>PRK10566 esterase; Provisional Back     alignment and domain information
>PF12695 Abhydrolase_5: Alpha/beta hydrolase family; PDB: 3D0K_B 2I3D_B 3DOH_B 3DOI_B 3PFB_A 3S2Z_B 3PFC_A 3QM1_A 3PF8_B 3PF9_A Back     alignment and domain information
>KOG1455 consensus Lysophospholipase [Lipid transport and metabolism] Back     alignment and domain information
>KOG2551 consensus Phospholipase/carboxyhydrolase [Amino acid transport and metabolism] Back     alignment and domain information
>PF01738 DLH: Dienelactone hydrolase family; InterPro: IPR002925 Dienelactone hydrolases play a crucial role in chlorocatechol degradation via the modified ortho cleavage pathway Back     alignment and domain information
>COG0429 Predicted hydrolase of the alpha/beta-hydrolase fold [General function prediction only] Back     alignment and domain information
>KOG4391 consensus Predicted alpha/beta hydrolase BEM46 [General function prediction only] Back     alignment and domain information
>KOG4667 consensus Predicted esterase [Lipid transport and metabolism] Back     alignment and domain information
>PF00450 Peptidase_S10: Serine carboxypeptidase; InterPro: IPR001563 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>KOG2931 consensus Differentiation-related gene 1 protein (NDR1 protein), related proteins [Function unknown] Back     alignment and domain information
>PF02230 Abhydrolase_2: Phospholipase/Carboxylesterase; InterPro: IPR003140 This entry represents the alpha/beta hydrolase domain found in phospholipases [], carboxylesterases [] and thioesterases Back     alignment and domain information
>PF03096 Ndr: Ndr family; InterPro: IPR004142 This family consists of proteins from different gene families: Ndr1/RTP/Drg1, Ndr2, and Ndr3 Back     alignment and domain information
>PF03959 FSH1: Serine hydrolase (FSH1); InterPro: IPR005645 This entry represents proteins belonging to the AB hydrolase family Back     alignment and domain information
>PTZ00472 serine carboxypeptidase (CBP1); Provisional Back     alignment and domain information
>PF05705 DUF829: Eukaryotic protein of unknown function (DUF829); InterPro: IPR008547 This signature identifies Transmembrane protein 53, that have no known function but are predicted to be integral membrane proteins Back     alignment and domain information
>PF06821 Ser_hydrolase: Serine hydrolase; InterPro: IPR010662 This family contains a number of hypothetical bacterial proteins of unknown function, which may be cytosolic Back     alignment and domain information
>PF10142 PhoPQ_related: PhoPQ-activated pathogenicity-related protein; InterPro: IPR009199 Proteins in this entry are believed to play a role in virulence/pathogenicity in Salmonella Back     alignment and domain information
>TIGR01849 PHB_depoly_PhaZ polyhydroxyalkanoate depolymerase, intracellular Back     alignment and domain information
>PF08840 BAAT_C: BAAT / Acyl-CoA thioester hydrolase C terminal; InterPro: IPR014940 Acyl-CoA thioesterases are a group of enzymes that catalyse the hydrolysis of acyl-CoAs to the free fatty acid and coenzyme A (CoASH), providing the potential to regulate intracellular levels of acyl-CoAs, free fatty acids and CoASH Back     alignment and domain information
>COG2945 Predicted hydrolase of the alpha/beta superfamily [General function prediction only] Back     alignment and domain information
>KOG3043 consensus Predicted hydrolase related to dienelactone hydrolase [General function prediction only] Back     alignment and domain information
>PLN02213 sinapoylglucose-malate O-sinapoyltransferase/ carboxypeptidase Back     alignment and domain information
>PLN02209 serine carboxypeptidase Back     alignment and domain information
>PF05448 AXE1: Acetyl xylan esterase (AXE1); InterPro: IPR008391 This family consists of several bacterial acetyl xylan esterase proteins Back     alignment and domain information
>COG1073 Hydrolases of the alpha/beta superfamily [General function prediction only] Back     alignment and domain information
>PLN03016 sinapoylglucose-malate O-sinapoyltransferase Back     alignment and domain information
>KOG1282 consensus Serine carboxypeptidases (lysosomal cathepsin A) [Posttranslational modification, protein turnover, chaperones; Amino acid transport and metabolism] Back     alignment and domain information
>PF09752 DUF2048: Uncharacterized conserved protein (DUF2048); InterPro: IPR019149 This family of proteins has no known function Back     alignment and domain information
>COG2021 MET2 Homoserine acetyltransferase [Amino acid transport and metabolism] Back     alignment and domain information
>KOG1838 consensus Alpha/beta hydrolase [General function prediction only] Back     alignment and domain information
>COG0400 Predicted esterase [General function prediction only] Back     alignment and domain information
>PLN02442 S-formylglutathione hydrolase Back     alignment and domain information
>COG0412 Dienelactone hydrolase and related enzymes [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>KOG2564 consensus Predicted acetyltransferases and hydrolases with the alpha/beta hydrolase fold [General function prediction only] Back     alignment and domain information
>COG4757 Predicted alpha/beta hydrolase [General function prediction only] Back     alignment and domain information
>COG3243 PhaC Poly(3-hydroxyalkanoate) synthetase [Lipid metabolism] Back     alignment and domain information
>PRK05371 x-prolyl-dipeptidyl aminopeptidase; Provisional Back     alignment and domain information
>PF08538 DUF1749: Protein of unknown function (DUF1749); InterPro: IPR013744 This is a plant and fungal family of unknown function Back     alignment and domain information
>PRK10162 acetyl esterase; Provisional Back     alignment and domain information
>TIGR01839 PHA_synth_II poly(R)-hydroxyalkanoic acid synthase, class II Back     alignment and domain information
>TIGR02821 fghA_ester_D S-formylglutathione hydrolase Back     alignment and domain information
>KOG3975 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG3571 Predicted hydrolase of the alpha/beta-hydrolase fold [General function prediction only] Back     alignment and domain information
>COG3545 Predicted esterase of the alpha/beta hydrolase fold [General function prediction only] Back     alignment and domain information
>KOG3253 consensus Predicted alpha/beta hydrolase [General function prediction only] Back     alignment and domain information
>PF02273 Acyl_transf_2: Acyl transferase; InterPro: IPR003157 LuxD proteins are bacterial acyl transferases Back     alignment and domain information
>PF06850 PHB_depo_C: PHB de-polymerase C-terminus; InterPro: IPR009656 This entry represents the C terminus of bacterial poly(3-hydroxybutyrate) (PHB) de-polymerase Back     alignment and domain information
>PF05728 UPF0227: Uncharacterised protein family (UPF0227); InterPro: IPR008886 Despite being classed as uncharacterised proteins, the members of this family are almost certainly enzymes in that they contain a domain distantly related to IPR000073 from INTERPRO Back     alignment and domain information
>PF07859 Abhydrolase_3: alpha/beta hydrolase fold A web page of Esterases and alpha/beta hydrolases Back     alignment and domain information
>PF00975 Thioesterase: Thioesterase domain; InterPro: IPR001031 Thioesterase domains often occur integrated in or associated with peptide synthetases which are involved in the non-ribosomal synthesis of peptide antibiotics [] Back     alignment and domain information
>PRK10115 protease 2; Provisional Back     alignment and domain information
>KOG1551 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1515 consensus Arylacetamide deacetylase [Defense mechanisms] Back     alignment and domain information
>PF06342 DUF1057: Alpha/beta hydrolase of unknown function (DUF1057); InterPro: IPR010463 This entry consists of proteins of unknown function which have an alpha/beta hydrolase fold Back     alignment and domain information
>PF03583 LIP: Secretory lipase ; InterPro: IPR005152 This entry represents a family of secreted lipases Back     alignment and domain information
>PF06500 DUF1100: Alpha/beta hydrolase of unknown function (DUF1100); InterPro: IPR010520 Proteins in this entry display esterase activity toward pNP-butyrate [] Back     alignment and domain information
>COG0657 Aes Esterase/lipase [Lipid metabolism] Back     alignment and domain information
>COG4287 PqaA PhoPQ-activated pathogenicity-related protein [General function prediction only] Back     alignment and domain information
>PF06057 VirJ: Bacterial virulence protein (VirJ); InterPro: IPR010333 This entry contains several bacterial VirJ virulence proteins Back     alignment and domain information
>KOG2565 consensus Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) [General function prediction only] Back     alignment and domain information
>COG3458 Acetyl esterase (deacetylase) [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PF11339 DUF3141: Protein of unknown function (DUF3141); InterPro: IPR024501 This family of proteins appears to be predominantly expressed in Proteobacteria Back     alignment and domain information
>PF04301 DUF452: Protein of unknown function (DUF452); InterPro: IPR007398 This is a family of uncharacterised proteins Back     alignment and domain information
>PLN00021 chlorophyllase Back     alignment and domain information
>KOG2100 consensus Dipeptidyl aminopeptidase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF10230 DUF2305: Uncharacterised conserved protein (DUF2305); InterPro: IPR019363 This entry contains proteins that have no known function Back     alignment and domain information
>KOG2624 consensus Triglyceride lipase-cholesterol esterase [Lipid transport and metabolism] Back     alignment and domain information
>KOG2112 consensus Lysophospholipase [Lipid transport and metabolism] Back     alignment and domain information
>PF05576 Peptidase_S37: PS-10 peptidase S37; InterPro: IPR008761 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>COG4188 Predicted dienelactone hydrolase [General function prediction only] Back     alignment and domain information
>PF07519 Tannase: Tannase and feruloyl esterase; InterPro: IPR011118 This family includes fungal tannase [] and feruloyl esterase [, ] Back     alignment and domain information
>KOG4627 consensus Kynurenine formamidase [Amino acid transport and metabolism] Back     alignment and domain information
>smart00824 PKS_TE Thioesterase Back     alignment and domain information
>TIGR01840 esterase_phb esterase, PHB depolymerase family Back     alignment and domain information
>PRK10252 entF enterobactin synthase subunit F; Provisional Back     alignment and domain information
>COG2939 Carboxypeptidase C (cathepsin A) [Amino acid transport and metabolism] Back     alignment and domain information
>PF02129 Peptidase_S15: X-Pro dipeptidyl-peptidase (S15 family); InterPro: IPR000383 This entry represents a domain found peptidases Xaa-Pro dipeptidyl-peptidase and glutaryl-7-aminocephalosporanic-acid acylase, which belong to MEROPS peptidase families S15 and S45 respectively [] Back     alignment and domain information
>COG4553 DepA Poly-beta-hydroxyalkanoate depolymerase [Lipid metabolism] Back     alignment and domain information
>PF06028 DUF915: Alpha/beta hydrolase of unknown function (DUF915); InterPro: IPR010315 This family consists of bacterial proteins of unknown function, which are hydrolase-like Back     alignment and domain information
>KOG2521 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK04940 hypothetical protein; Provisional Back     alignment and domain information
>PF10503 Esterase_phd: Esterase PHB depolymerase Back     alignment and domain information
>COG3946 VirJ Type IV secretory pathway, VirJ component [Intracellular trafficking and secretion] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query73
1u2e_A289 Crystal Structure Of The C-C Bond Hydrolase Mhpc Le 3e-04
1iun_A282 Meta-Cleavage Product Hydrolase From Pseudomonas Fl 4e-04
2d0d_A282 Crystal Structure Of A Meta-Cleavage Product Hydrol 4e-04
3bdi_A207 Crystal Structure Of Predicted Cib-Like Hydrolase ( 8e-04
2og1_A286 Crystal Structure Of Bphd, A C-C Hydrolase From Bur 8e-04
2rht_A283 Crystal Structure Of The S112a Mutant Of A C-C Hydr 8e-04
2puh_A286 Crystal Structure Of The S112a Mutant Of A C-C Hydr 8e-04
>pdb|1U2E|A Chain A, Crystal Structure Of The C-C Bond Hydrolase Mhpc Length = 289 Back     alignment and structure

Iteration: 1

Score = 40.4 bits (93), Expect = 3e-04, Method: Composition-based stats. Identities = 17/59 (28%), Positives = 31/59 (52%) Query: 1 VKQKTLIIWGEDDQIISSKLAVRLHCELPNAIIRQIPDCGHLPHVEKPGAVAKLIVEFI 59 +K +TLI+WG +D+ + +RL + + + DCGH E A +L++ F+ Sbjct: 228 IKAQTLIVWGRNDRFVPMDAGLRLLSGIAGSELHIFRDCGHWAQWEHADAFNQLVLNFL 286
>pdb|1IUN|A Chain A, Meta-Cleavage Product Hydrolase From Pseudomonas Fluorescens Ip01 (Cumd) S103a Mutant Hexagonal Length = 282 Back     alignment and structure
>pdb|2D0D|A Chain A, Crystal Structure Of A Meta-Cleavage Product Hydrolase (Cumd) A129v Mutant Length = 282 Back     alignment and structure
>pdb|3BDI|A Chain A, Crystal Structure Of Predicted Cib-Like Hydrolase (Np_393672.1) From Thermoplasma Acidophilum At 1.45 A Resolution Length = 207 Back     alignment and structure
>pdb|2OG1|A Chain A, Crystal Structure Of Bphd, A C-C Hydrolase From Burkholderia Xenovorans Lb400 Length = 286 Back     alignment and structure
>pdb|2RHT|A Chain A, Crystal Structure Of The S112a Mutant Of A C-C Hydrolase, Bphd From Burkholderia Xenovorans Lb400, In Complex With 3-Cl Hopda Length = 283 Back     alignment and structure
>pdb|2PUH|A Chain A, Crystal Structure Of The S112a Mutant Of A C-C Hydrolase, Bphd From Burkholderia Xenovorans Lb400, In Complex With Its Substrate Hopda Length = 286 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query73
2puj_A286 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrola; 2e-20
1c4x_A285 BPHD, protein (2-hydroxy-6-OXO-6-phenylhexa-2,4-di 4e-20
2wue_A291 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrolas 6e-20
1iup_A282 META-cleavage product hydrolase; aromatic compound 8e-20
1j1i_A296 META cleavage compound hydrolase; carbazole degrad 1e-19
3fsg_A272 Alpha/beta superfamily hydrolase; PF00561, MCSG, P 1e-19
1u2e_A289 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase 7e-19
2xmz_A269 Hydrolase, alpha/beta hydrolase fold family; menaq 1e-18
3e0x_A245 Lipase-esterase related protein; APC60309, clostri 2e-18
3kxp_A314 Alpha-(N-acetylaminomethylene)succinic acid hydrol 8e-18
2wj6_A276 1H-3-hydroxy-4-oxoquinaldine 2,4-dioxygenase; oxid 1e-17
1m33_A258 BIOH protein; alpha-betta-alpha sandwich, structur 1e-17
2ocg_A254 Valacyclovir hydrolase; alpha beta hydrolase fold; 2e-17
3oos_A278 Alpha/beta hydrolase family protein; APC67239.0, p 2e-17
4f0j_A315 Probable hydrolytic enzyme; alpha/beta hydrolase f 1e-16
1wom_A271 RSBQ, sigma factor SIGB regulation protein RSBQ; a 1e-16
3v48_A268 Aminohydrolase, putative aminoacrylate hydrolase R 2e-16
2y6u_A398 Peroxisomal membrane protein LPX1; hydrolase, puta 4e-16
3bf7_A255 Esterase YBFF; thioesterase, helical CAP, hydrolas 4e-16
3qvm_A282 OLEI00960; structural genomics, PSI-biology, midwe 4e-16
2r11_A306 Carboxylesterase NP; 2632844, putative hydrolase, 7e-16
3hss_A293 Putative bromoperoxidase; alpha beta hydrolase, ox 9e-16
1hkh_A279 Gamma lactamase; hydrolase, alpha/beta hydrolase, 1e-15
3fob_A281 Bromoperoxidase; structural genomics, IDP00046, ba 2e-15
1q0r_A298 RDMC, aclacinomycin methylesterase; anthracycline, 5e-15
3c5v_A316 PME-1, protein phosphatase methylesterase 1; demet 5e-15
1r3d_A264 Conserved hypothetical protein VC1974; structural 6e-15
1brt_A277 Bromoperoxidase A2; haloperoxidase, oxidoreductase 8e-15
3vdx_A 456 Designed 16NM tetrahedral protein CAGE containing 2e-14
1a88_A275 Chloroperoxidase L; haloperoxidase, oxidoreductase 2e-14
3nwo_A330 PIP, proline iminopeptidase; structural genomics, 2e-14
3g9x_A299 Haloalkane dehalogenase; alpha/beta hydrolase, hel 3e-14
1mtz_A293 Proline iminopeptidase; alpha-beta hydrolase, CAP 3e-14
1a8s_A273 Chloroperoxidase F; haloperoxidase, oxidoreductase 5e-14
3bwx_A285 Alpha/beta hydrolase; YP_496220.1, joint center fo 5e-14
3i28_A555 Epoxide hydrolase 2; aromatic hydrocarbons catabol 6e-14
1zoi_A276 Esterase; alpha/beta hydrolase fold; 1.60A {Pseudo 7e-14
3afi_E316 Haloalkane dehalogenase; A/B-hydrolase, hydrolase; 9e-14
3u1t_A309 DMMA haloalkane dehalogenase; alpha/beta-hydrolase 3e-13
3ia2_A271 Arylesterase; alpha-beta hydrolase fold, transitio 5e-13
3bdi_A207 Uncharacterized protein TA0194; NP_393672.1, predi 6e-13
2yys_A286 Proline iminopeptidase-related protein; TTHA1809, 6e-13
2xua_A266 PCAD, 3-oxoadipate ENOL-lactonase; hydrolase, cate 1e-12
3kda_A301 CFTR inhibitory factor (CIF); alpha/beta hydrolase 1e-12
1imj_A210 CIB, CCG1-interacting factor B; alpha/beta hydrola 2e-12
1a8q_A274 Bromoperoxidase A1; haloperoxidase, oxidoreductase 4e-12
3r0v_A262 Alpha/beta hydrolase fold protein; structural geno 5e-12
3p2m_A330 Possible hydrolase; alpha/beta hydrolase superfami 5e-12
3om8_A266 Probable hydrolase; structural genomics, PSI-2, pr 5e-12
2cjp_A328 Epoxide hydrolase; HET: PG4 VPR; 1.95A {Solanum tu 7e-12
2xt0_A297 Haloalkane dehalogenase; hydrolase, alpha-beta hyd 2e-11
2qmq_A286 Protein NDRG2, protein NDR2; alpha/beta-hydrolases 4e-11
1ehy_A294 Protein (soluble epoxide hydrolase); alpha/beta hy 6e-11
2qvb_A297 Haloalkane dehalogenase 3; RV2579, alpha-beta hydr 7e-11
3ibt_A264 1H-3-hydroxy-4-oxoquinoline 2,4-dioxygenase; QDO, 1e-10
1b6g_A310 Haloalkane dehalogenase; hydrolase, alpha/beta-hyd 2e-10
1mj5_A302 1,3,4,6-tetrachloro-1,4-cyclohexadiene hydrolase; 2e-10
3qit_A286 CURM TE, polyketide synthase; thioesterase, alpha/ 6e-10
3l80_A292 Putative uncharacterized protein SMU.1393C; alpha/ 6e-10
2e3j_A356 Epoxide hydrolase EPHB; epoxide hydrolase B, struc 8e-10
3r40_A306 Fluoroacetate dehalogenase; FACD, defluorinase, al 4e-09
1tqh_A247 Carboxylesterase precursor; tetrahedral intermedia 7e-09
3b12_A304 Fluoroacetate dehalogenase; dehalogease, hydrolase 1e-08
2psd_A318 Renilla-luciferin 2-monooxygenase; alpha/beta-hydr 3e-08
3qyj_A291 ALR0039 protein; alpha/beta fold, hydrolase; 1.78A 3e-08
2wfl_A264 Polyneuridine-aldehyde esterase; alkaloid metaboli 7e-08
1xkl_A273 SABP2, salicylic acid-binding protein 2; alpha-bet 3e-07
3dkr_A251 Esterase D; alpha beta hydrolase, mechanism, catal 7e-07
3sty_A267 Methylketone synthase 1; alpha/beta hydrolase, dec 1e-06
3c6x_A257 Hydroxynitrilase; atomic resolution, hydroxynitril 4e-06
3rm3_A270 MGLP, thermostable monoacylglycerol lipase; alpha/ 5e-06
1azw_A313 Proline iminopeptidase; aminopeptidase, serine pro 7e-06
3dqz_A258 Alpha-hydroxynitrIle lyase-like protein; A/B-hydrl 3e-05
1wm1_A317 Proline iminopeptidase; complex with inhibitor, hy 3e-05
3pfb_A270 Cinnamoyl esterase; alpha/beta hydrolase fold, hyd 7e-05
2wtm_A251 EST1E; hydrolase; 1.60A {Clostridium proteoclastic 3e-04
3trd_A208 Alpha/beta hydrolase; cellular processes; 1.50A {C 4e-04
>2puj_A 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrola; C-C bond hydrolase, hydrolase; HET: HPZ; 1.57A {Burkholderia xenovorans} PDB: 2pu7_A* 3v1m_A* 3v1l_A* 2puh_A* 3v1n_A* 3v1k_A* 2og1_A 2pu5_A 2rhw_A* 2rht_A* 2ri6_A Length = 286 Back     alignment and structure
 Score = 80.1 bits (198), Expect = 2e-20
 Identities = 15/61 (24%), Positives = 29/61 (47%)

Query: 1   VKQKTLIIWGEDDQIISSKLAVRLHCELPNAIIRQIPDCGHLPHVEKPGAVAKLIVEFIQ 60
           +K KT I WG DD+ +     ++L   + +A +     CG     E      +L+++F++
Sbjct: 225 IKAKTFITWGRDDRFVPLDHGLKLLWNIDDARLHVFSKCGAWAQWEHADEFNRLVIDFLR 284

Query: 61  E 61
            
Sbjct: 285 H 285


>1c4x_A BPHD, protein (2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoat hydrolase); PCB degradation; 2.40A {Rhodococcus SP} SCOP: c.69.1.10 Length = 285 Back     alignment and structure
>2wue_A 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrolase BPHD; HET: KEK; 1.80A {Mycobacterium tuberculosis} PDB: 2wud_A* 2wuf_A* 2wug_A* 2vf2_A Length = 291 Back     alignment and structure
>1iup_A META-cleavage product hydrolase; aromatic compounds, cumene, isopropylbenzene, META-cleavage compound hydrolase; 1.60A {Pseudomonas fluorescens} SCOP: c.69.1.10 PDB: 1iun_A 1iuo_A 1uk6_A 1uk7_A 1uk8_A 1uk9_A 1uka_A 1ukb_A 2d0d_A Length = 282 Back     alignment and structure
>1j1i_A META cleavage compound hydrolase; carbazole degradation, META cleavage product hydrolase, histidine tagged protein, alpha/beta-hydrolase; 1.86A {Janthinobacterium} SCOP: c.69.1.10 Length = 296 Back     alignment and structure
>3fsg_A Alpha/beta superfamily hydrolase; PF00561, MCSG, PSI, PSI-2, structural genomics, protein structure initiative, midwest for structural genomics; 2.00A {Oenococcus oeni} Length = 272 Back     alignment and structure
>1u2e_A 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase; alpha/beta hydrolase fold; 2.10A {Escherichia coli} Length = 289 Back     alignment and structure
>2xmz_A Hydrolase, alpha/beta hydrolase fold family; menaquinone biosynthesis, lyase; 1.94A {Staphylococcus aureus} Length = 269 Back     alignment and structure
>3e0x_A Lipase-esterase related protein; APC60309, clostridium acetobutylicum ATCC 824, structural genomics, PSI-2; HET: MSE; 1.45A {Clostridium acetobutylicum} Length = 245 Back     alignment and structure
>3kxp_A Alpha-(N-acetylaminomethylene)succinic acid hydrolase; alpha/beta hydrolase, PLP degradation, E-2- (acetamidomethylene)succinate; 2.26A {Mesorhizobium loti} Length = 314 Back     alignment and structure
>2wj6_A 1H-3-hydroxy-4-oxoquinaldine 2,4-dioxygenase; oxidoreductase, alpha/beta hydrolase; HET: ZZ8 SRT; 2.00A {Arthrobacter nitroguajacolicus} PDB: 2wj4_A* 2wj3_A* 2wm2_A* Length = 276 Back     alignment and structure
>1m33_A BIOH protein; alpha-betta-alpha sandwich, structural genomics, PSI, protei structure initiative; HET: MSE 3OH; 1.70A {Escherichia coli} SCOP: c.69.1.26 Length = 258 Back     alignment and structure
>2ocg_A Valacyclovir hydrolase; alpha beta hydrolase fold; 1.75A {Homo sapiens} PDB: 2oci_A* 2ock_A 2ocl_A Length = 254 Back     alignment and structure
>3oos_A Alpha/beta hydrolase family protein; APC67239.0, protein structure initiative, PSI-2, structural midwest center for structural genomics, MCSG; HET: MSE PG4; 1.65A {Bacillus anthracis} Length = 278 Back     alignment and structure
>4f0j_A Probable hydrolytic enzyme; alpha/beta hydrolase fold, structural genomics, joint center structural genomics, JCSG; HET: MSE; 1.50A {Pseudomonas aeruginosa} Length = 315 Back     alignment and structure
>1wom_A RSBQ, sigma factor SIGB regulation protein RSBQ; alpha/beta hydrolase, signaling protein; 2.50A {Bacillus subtilis} PDB: 1wpr_A* Length = 271 Back     alignment and structure
>3v48_A Aminohydrolase, putative aminoacrylate hydrolase RUTD; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.10A {Escherichia coli SE11} Length = 268 Back     alignment and structure
>2y6u_A Peroxisomal membrane protein LPX1; hydrolase, putative esterase, putative lipase; HET: CME CSO; 1.90A {Saccharomyces cerevisiae} PDB: 2y6v_A* Length = 398 Back     alignment and structure
>3bf7_A Esterase YBFF; thioesterase, helical CAP, hydrolase; 1.10A {Escherichia coli} PDB: 3bf8_A Length = 255 Back     alignment and structure
>3qvm_A OLEI00960; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta hydrolase fold, hydrolase; 2.00A {Oleispira antarctica} Length = 282 Back     alignment and structure
>2r11_A Carboxylesterase NP; 2632844, putative hydrolase, structural genomics, joint center for structural genomics, JCSG; HET: MSE PGE; 1.96A {Bacillus subtilis} Length = 306 Back     alignment and structure
>3hss_A Putative bromoperoxidase; alpha beta hydrolase, oxidoreductase, hydrolase; 1.90A {Mycobacterium tuberculosis} PDB: 3e3a_A 3hys_A 3hzo_A Length = 293 Back     alignment and structure
>1hkh_A Gamma lactamase; hydrolase, alpha/beta hydrolase, CO-factor free haloperoxidase,; 1.73A {Microbacterium} SCOP: c.69.1.12 PDB: 1hl7_A* Length = 279 Back     alignment and structure
>3fob_A Bromoperoxidase; structural genomics, IDP00046, bacillus ANT peroxidase, oxidoreductase; 1.74A {Bacillus anthracis str} Length = 281 Back     alignment and structure
>1q0r_A RDMC, aclacinomycin methylesterase; anthracycline, hydrolase, polyketide, tailoring enzyme, structural proteomics in europe, spine; HET: AKT 1PE; 1.45A {Streptomyces purpurascens} SCOP: c.69.1.28 PDB: 1q0z_A* Length = 298 Back     alignment and structure
>3c5v_A PME-1, protein phosphatase methylesterase 1; demethylase, PP2A, alternative splicing, hydrolase, phosphoprotein, serine esterase; 2.00A {Homo sapiens} PDB: 3c5w_P Length = 316 Back     alignment and structure
>1r3d_A Conserved hypothetical protein VC1974; structural genomics, hydrolase, NYSGXRC, NEW YORK SGX research center for structural genomics, PSI; 1.90A {Vibrio cholerae} SCOP: c.69.1.35 Length = 264 Back     alignment and structure
>1brt_A Bromoperoxidase A2; haloperoxidase, oxidoreductase, alpha/beta hydrolase fold, mutant M99T; 1.50A {Streptomyces aureofaciens} SCOP: c.69.1.12 PDB: 1bro_A 1a8u_A 1a7u_A Length = 277 Back     alignment and structure
>3vdx_A Designed 16NM tetrahedral protein CAGE containing bromoperoxidase BPO-A2 and matrix...; protein design, bionanotechnology; 3.00A {Streptomyces aureofaciens} PDB: 4d9j_A Length = 456 Back     alignment and structure
>1a88_A Chloroperoxidase L; haloperoxidase, oxidoreductase; 1.90A {Streptomyces lividans} SCOP: c.69.1.12 Length = 275 Back     alignment and structure
>3nwo_A PIP, proline iminopeptidase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, mycobac smegmatis; 1.90A {Mycobacterium smegmatis} Length = 330 Back     alignment and structure
>3g9x_A Haloalkane dehalogenase; alpha/beta hydrolase, helical CAP domain, catalytic triad (A His272, Glu130), mutant, I135F, haloalkanes; 0.95A {Rhodococcus SP} PDB: 3fwh_A 3fbw_A 3rlt_A 3rk4_A 1bn6_A 1bn7_A 1cqw_A 2v9z_A Length = 299 Back     alignment and structure
>1mtz_A Proline iminopeptidase; alpha-beta hydrolase, CAP domain, caged active site, prolyl peptidase; 1.80A {Thermoplasma acidophilum} SCOP: c.69.1.7 PDB: 1mt3_A 1mu0_A* 1xrr_A 1xrq_A 1xro_A 1xrn_A 1xrm_A 1xrp_A 1xrl_A* 1xqw_A* 1xqx_A* 1xqy_A 1xqv_A Length = 293 Back     alignment and structure
>1a8s_A Chloroperoxidase F; haloperoxidase, oxidoreductase, propionate complex; 1.80A {Pseudomonas fluorescens} SCOP: c.69.1.12 Length = 273 Back     alignment and structure
>3bwx_A Alpha/beta hydrolase; YP_496220.1, joint center for structural genomics, protein structure initiative, PSI-2; HET: MSE; 1.50A {Novosphingobium aromaticivorans} Length = 285 Back     alignment and structure
>3i28_A Epoxide hydrolase 2; aromatic hydrocarbons catabolism, detoxification, magnesium, metal-binding, peroxisome; HET: 34N; 1.95A {Homo sapiens} PDB: 1s8o_A* 1zd2_P* 1vj5_A* 1zd4_A* 1zd5_A* 3i1y_A* 1zd3_A* 3koo_A* 3otq_A* 1cqz_A 1cr6_A* 1ek1_A* 1ek2_A* 3ans_A* 3ant_A* 3pdc_A* Length = 555 Back     alignment and structure
>1zoi_A Esterase; alpha/beta hydrolase fold; 1.60A {Pseudomonas putida} PDB: 4dgq_A Length = 276 Back     alignment and structure
>3afi_E Haloalkane dehalogenase; A/B-hydrolase, hydrolase; 1.75A {Bradyrhizobium japonicum} PDB: 3a2m_A* 3a2n_A 3a2l_A* Length = 316 Back     alignment and structure
>3u1t_A DMMA haloalkane dehalogenase; alpha/beta-hydrolase, hydrolase; 2.20A {Unidentified} Length = 309 Back     alignment and structure
>3ia2_A Arylesterase; alpha-beta hydrolase fold, transition state analog, hydrolas oxidoreductase, peroxidase; 1.65A {Pseudomonas fluorescens} PDB: 1va4_A 3hi4_A 3hea_A Length = 271 Back     alignment and structure
>3bdi_A Uncharacterized protein TA0194; NP_393672.1, predicted CIB-like hydrolase, structural genomi center for structural genomics; HET: MSE; 1.45A {Thermoplasma acidophilum dsm 1728} Length = 207 Back     alignment and structure
>2yys_A Proline iminopeptidase-related protein; TTHA1809, structural genomics, unknown function; 2.20A {Thermus thermophilus} Length = 286 Back     alignment and structure
>2xua_A PCAD, 3-oxoadipate ENOL-lactonase; hydrolase, catechol metabolism; 1.90A {Burkholderia xenovorans} Length = 266 Back     alignment and structure
>3kda_A CFTR inhibitory factor (CIF); alpha/beta hydrolase, hydrolase; 1.50A {Pseudomonas aeruginosa ucbpp-pa14} PDB: 3kd2_A 3pi6_A Length = 301 Back     alignment and structure
>1imj_A CIB, CCG1-interacting factor B; alpha/beta hydrolase, CCG1 interactor; 2.20A {Homo sapiens} SCOP: c.69.1.23 Length = 210 Back     alignment and structure
>1a8q_A Bromoperoxidase A1; haloperoxidase, oxidoreductase; 1.75A {Streptomyces aureofaciens} SCOP: c.69.1.12 Length = 274 Back     alignment and structure
>3r0v_A Alpha/beta hydrolase fold protein; structural genomics, PSI-biology, protein structure initiati alpha/beta hydrolase; HET: MSE; 1.38A {Sphaerobacter thermophilus} Length = 262 Back     alignment and structure
>3p2m_A Possible hydrolase; alpha/beta hydrolase superfamily; 2.80A {Mycobacterium tuberculosis} Length = 330 Back     alignment and structure
>3om8_A Probable hydrolase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MES; 2.25A {Pseudomonas aeruginosa} Length = 266 Back     alignment and structure
>2cjp_A Epoxide hydrolase; HET: PG4 VPR; 1.95A {Solanum tuberosum} PDB: 3cxu_A* Length = 328 Back     alignment and structure
>2xt0_A Haloalkane dehalogenase; hydrolase, alpha-beta hydrolase fold; 1.90A {Plesiocystis pacifica} Length = 297 Back     alignment and structure
>2qmq_A Protein NDRG2, protein NDR2; alpha/beta-hydrolases fold, NDR family, developmental protei differentiation, neurogenesis, phosphorylation; HET: 2PE; 1.70A {Mus musculus} PDB: 2xmq_A 2xmr_A 2xms_A Length = 286 Back     alignment and structure
>1ehy_A Protein (soluble epoxide hydrolase); alpha/beta hydrolase fold, epoxide degradation, epichlorohydrin; 2.10A {Agrobacterium tumefaciens} SCOP: c.69.1.11 Length = 294 Back     alignment and structure
>2qvb_A Haloalkane dehalogenase 3; RV2579, alpha-beta hydrolase protei structural genomics consortium, TBSGC, hydrolase; 1.19A {Mycobacterium tuberculosis} PDB: 2o2i_A 2o2h_A Length = 297 Back     alignment and structure
>3ibt_A 1H-3-hydroxy-4-oxoquinoline 2,4-dioxygenase; QDO, oxidoreductase; 2.60A {Pseudomonas putida} Length = 264 Back     alignment and structure
>1b6g_A Haloalkane dehalogenase; hydrolase, alpha/beta-hydrolase; 1.15A {Xanthobacter autotrophicus} SCOP: c.69.1.8 PDB: 1be0_A 1cij_A 2yxp_X 1edd_A 1edb_A 2dhc_A 2dhe_A 2eda_A 2edc_A 2had_A 1ede_A 2pky_X 1bez_A 1bee_A 2dhd_A* 1hde_A Length = 310 Back     alignment and structure
>1mj5_A 1,3,4,6-tetrachloro-1,4-cyclohexadiene hydrolase; LINB, haloalkane dehalogenase, 1, 3, 4, 4-cyclohexadiene dehalogenase; 0.95A {Sphingomonas paucimobilis} SCOP: c.69.1.8 PDB: 1cv2_A 1d07_A 2bfn_A 1g42_A* 1g4h_A* 1g5f_A* 1iz7_A 1iz8_A* 1k5p_A 1k63_A 1k6e_A Length = 302 Back     alignment and structure
>3qit_A CURM TE, polyketide synthase; thioesterase, alpha/beta hydrolase, decarboxylase, sulfate elimination, terminal alkene production; 1.68A {Lyngbya majuscula 19L} Length = 286 Back     alignment and structure
>3l80_A Putative uncharacterized protein SMU.1393C; alpha/beta hydrolase fold, carboxylesterase, Ser- hydrolase; 2.00A {Streptococcus mutans} Length = 292 Back     alignment and structure
>2e3j_A Epoxide hydrolase EPHB; epoxide hydrolase B, structural mycobacterium tuberculosis structural proteomics project, X hydrolase; 2.10A {Mycobacterium tuberculosis} PDB: 2zjf_A* Length = 356 Back     alignment and structure
>3r40_A Fluoroacetate dehalogenase; FACD, defluorinase, alpha/beta hydrolase, hydrolase; 1.05A {Rhodopseudomonas palustris} PDB: 3r3w_A 3r3x_A 3r3v_A 3r3u_A 3r3z_A 3r41_A 3r3y_A Length = 306 Back     alignment and structure
>1tqh_A Carboxylesterase precursor; tetrahedral intermediate, alpha/beta hydrolase; 1.63A {Geobacillus stearothermophilus} SCOP: c.69.1.29 PDB: 1r1d_A* 4diu_A Length = 247 Back     alignment and structure
>3b12_A Fluoroacetate dehalogenase; dehalogease, hydrolase; 1.20A {Burkholderia SP} PDB: 1y37_A Length = 304 Back     alignment and structure
>2psd_A Renilla-luciferin 2-monooxygenase; alpha/beta-hydrolase, luciferase, oxidoreductase; 1.40A {Renilla reniformis} PDB: 2pse_A 2psj_A* 2psh_A 2psf_A Length = 318 Back     alignment and structure
>3qyj_A ALR0039 protein; alpha/beta fold, hydrolase; 1.78A {Nostoc SP} Length = 291 Back     alignment and structure
>2wfl_A Polyneuridine-aldehyde esterase; alkaloid metabolism, monoterpenoid indole alkaloids, PNAE, hydrolase, serine esterase; HET: CME; 2.10A {Rauvolfia serpentina} PDB: 2wfm_A 3gzj_A* Length = 264 Back     alignment and structure
>1xkl_A SABP2, salicylic acid-binding protein 2; alpha-beta protein, structural genomics, protein structure initiative, PSI; HET: STH; 2.00A {Nicotiana tabacum} SCOP: c.69.1.20 PDB: 1y7i_A* 1y7h_A* Length = 273 Back     alignment and structure
>3dkr_A Esterase D; alpha beta hydrolase, mechanism, catalytic triad, rotation; 1.60A {Lactobacillus rhamnosus} PDB: 3dlt_A 3dyi_A 3dyv_A 3e1g_A Length = 251 Back     alignment and structure
>3sty_A Methylketone synthase 1; alpha/beta hydrolase, decarboxylase, hydrolase; HET: DKA; 1.70A {Lycopersicon hirsutum F} PDB: 3stu_A* 3stt_A* 3stv_A* 3stw_A* 3stx_A* Length = 267 Back     alignment and structure
>3c6x_A Hydroxynitrilase; atomic resolution, hydroxynitril lyase, catalysis, protonation state, AB initio calculations, substrate bindin; 1.05A {Hevea brasiliensis} SCOP: c.69.1.20 PDB: 1sc9_A 1yas_A* 2g4l_A* 2yas_A 1qj4_A 3c6y_A 3c6z_A 3c70_A 3yas_A 4yas_A 5yas_A* 6yas_A 7yas_A* 1yb6_A* 1yb7_A 1sck_A 1sci_A 1scq_A 1dwo_A 1dwp_A ... Length = 257 Back     alignment and structure
>3rm3_A MGLP, thermostable monoacylglycerol lipase; alpha/beta hydrolase fold, hydrolase; 1.20A {Bacillus SP} Length = 270 Back     alignment and structure
>1azw_A Proline iminopeptidase; aminopeptidase, serine protease, xanthomonas campestris; 2.70A {Xanthomonas citri} SCOP: c.69.1.7 Length = 313 Back     alignment and structure
>3dqz_A Alpha-hydroxynitrIle lyase-like protein; A/B-hydrloase fold, cyanogenesis; 2.50A {Arabidopsis thaliana} Length = 258 Back     alignment and structure
>1wm1_A Proline iminopeptidase; complex with inhibitor, hydrolase; HET: PTB; 2.10A {Serratia marcescens} SCOP: c.69.1.7 PDB: 1qtr_A* 1x2b_A* 1x2e_A* Length = 317 Back     alignment and structure
>3pfb_A Cinnamoyl esterase; alpha/beta hydrolase fold, hydrolase, cinnamoyl/Fe esterase, hydroxycinammates, extracellular; HET: ZYC; 1.58A {Lactobacillus johnsonii} PDB: 3pf9_A* 3pfc_A* 3s2z_A* 3pf8_A 3qm1_A* Length = 270 Back     alignment and structure
>2wtm_A EST1E; hydrolase; 1.60A {Clostridium proteoclasticum} PDB: 2wtn_A* Length = 251 Back     alignment and structure
>3trd_A Alpha/beta hydrolase; cellular processes; 1.50A {Coxiella burnetii} Length = 208 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query73
3v48_A268 Aminohydrolase, putative aminoacrylate hydrolase R 99.66
3fob_A281 Bromoperoxidase; structural genomics, IDP00046, ba 99.61
1iup_A282 META-cleavage product hydrolase; aromatic compound 99.61
3om8_A266 Probable hydrolase; structural genomics, PSI-2, pr 99.61
2puj_A286 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrola; 99.61
3c6x_A257 Hydroxynitrilase; atomic resolution, hydroxynitril 99.6
1c4x_A285 BPHD, protein (2-hydroxy-6-OXO-6-phenylhexa-2,4-di 99.59
2ocg_A254 Valacyclovir hydrolase; alpha beta hydrolase fold; 99.59
3bf7_A255 Esterase YBFF; thioesterase, helical CAP, hydrolas 99.59
1u2e_A289 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase 99.59
3afi_E316 Haloalkane dehalogenase; A/B-hydrolase, hydrolase; 99.59
1j1i_A296 META cleavage compound hydrolase; carbazole degrad 99.58
1xkl_A273 SABP2, salicylic acid-binding protein 2; alpha-bet 99.58
3ia2_A271 Arylesterase; alpha-beta hydrolase fold, transitio 99.57
2wue_A291 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrolas 99.57
1brt_A277 Bromoperoxidase A2; haloperoxidase, oxidoreductase 99.57
3nwo_A330 PIP, proline iminopeptidase; structural genomics, 99.57
2wfl_A264 Polyneuridine-aldehyde esterase; alkaloid metaboli 99.56
1wom_A271 RSBQ, sigma factor SIGB regulation protein RSBQ; a 99.56
2xua_A266 PCAD, 3-oxoadipate ENOL-lactonase; hydrolase, cate 99.55
2yys_A286 Proline iminopeptidase-related protein; TTHA1809, 99.55
1tqh_A247 Carboxylesterase precursor; tetrahedral intermedia 99.55
1mtz_A293 Proline iminopeptidase; alpha-beta hydrolase, CAP 99.55
1b6g_A310 Haloalkane dehalogenase; hydrolase, alpha/beta-hyd 99.55
2e3j_A356 Epoxide hydrolase EPHB; epoxide hydrolase B, struc 99.54
3dqz_A258 Alpha-hydroxynitrIle lyase-like protein; A/B-hydrl 99.54
1a8s_A273 Chloroperoxidase F; haloperoxidase, oxidoreductase 99.54
1ehy_A294 Protein (soluble epoxide hydrolase); alpha/beta hy 99.54
3sty_A267 Methylketone synthase 1; alpha/beta hydrolase, dec 99.53
3u1t_A309 DMMA haloalkane dehalogenase; alpha/beta-hydrolase 99.53
2xmz_A269 Hydrolase, alpha/beta hydrolase fold family; menaq 99.53
2wtm_A251 EST1E; hydrolase; 1.60A {Clostridium proteoclastic 99.53
1a8q_A274 Bromoperoxidase A1; haloperoxidase, oxidoreductase 99.53
1m33_A258 BIOH protein; alpha-betta-alpha sandwich, structur 99.53
3fsg_A272 Alpha/beta superfamily hydrolase; PF00561, MCSG, P 99.52
1a88_A275 Chloroperoxidase L; haloperoxidase, oxidoreductase 99.52
1zoi_A276 Esterase; alpha/beta hydrolase fold; 1.60A {Pseudo 99.52
3hss_A293 Putative bromoperoxidase; alpha beta hydrolase, ox 99.52
3g9x_A299 Haloalkane dehalogenase; alpha/beta hydrolase, hel 99.51
3oos_A278 Alpha/beta hydrolase family protein; APC67239.0, p 99.51
3p2m_A330 Possible hydrolase; alpha/beta hydrolase superfami 99.51
4fbl_A281 LIPS lipolytic enzyme; thermostable, structural ge 99.51
3kxp_A314 Alpha-(N-acetylaminomethylene)succinic acid hydrol 99.49
1hkh_A279 Gamma lactamase; hydrolase, alpha/beta hydrolase, 99.49
3kda_A301 CFTR inhibitory factor (CIF); alpha/beta hydrolase 99.49
4dnp_A269 DAD2; alpha/beta hydrolase, hydrolase; 2.15A {Petu 99.48
2y6u_A398 Peroxisomal membrane protein LPX1; hydrolase, puta 99.48
4f0j_A315 Probable hydrolytic enzyme; alpha/beta hydrolase f 99.48
2pl5_A366 Homoserine O-acetyltransferase; alpha/beta hydrola 99.48
2cjp_A328 Epoxide hydrolase; HET: PG4 VPR; 1.95A {Solanum tu 99.47
2b61_A377 Homoserine O-acetyltransferase; acyl-enzyme, aspar 99.46
3bwx_A285 Alpha/beta hydrolase; YP_496220.1, joint center fo 99.46
3qvm_A282 OLEI00960; structural genomics, PSI-biology, midwe 99.46
4g9e_A279 AHL-lactonase, alpha/beta hydrolase fold protein; 99.46
2vat_A444 Acetyl-COA--deacetylcephalosporin C acetyltransfer 99.46
2r11_A306 Carboxylesterase NP; 2632844, putative hydrolase, 99.45
2xt0_A297 Haloalkane dehalogenase; hydrolase, alpha-beta hyd 99.44
3i1i_A377 Homoserine O-acetyltransferase; structural genomic 99.44
3e0x_A245 Lipase-esterase related protein; APC60309, clostri 99.43
3pfb_A270 Cinnamoyl esterase; alpha/beta hydrolase fold, hyd 99.43
1mj5_A302 1,3,4,6-tetrachloro-1,4-cyclohexadiene hydrolase; 99.42
2qvb_A297 Haloalkane dehalogenase 3; RV2579, alpha-beta hydr 99.42
3i28_A555 Epoxide hydrolase 2; aromatic hydrocarbons catabol 99.42
1k8q_A377 Triacylglycerol lipase, gastric; APHA beta hydrola 99.41
1wm1_A317 Proline iminopeptidase; complex with inhibitor, hy 99.4
2qmq_A286 Protein NDRG2, protein NDR2; alpha/beta-hydrolases 99.4
2psd_A318 Renilla-luciferin 2-monooxygenase; alpha/beta-hydr 99.39
3r0v_A262 Alpha/beta hydrolase fold protein; structural geno 99.39
1q0r_A298 RDMC, aclacinomycin methylesterase; anthracycline, 99.38
3bdi_A207 Uncharacterized protein TA0194; NP_393672.1, predi 99.37
2qs9_A194 Retinoblastoma-binding protein 9; B5T overexpresse 99.37
3r40_A306 Fluoroacetate dehalogenase; FACD, defluorinase, al 99.37
3vdx_A 456 Designed 16NM tetrahedral protein CAGE containing 99.36
3pe6_A303 Monoglyceride lipase; alpha-beta hydrolase fold, 2 99.35
3rm3_A270 MGLP, thermostable monoacylglycerol lipase; alpha/ 99.35
3qit_A286 CURM TE, polyketide synthase; thioesterase, alpha/ 99.34
3fla_A267 RIFR; alpha-beta hydrolase thioesterase, hydrolase 99.34
3dkr_A251 Esterase D; alpha beta hydrolase, mechanism, catal 99.34
3bdv_A191 Uncharacterized protein DUF1234; DUF1234 family pr 99.32
3hju_A342 Monoglyceride lipase; alpha/beta hydrolase, hydrol 99.31
3ibt_A264 1H-3-hydroxy-4-oxoquinoline 2,4-dioxygenase; QDO, 99.31
3c5v_A316 PME-1, protein phosphatase methylesterase 1; demet 99.31
1azw_A313 Proline iminopeptidase; aminopeptidase, serine pro 99.3
1imj_A210 CIB, CCG1-interacting factor B; alpha/beta hydrola 99.3
3h04_A275 Uncharacterized protein; protein with unknown func 99.29
3llc_A270 Putative hydrolase; structural genomics, joint cen 99.28
3qyj_A291 ALR0039 protein; alpha/beta fold, hydrolase; 1.78A 99.27
2k2q_B242 Surfactin synthetase thioesterase subunit; A/B-hyd 99.27
3b12_A304 Fluoroacetate dehalogenase; dehalogease, hydrolase 98.91
1pja_A302 Palmitoyl-protein thioesterase 2 precursor; hydrol 99.26
1tht_A305 Thioesterase; 2.10A {Vibrio harveyi} SCOP: c.69.1. 99.25
2i3d_A249 AGR_C_3351P, hypothetical protein ATU1826; structu 99.25
2wj6_A276 1H-3-hydroxy-4-oxoquinaldine 2,4-dioxygenase; oxid 99.25
1uxo_A192 YDEN protein; hydrolase, A/B hydrolase, esterase, 99.25
1jfr_A262 Lipase; serine hydrolase; 1.90A {Streptomyces exfo 99.22
1ufo_A238 Hypothetical protein TT1662; alpha-beta fold, hydr 99.22
2fx5_A258 Lipase; alpha-beta hydrolase; HET: TLA; 1.80A {Pse 99.21
3trd_A208 Alpha/beta hydrolase; cellular processes; 1.50A {C 99.21
3ksr_A290 Putative serine hydrolase; catalytic triad, struct 99.2
3l80_A292 Putative uncharacterized protein SMU.1393C; alpha/ 99.2
1r3d_A264 Conserved hypothetical protein VC1974; structural 99.2
1zi8_A236 Carboxymethylenebutenolidase; alpha and beta prote 99.16
2qjw_A176 Uncharacterized protein XCC1541; putative hydrolas 99.15
2fuk_A220 XC6422 protein; A/B hydrolase, structural genomics 99.14
2o2g_A223 Dienelactone hydrolase; YP_324580.1, structural ge 99.12
4fle_A202 Esterase; structural genomics, PSI-biology, northe 99.11
2rau_A354 Putative esterase; NP_343859.1, putative lipase, s 99.11
1vkh_A273 Putative serine hydrolase; structural genomics, jo 99.11
1qlw_A328 Esterase; anisotropic refinement, atomic resolutio 99.1
3vis_A306 Esterase; alpha/beta-hydrolase fold, polyethylene 99.08
2pbl_A262 Putative esterase/lipase/thioesterase; alpha/beta- 99.07
4i19_A388 Epoxide hydrolase; structural genomics, PSI-biolog 99.05
3hxk_A276 Sugar hydrolase; alpha-beta protein., structural g 99.05
3f67_A241 Putative dienelactone hydrolase; alpha-beta-alpha 99.04
3qmv_A280 Thioesterase, REDJ; alpha/beta hydrolase fold, hyd 99.03
3ils_A265 PKS, aflatoxin biosynthesis polyketide synthase; A 99.02
1isp_A181 Lipase; alpha/beta hydrolase fold, hydrolase; 1.30 99.01
2jbw_A386 Dhpon-hydrolase, 2,6-dihydroxy-pseudo-oxynicotine 99.0
1fj2_A232 Protein (acyl protein thioesterase 1); alpha/beta 99.0
1ycd_A243 Hypothetical 27.3 kDa protein in AAP1-SMF2 interge 98.99
1auo_A218 Carboxylesterase; hydrolase; 1.80A {Pseudomonas fl 98.98
3fcy_A346 Xylan esterase 1; alpha/beta hydrolase, carbohydra 98.98
2z3z_A706 Dipeptidyl aminopeptidase IV; peptidase family S9, 98.97
3o4h_A582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 98.97
3fnb_A405 Acylaminoacyl peptidase SMU_737; alpha-beta-alpha 98.96
1whs_B153 Serine carboxypeptidase II; HET: NAG FUC; 2.00A {T 98.96
3bjr_A283 Putative carboxylesterase; structural genomics, jo 98.96
2zsh_A351 Probable gibberellin receptor GID1L1; plant hormon 98.96
2o7r_A338 CXE carboxylesterase; alpha/beta hydrolase; 1.40A 98.94
3bxp_A277 Putative lipase/esterase; putative carboxylesteras 98.94
2qru_A274 Uncharacterized protein; alpha/beta-hydrolase, str 98.94
1xfd_A723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 98.93
3g02_A408 Epoxide hydrolase; alpha/beta hydrolase fold, enan 98.93
3k2i_A422 Acyl-coenzyme A thioesterase 4; alpha/beta hydrola 98.91
2r8b_A251 AGR_C_4453P, uncharacterized protein ATU2452; APC6 98.89
2q0x_A335 Protein DUF1749, uncharacterized protein; alpha/be 98.89
3cn9_A226 Carboxylesterase; alpha/beta hydrolase fold super- 98.88
2ecf_A741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 98.88
2hdw_A367 Hypothetical protein PA2218; alpha/beta hydrolase 98.87
3azo_A662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 98.87
1l7a_A318 Cephalosporin C deacetylase; structural genomics, 98.87
3d7r_A326 Esterase; alpha/beta fold, hydrolase; 2.01A {Staph 98.85
1kez_A300 Erythronolide synthase; polyketide synthase, modul 98.85
3hlk_A446 Acyl-coenzyme A thioesterase 2, mitochondrial; alp 98.84
1vlq_A337 Acetyl xylan esterase; TM0077, structural genomics 98.79
2h1i_A226 Carboxylesterase; structural genomics, PSI-2, prot 98.77
3u0v_A239 Lysophospholipase-like protein 1; alpha, beta hydr 98.75
1z68_A719 Fibroblast activation protein, alpha subunit; sepr 98.75
4az3_B155 Lysosomal protective protein 20 kDa chain; hydrola 98.71
2cb9_A244 Fengycin synthetase; thioesterase, non-ribosomal p 98.67
1jmk_C230 SRFTE, surfactin synthetase; thioesterase, non-rib 98.66
4a5s_A740 Dipeptidyl peptidase 4 soluble form; hydrolase, ty 98.65
2c7b_A311 Carboxylesterase, ESTE1; carboxyesterase, thermoph 98.64
3ebl_A365 Gibberellin receptor GID1; alpha/beta hydrolase, l 98.62
4e15_A303 Kynurenine formamidase; alpha/beta hydrolase fold, 98.61
3lcr_A319 Tautomycetin biosynthetic PKS; alpha-beta hydrolas 98.59
3ain_A323 303AA long hypothetical esterase; carboxylesterase 98.58
3k6k_A322 Esterase/lipase; alpha/beta hydrolase fold; 2.20A 98.55
3mve_A415 FRSA, UPF0255 protein VV1_0328; FRSA,fermentation/ 98.55
4ao6_A259 Esterase; hydrolase, thermo label; 1.60A {Unidenti 98.54
1lzl_A323 Heroin esterase; alpha/beta hydrolase; 1.30A {Rhod 98.53
3b5e_A223 MLL8374 protein; NP_108484.1, carboxylesterase, st 98.52
1yr2_A741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 98.5
2hfk_A319 Pikromycin, type I polyketide synthase pikaiv; alp 98.49
1lns_A 763 X-prolyl dipeptidyl aminopetidase; alpha beta hydr 98.49
2bkl_A695 Prolyl endopeptidase; mechanistic study, celiac sp 98.47
1jkm_A361 Brefeldin A esterase; serine hydrolase, degradatio 98.46
2xdw_A710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 98.45
1jji_A311 Carboxylesterase; alpha-beta hydrolase fold, hydro 98.43
1gxs_B158 P-(S)-hydroxymandelonitrIle lyase chain B; inhibit 98.42
3qh4_A317 Esterase LIPW; structural genomics, ssgcid, seattl 98.4
2wir_A313 Pesta, alpha/beta hydrolase fold-3 domain protein; 98.4
2hm7_A310 Carboxylesterase; alpha/beta hydrolase fold, hydro 98.39
2xe4_A751 Oligopeptidase B; hydrolase-inhibitor complex, hyd 98.36
4h0c_A210 Phospholipase/carboxylesterase; PSI-biology, midwe 98.34
3tej_A329 Enterobactin synthase component F; nonribosomal pe 98.32
3fak_A322 Esterase/lipase, ESTE5; HSL, hydrolase; 1.90A {Unc 98.31
4f21_A246 Carboxylesterase/phospholipase family protein; str 98.31
3ga7_A326 Acetyl esterase; phosphoserine, IDP00896, hydrolas 98.3
3og9_A209 Protein YAHD A copper inducible hydrolase; alpha/b 98.29
3iuj_A693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 98.29
4fhz_A285 Phospholipase/carboxylesterase; alpha/beta hydrola 98.23
1ac5_A483 KEX1(delta)P; carboxypeptidase, hydrolase, glycopr 98.2
4hvt_A711 Ritya.17583.B, post-proline cleaving enzyme; ssgci 98.15
1cpy_A421 Serine carboxypeptidase; hydrolase (carboxypeptida 98.08
3d59_A383 Platelet-activating factor acetylhydrolase; secret 98.07
1ivy_A452 Human protective protein; carboxypeptidase, serine 98.05
3tjm_A283 Fatty acid synthase; thioesterase domain, fatty ac 98.04
3lp5_A250 Putative cell surface hydrolase; structural genom 98.02
3i6y_A280 Esterase APC40077; lipase, structural genomics, PS 98.02
3ds8_A254 LIN2722 protein; unkonwn function, structural geno 98.02
3ls2_A280 S-formylglutathione hydrolase; psychrophilic organ 98.02
4ezi_A377 Uncharacterized protein; alpha-beta hydrolases fol 97.96
3guu_A462 Lipase A; protein structure, hydrolase; HET: 1PE; 97.91
2d81_A 318 PHB depolymerase; alpha/beta hydrolase fold, circu 97.85
3fcx_A282 FGH, esterase D, S-formylglutathione hydrolase; re 97.85
3doh_A380 Esterase; alpha-beta hydrolase, beta sheet; 2.60A 97.85
1jjf_A268 Xylanase Z, endo-1,4-beta-xylanase Z, 1,4-beta-D-x 97.64
4b6g_A283 Putative esterase; hydrolase, formaldehyde detoxif 97.61
3e4d_A278 Esterase D; S-formylglutathione hydrolase, hydrola 97.61
3h2g_A397 Esterase; xanthomonas oryzae PV. oryzae, cell WALL 97.58
3fle_A249 SE_1780 protein; structural genomics, APC61035.1, 97.5
2uz0_A263 Esterase, tributyrin esterase; alpha/beta hydrolas 97.46
3d0k_A304 Putative poly(3-hydroxybutyrate) depolymerase LPQ; 96.95
2px6_A316 Thioesterase domain; thioesaterse domain, orlistat 96.85
1tca_A317 Lipase; hydrolase(carboxylic esterase); HET: NAG; 96.76
1ei9_A279 Palmitoyl protein thioesterase 1; alpha/beta hydro 96.31
2qm0_A275 BES; alpha-beta structure, structural genomics, PS 96.03
2vsq_A1304 Surfactin synthetase subunit 3; ligase, peptidyl c 95.7
2b9v_A 652 Alpha-amino acid ester hydrolase; catalytic triad, 95.14
3gff_A331 IROE-like serine hydrolase; NP_718593.1, structura 94.92
1sfr_A304 Antigen 85-A; alpha/beta hydrolase, structural gen 94.79
1mpx_A 615 Alpha-amino acid ester hydrolase; alpha/beta hydro 94.52
1r88_A280 MPT51/MPB51 antigen; ALFA/beta hydrolase fold, FBP 92.91
3c8d_A403 Enterochelin esterase; alpha-beta-alpha sandwich, 92.78
2gzs_A278 IROE protein; enterobactin, salmochelin, DFP, hydr 91.6
1dqz_A280 85C, protein (antigen 85-C); fibronectin, structur 91.42
3pic_A375 CIP2; alpha/beta hydrolase fold, glucuronoyl ester 90.78
4g4g_A433 4-O-methyl-glucuronoyl methylesterase; alpha/beta 90.25
1gkl_A297 Endo-1,4-beta-xylanase Y; hydrolase, esterase fami 88.19
3iii_A 560 COCE/NOND family hydrolase; structural genomics, c 87.26
2vz8_A2512 Fatty acid synthase; transferase, phosphopantethei 85.99
>3v48_A Aminohydrolase, putative aminoacrylate hydrolase RUTD; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.10A {Escherichia coli SE11} Back     alignment and structure
Probab=99.66  E-value=2.7e-16  Score=85.68  Aligned_cols=62  Identities=23%  Similarity=0.382  Sum_probs=58.8

Q ss_pred             CCccEEEEEcCCCcccCHHHHHHHHhhCCCcEEEEeCCCCccCCccChHHHHHHHHHHHhhc
Q 037210            1 VKQKTLIIWGEDDQIISSKLAVRLHCELPNAIIRQIPDCGHLPHVEKPGAVAKLIVEFIQEN   62 (73)
Q Consensus         1 i~~p~l~i~g~~d~~~~~~~~~~~~~~~~~~~~~~~~~~~H~~~~~~~~~~~~~~~~~~~~~   62 (73)
                      |++|+++|+|++|.+++.+..+.+.+.+|+.++..++++||+++.|+|+.+++.+..|+...
T Consensus       199 i~~P~Lii~G~~D~~~p~~~~~~l~~~~p~~~~~~~~~~GH~~~~e~p~~~~~~i~~fl~~~  260 (268)
T 3v48_A          199 IRCPVQIICASDDLLVPTACSSELHAALPDSQKMVMPYGGHACNVTDPETFNALLLNGLASL  260 (268)
T ss_dssp             CCSCEEEEEETTCSSSCTHHHHHHHHHCSSEEEEEESSCCTTHHHHCHHHHHHHHHHHHHHH
T ss_pred             CCCCeEEEEeCCCcccCHHHHHHHHHhCCcCeEEEeCCCCcchhhcCHHHHHHHHHHHHHHh
Confidence            57999999999999999999999999999999999999999999999999999999999764



>3fob_A Bromoperoxidase; structural genomics, IDP00046, bacillus ANT peroxidase, oxidoreductase; 1.74A {Bacillus anthracis str} SCOP: c.69.1.0 Back     alignment and structure
>1iup_A META-cleavage product hydrolase; aromatic compounds, cumene, isopropylbenzene, META-cleavage compound hydrolase; 1.60A {Pseudomonas fluorescens} SCOP: c.69.1.10 PDB: 1iun_A 1iuo_A 1uk6_A 1uk7_A 1uk8_A 1uk9_A 1uka_A 1ukb_A 2d0d_A Back     alignment and structure
>3om8_A Probable hydrolase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MES; 2.25A {Pseudomonas aeruginosa} SCOP: c.69.1.0 Back     alignment and structure
>2puj_A 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrola; C-C bond hydrolase, hydrolase; HET: HPZ; 1.57A {Burkholderia xenovorans} PDB: 2pu7_A* 3v1m_A* 3v1l_A* 2puh_A* 3v1n_A* 3v1k_A* 2og1_A 2pu5_A 2rhw_A* 2rht_A* 2ri6_A Back     alignment and structure
>3c6x_A Hydroxynitrilase; atomic resolution, hydroxynitril lyase, catalysis, protonation state, AB initio calculations, substrate bindin; 1.05A {Hevea brasiliensis} SCOP: c.69.1.20 PDB: 1sc9_A 1yas_A* 2g4l_A* 2yas_A 1qj4_A 3c6y_A 3c6z_A 3c70_A 3yas_A 4yas_A 5yas_A* 6yas_A 7yas_A* 1yb6_A* 1yb7_A 1sck_A 1sci_A 1scq_A 1dwo_A 1dwp_A ... Back     alignment and structure
>1c4x_A BPHD, protein (2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoat hydrolase); PCB degradation; 2.40A {Rhodococcus SP} SCOP: c.69.1.10 Back     alignment and structure
>2ocg_A Valacyclovir hydrolase; alpha beta hydrolase fold; 1.75A {Homo sapiens} PDB: 2oci_A* 2ock_A 2ocl_A Back     alignment and structure
>3bf7_A Esterase YBFF; thioesterase, helical CAP, hydrolase; 1.10A {Escherichia coli} PDB: 3bf8_A Back     alignment and structure
>1u2e_A 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase; alpha/beta hydrolase fold; 2.10A {Escherichia coli} Back     alignment and structure
>3afi_E Haloalkane dehalogenase; A/B-hydrolase, hydrolase; 1.75A {Bradyrhizobium japonicum} PDB: 3a2m_A* 3a2n_A 3a2l_A* Back     alignment and structure
>1j1i_A META cleavage compound hydrolase; carbazole degradation, META cleavage product hydrolase, histidine tagged protein, alpha/beta-hydrolase; 1.86A {Janthinobacterium} SCOP: c.69.1.10 Back     alignment and structure
>1xkl_A SABP2, salicylic acid-binding protein 2; alpha-beta protein, structural genomics, protein structure initiative, PSI; HET: STH; 2.00A {Nicotiana tabacum} SCOP: c.69.1.20 PDB: 1y7i_A* 1y7h_A* Back     alignment and structure
>3ia2_A Arylesterase; alpha-beta hydrolase fold, transition state analog, hydrolas oxidoreductase, peroxidase; 1.65A {Pseudomonas fluorescens} SCOP: c.69.1.12 PDB: 1va4_A 3t52_A* 3t4u_A* 3hi4_A 3hea_A Back     alignment and structure
>2wue_A 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrolase BPHD; HET: KEK; 1.80A {Mycobacterium tuberculosis} PDB: 2wud_A* 2wuf_A* 2wug_A* 2vf2_A Back     alignment and structure
>1brt_A Bromoperoxidase A2; haloperoxidase, oxidoreductase, alpha/beta hydrolase fold, mutant M99T; 1.50A {Streptomyces aureofaciens} SCOP: c.69.1.12 PDB: 1bro_A 1a8u_A 1a7u_A Back     alignment and structure
>3nwo_A PIP, proline iminopeptidase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, mycobac smegmatis; 1.90A {Mycobacterium smegmatis} Back     alignment and structure
>2wfl_A Polyneuridine-aldehyde esterase; alkaloid metabolism, monoterpenoid indole alkaloids, PNAE, hydrolase, serine esterase; HET: CME; 2.10A {Rauvolfia serpentina} PDB: 2wfm_A 3gzj_A* Back     alignment and structure
>1wom_A RSBQ, sigma factor SIGB regulation protein RSBQ; alpha/beta hydrolase, signaling protein; 2.50A {Bacillus subtilis} PDB: 1wpr_A* Back     alignment and structure
>2xua_A PCAD, 3-oxoadipate ENOL-lactonase; hydrolase, catechol metabolism; 1.90A {Burkholderia xenovorans} Back     alignment and structure
>2yys_A Proline iminopeptidase-related protein; TTHA1809, structural genomics, unknown function; 2.20A {Thermus thermophilus} Back     alignment and structure
>1tqh_A Carboxylesterase precursor; tetrahedral intermediate, alpha/beta hydrolase; 1.63A {Geobacillus stearothermophilus} SCOP: c.69.1.29 PDB: 1r1d_A* 4diu_A Back     alignment and structure
>1mtz_A Proline iminopeptidase; alpha-beta hydrolase, CAP domain, caged active site, prolyl peptidase; 1.80A {Thermoplasma acidophilum} SCOP: c.69.1.7 PDB: 1mt3_A 1mu0_A* 1xrr_A 1xrq_A 1xro_A 1xrn_A 1xrm_A 1xrp_A 1xrl_A* 1xqw_A* 1xqx_A* 1xqy_A 1xqv_A Back     alignment and structure
>1b6g_A Haloalkane dehalogenase; hydrolase, alpha/beta-hydrolase; 1.15A {Xanthobacter autotrophicus} SCOP: c.69.1.8 PDB: 1be0_A 1cij_A 2yxp_X 1edd_A 1edb_A 2dhc_A 2dhe_A 2eda_A 2edc_A 2had_A 1ede_A 2pky_X 1bez_A 1bee_A 2dhd_A* 1hde_A Back     alignment and structure
>2e3j_A Epoxide hydrolase EPHB; epoxide hydrolase B, structural mycobacterium tuberculosis structural proteomics project, X hydrolase; 2.10A {Mycobacterium tuberculosis} PDB: 2zjf_A* Back     alignment and structure
>3dqz_A Alpha-hydroxynitrIle lyase-like protein; A/B-hydrloase fold, cyanogenesis; 2.50A {Arabidopsis thaliana} SCOP: c.69.1.0 Back     alignment and structure
>1a8s_A Chloroperoxidase F; haloperoxidase, oxidoreductase, propionate complex; 1.80A {Pseudomonas fluorescens} SCOP: c.69.1.12 Back     alignment and structure
>1ehy_A Protein (soluble epoxide hydrolase); alpha/beta hydrolase fold, epoxide degradation, epichlorohydrin; 2.10A {Agrobacterium tumefaciens} SCOP: c.69.1.11 Back     alignment and structure
>3sty_A Methylketone synthase 1; alpha/beta hydrolase, decarboxylase, hydrolase; HET: DKA; 1.70A {Lycopersicon hirsutum F} PDB: 3stu_A* 3stt_A* 3stv_A* 3stw_A* 3stx_A* Back     alignment and structure
>3u1t_A DMMA haloalkane dehalogenase; alpha/beta-hydrolase, hydrolase; 2.20A {Unidentified} Back     alignment and structure
>2xmz_A Hydrolase, alpha/beta hydrolase fold family; menaquinone biosynthesis, lyase; 1.94A {Staphylococcus aureus} Back     alignment and structure
>2wtm_A EST1E; hydrolase; 1.60A {Clostridium proteoclasticum} PDB: 2wtn_A* Back     alignment and structure
>1a8q_A Bromoperoxidase A1; haloperoxidase, oxidoreductase; 1.75A {Streptomyces aureofaciens} SCOP: c.69.1.12 Back     alignment and structure
>1m33_A BIOH protein; alpha-betta-alpha sandwich, structural genomics, PSI, protei structure initiative; HET: MSE 3OH; 1.70A {Escherichia coli} SCOP: c.69.1.26 Back     alignment and structure
>3fsg_A Alpha/beta superfamily hydrolase; PF00561, MCSG, PSI, PSI-2, structural genomics, protein structure initiative, midwest for structural genomics; 2.00A {Oenococcus oeni} Back     alignment and structure
>1a88_A Chloroperoxidase L; haloperoxidase, oxidoreductase; 1.90A {Streptomyces lividans} SCOP: c.69.1.12 Back     alignment and structure
>1zoi_A Esterase; alpha/beta hydrolase fold; 1.60A {Pseudomonas putida} PDB: 4dgq_A Back     alignment and structure
>3hss_A Putative bromoperoxidase; alpha beta hydrolase, oxidoreductase, hydrolase; 1.90A {Mycobacterium tuberculosis} PDB: 3e3a_A 3hys_A 3hzo_A Back     alignment and structure
>3g9x_A Haloalkane dehalogenase; alpha/beta hydrolase, helical CAP domain, catalytic triad (A His272, Glu130), mutant, I135F, haloalkanes; 0.95A {Rhodococcus SP} SCOP: c.69.1.8 PDB: 3fwh_A 3fbw_A 3rlt_A 3rk4_A 1bn6_A 1bn7_A 4fwb_A 1cqw_A 3sk0_A 2v9z_A Back     alignment and structure
>3oos_A Alpha/beta hydrolase family protein; APC67239.0, protein structure initiative, PSI-2, structural midwest center for structural genomics, MCSG; HET: MSE PG4; 1.65A {Bacillus anthracis} Back     alignment and structure
>3p2m_A Possible hydrolase; alpha/beta hydrolase superfamily; 2.80A {Mycobacterium tuberculosis} Back     alignment and structure
>4fbl_A LIPS lipolytic enzyme; thermostable, structural genomics, enzyme function initiativ structural proteomics in europe, spine; HET: SPD; 1.99A {Unidentified} PDB: 4fbm_A Back     alignment and structure
>3kxp_A Alpha-(N-acetylaminomethylene)succinic acid hydrolase; alpha/beta hydrolase, PLP degradation, E-2- (acetamidomethylene)succinate; 2.26A {Mesorhizobium loti} Back     alignment and structure
>1hkh_A Gamma lactamase; hydrolase, alpha/beta hydrolase, CO-factor free haloperoxidase,; 1.73A {Microbacterium} SCOP: c.69.1.12 PDB: 1hl7_A* Back     alignment and structure
>3kda_A CFTR inhibitory factor (CIF); alpha/beta hydrolase, hydrolase; 1.50A {Pseudomonas aeruginosa ucbpp-pa14} PDB: 3kd2_A 3pi6_A Back     alignment and structure
>4dnp_A DAD2; alpha/beta hydrolase, hydrolase; 2.15A {Petunia hybrida} PDB: 4dnq_A Back     alignment and structure
>2y6u_A Peroxisomal membrane protein LPX1; hydrolase, putative esterase, putative lipase; HET: CME CSO; 1.90A {Saccharomyces cerevisiae} PDB: 2y6v_A* Back     alignment and structure
>4f0j_A Probable hydrolytic enzyme; alpha/beta hydrolase fold, structural genomics, joint center structural genomics, JCSG; HET: MSE; 1.50A {Pseudomonas aeruginosa} Back     alignment and structure
>2pl5_A Homoserine O-acetyltransferase; alpha/beta hydrolase superfa transferase; 2.20A {Leptospira interrogans} SCOP: c.69.1.40 Back     alignment and structure
>2cjp_A Epoxide hydrolase; HET: PG4 VPR; 1.95A {Solanum tuberosum} PDB: 3cxu_A* Back     alignment and structure
>2b61_A Homoserine O-acetyltransferase; acyl-enzyme, aspartate pathway, coenzyme A, structure-functi studies, alpha-beta hydrolase fold; 1.65A {Haemophilus influenzae} SCOP: c.69.1.40 Back     alignment and structure
>3bwx_A Alpha/beta hydrolase; YP_496220.1, joint center for structural genomics, protein structure initiative, PSI-2; HET: MSE; 1.50A {Novosphingobium aromaticivorans} Back     alignment and structure
>3qvm_A OLEI00960; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta hydrolase fold, hydrolase; 2.00A {Oleispira antarctica} Back     alignment and structure
>4g9e_A AHL-lactonase, alpha/beta hydrolase fold protein; AHL-binding; HET: C4L; 1.09A {Ochrobactrum} PDB: 4g5x_A* 4g8b_A* 4g8d_A 4g8c_A* 4g9g_A Back     alignment and structure
>2vat_A Acetyl-COA--deacetylcephalosporin C acetyltransferase; A/B- hydrolase fold, acyltransferase, acetyl coenzyme A, antibiotic biosynthesis; HET: COA; 2.2A {Acremonium chrysogenum} SCOP: c.69.1.40 PDB: 2vav_A* 2vax_A* Back     alignment and structure
>2r11_A Carboxylesterase NP; 2632844, putative hydrolase, structural genomics, joint center for structural genomics, JCSG; HET: MSE PGE; 1.96A {Bacillus subtilis} Back     alignment and structure
>2xt0_A Haloalkane dehalogenase; hydrolase, alpha-beta hydrolase fold; 1.90A {Plesiocystis pacifica} Back     alignment and structure
>3i1i_A Homoserine O-acetyltransferase; structural genomics, IDP01610, O-acetyltransfera bacillus anthracis; HET: MSE; 2.44A {Bacillus anthracis str} Back     alignment and structure
>3e0x_A Lipase-esterase related protein; APC60309, clostridium acetobutylicum ATCC 824, structural genomics, PSI-2; HET: MSE; 1.45A {Clostridium acetobutylicum} Back     alignment and structure
>3pfb_A Cinnamoyl esterase; alpha/beta hydrolase fold, hydrolase, cinnamoyl/Fe esterase, hydroxycinammates, extracellular; HET: ZYC; 1.58A {Lactobacillus johnsonii} PDB: 3pf9_A* 3pfc_A* 3s2z_A* 3pf8_A 3qm1_A* Back     alignment and structure
>1mj5_A 1,3,4,6-tetrachloro-1,4-cyclohexadiene hydrolase; LINB, haloalkane dehalogenase, 1, 3, 4, 4-cyclohexadiene dehalogenase; 0.95A {Sphingomonas paucimobilis} SCOP: c.69.1.8 PDB: 1cv2_A 1d07_A 2bfn_A 1g42_A* 1g4h_A* 1g5f_A* 1iz7_A 1iz8_A* 1k5p_A 1k63_A 1k6e_A Back     alignment and structure
>2qvb_A Haloalkane dehalogenase 3; RV2579, alpha-beta hydrolase protei structural genomics consortium, TBSGC, hydrolase; 1.19A {Mycobacterium tuberculosis} PDB: 2o2i_A 2o2h_A Back     alignment and structure
>3i28_A Epoxide hydrolase 2; aromatic hydrocarbons catabolism, detoxification, magnesium, metal-binding, peroxisome; HET: 34N; 1.95A {Homo sapiens} PDB: 1s8o_A* 1zd2_P* 1vj5_A* 1zd4_A* 1zd5_A* 3i1y_A* 1zd3_A* 3koo_A* 3otq_A* 4hai_A* 1cqz_A 1cr6_A* 1ek1_A* 1ek2_A* 3ans_A* 3ant_A* 3pdc_A* Back     alignment and structure
>1k8q_A Triacylglycerol lipase, gastric; APHA beta hydrolase fold, hydrolase; HET: NAG BOG C11; 2.70A {Canis lupus familiaris} SCOP: c.69.1.6 PDB: 1hlg_A* Back     alignment and structure
>1wm1_A Proline iminopeptidase; complex with inhibitor, hydrolase; HET: PTB; 2.10A {Serratia marcescens} SCOP: c.69.1.7 PDB: 1qtr_A* 1x2b_A* 1x2e_A* Back     alignment and structure
>2qmq_A Protein NDRG2, protein NDR2; alpha/beta-hydrolases fold, NDR family, developmental protei differentiation, neurogenesis, phosphorylation; HET: 2PE; 1.70A {Mus musculus} PDB: 2xmq_A 2xmr_A 2xms_A Back     alignment and structure
>2psd_A Renilla-luciferin 2-monooxygenase; alpha/beta-hydrolase, luciferase, oxidoreductase; 1.40A {Renilla reniformis} PDB: 2pse_A 2psj_A* 2psh_A 2psf_A Back     alignment and structure
>3r0v_A Alpha/beta hydrolase fold protein; structural genomics, PSI-biology, protein structure initiati alpha/beta hydrolase; HET: MSE; 1.38A {Sphaerobacter thermophilus} Back     alignment and structure
>1q0r_A RDMC, aclacinomycin methylesterase; anthracycline, hydrolase, polyketide, tailoring enzyme, structural proteomics in europe, spine; HET: AKT 1PE; 1.45A {Streptomyces purpurascens} SCOP: c.69.1.28 PDB: 1q0z_A* Back     alignment and structure
>3bdi_A Uncharacterized protein TA0194; NP_393672.1, predicted CIB-like hydrolase, structural genomi center for structural genomics; HET: MSE; 1.45A {Thermoplasma acidophilum dsm 1728} Back     alignment and structure
>2qs9_A Retinoblastoma-binding protein 9; B5T overexpressed gene protein, BOG, RBBP9, RBBP10, HR2978, NESG, structural genomics, PSI-2; 1.72A {Homo sapiens} Back     alignment and structure
>3r40_A Fluoroacetate dehalogenase; FACD, defluorinase, alpha/beta hydrolase, hydrolase; 1.05A {Rhodopseudomonas palustris} PDB: 3r3w_A 3r3x_A 3r3v_A 3r3u_A 3r3z_A 3r41_A 3r3y_A Back     alignment and structure
>3vdx_A Designed 16NM tetrahedral protein CAGE containing bromoperoxidase BPO-A2 and matrix...; protein design, bionanotechnology; 3.00A {Streptomyces aureofaciens} PDB: 4d9j_A Back     alignment and structure
>3pe6_A Monoglyceride lipase; alpha-beta hydrolase fold, 2-arachidonyl-glycerol, M associated, hydrolase, hydrolase-hydrolase inhibitor comple; HET: ZYH; 1.35A {Homo sapiens} PDB: 3jw8_A 3jwe_A* Back     alignment and structure
>3rm3_A MGLP, thermostable monoacylglycerol lipase; alpha/beta hydrolase fold, hydrolase; 1.20A {Bacillus SP} PDB: 3rli_A Back     alignment and structure
>3qit_A CURM TE, polyketide synthase; thioesterase, alpha/beta hydrolase, decarboxylase, sulfate elimination, terminal alkene production; 1.68A {Lyngbya majuscula 19L} Back     alignment and structure
>3fla_A RIFR; alpha-beta hydrolase thioesterase, hydrolase; HET: MSE; 1.80A {Amycolatopsis mediterranei} PDB: 3flb_A* Back     alignment and structure
>3dkr_A Esterase D; alpha beta hydrolase, mechanism, catalytic triad, rotation; 1.60A {Lactobacillus rhamnosus} SCOP: c.69.1.0 PDB: 3dlt_A 3dyi_A 3dyv_A 3e1g_A Back     alignment and structure
>3bdv_A Uncharacterized protein DUF1234; DUF1234 family protein, alpha/beta-hydrolases fold, structur genomics; HET: MSE; 1.66A {Pectobacterium atrosepticum SCRI1043} Back     alignment and structure
>3hju_A Monoglyceride lipase; alpha/beta hydrolase, hydrolase, serine esterase; 2.20A {Homo sapiens} Back     alignment and structure
>3ibt_A 1H-3-hydroxy-4-oxoquinoline 2,4-dioxygenase; QDO, oxidoreductase; 2.60A {Pseudomonas putida} Back     alignment and structure
>3c5v_A PME-1, protein phosphatase methylesterase 1; demethylase, PP2A, alternative splicing, hydrolase, phosphoprotein, serine esterase; 2.00A {Homo sapiens} PDB: 3c5w_P Back     alignment and structure
>1azw_A Proline iminopeptidase; aminopeptidase, serine protease, xanthomonas campestris; 2.70A {Xanthomonas citri} SCOP: c.69.1.7 Back     alignment and structure
>1imj_A CIB, CCG1-interacting factor B; alpha/beta hydrolase, CCG1 interactor; 2.20A {Homo sapiens} SCOP: c.69.1.23 Back     alignment and structure
>3h04_A Uncharacterized protein; protein with unknown function, structural genomics, MCSG, PS protein structure initiative; 1.90A {Staphylococcus aureus subsp} Back     alignment and structure
>3llc_A Putative hydrolase; structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE PG4; 1.80A {Agrobacterium vitis} Back     alignment and structure
>3qyj_A ALR0039 protein; alpha/beta fold, hydrolase; 1.78A {Nostoc SP} Back     alignment and structure
>2k2q_B Surfactin synthetase thioesterase subunit; A/B-hydrolase, NRPS, non-ribosomal peptide synthetase, type II thioesterase, antibiotic biosynthesis; NMR {Bacillus subtilis} PDB: 2ron_A Back     alignment and structure
>3b12_A Fluoroacetate dehalogenase; dehalogease, hydrolase; 1.20A {Burkholderia SP} PDB: 1y37_A Back     alignment and structure
>1pja_A Palmitoyl-protein thioesterase 2 precursor; hydrolase, glycoprotein, lysosome; HET: NAG; 2.70A {Homo sapiens} SCOP: c.69.1.13 Back     alignment and structure
>1tht_A Thioesterase; 2.10A {Vibrio harveyi} SCOP: c.69.1.13 Back     alignment and structure
>2i3d_A AGR_C_3351P, hypothetical protein ATU1826; structural genomics, APC5865, hydrolase, PSI-2, protein STRU initiative; HET: MSE; 1.50A {Agrobacterium tumefaciens str} SCOP: c.69.1.36 Back     alignment and structure
>2wj6_A 1H-3-hydroxy-4-oxoquinaldine 2,4-dioxygenase; oxidoreductase, alpha/beta hydrolase; HET: ZZ8 SRT; 2.00A {Arthrobacter nitroguajacolicus} PDB: 2wj4_A* 2wj3_A* 2wm2_A* Back     alignment and structure
>1uxo_A YDEN protein; hydrolase, A/B hydrolase, esterase, PSI, protein structure initiative, MCSG, midwest center for structural genomics; 1.8A {Bacillus subtilis} SCOP: c.69.1.31 Back     alignment and structure
>1jfr_A Lipase; serine hydrolase; 1.90A {Streptomyces exfoliatus} SCOP: c.69.1.16 Back     alignment and structure
>1ufo_A Hypothetical protein TT1662; alpha-beta fold, hydrolase, structural genomics, riken structural genomics/proteomics initiative, RSGI; 1.60A {Thermus thermophilus} SCOP: c.69.1.27 Back     alignment and structure
>2fx5_A Lipase; alpha-beta hydrolase; HET: TLA; 1.80A {Pseudomonas mendocina} Back     alignment and structure
>3trd_A Alpha/beta hydrolase; cellular processes; 1.50A {Coxiella burnetii} Back     alignment and structure
>3ksr_A Putative serine hydrolase; catalytic triad, structural genomics, JOIN for structural genomics, JCSG; 2.69A {Xanthomonas campestris PV} Back     alignment and structure
>3l80_A Putative uncharacterized protein SMU.1393C; alpha/beta hydrolase fold, carboxylesterase, Ser- hydrolase; 2.00A {Streptococcus mutans} Back     alignment and structure
>1r3d_A Conserved hypothetical protein VC1974; structural genomics, hydrolase, NYSGXRC, NEW YORK SGX research center for structural genomics, PSI; 1.90A {Vibrio cholerae} SCOP: c.69.1.35 Back     alignment and structure
>1zi8_A Carboxymethylenebutenolidase; alpha and beta proteins, 3-D structure, serine esterase, HYD aromatic hydrocarbons, catabolism; 1.40A {Pseudomonas putida} PDB: 1zj5_A* 1zi9_A 1zi6_A 1zj4_A* 1din_A 1ziy_A* 1zic_A 1zix_A 1ggv_A* Back     alignment and structure
>2qjw_A Uncharacterized protein XCC1541; putative hydrolase of the alpha/beta superfamily, structural genomics; HET: MSE TLA P6G; 1.35A {Xanthomonas campestris PV} Back     alignment and structure
>2fuk_A XC6422 protein; A/B hydrolase, structural genomics, X-RAY diffraction; 1.60A {Xanthomonas campestris} SCOP: c.69.1.36 Back     alignment and structure
>2o2g_A Dienelactone hydrolase; YP_324580.1, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.92A {Anabaena variabilis} Back     alignment and structure
>4fle_A Esterase; structural genomics, PSI-biology, northeast structural genom consortium, NESG, alpha-beta protein, rossmann fold, HY; 2.10A {Yersinia enterocolitica subsp} Back     alignment and structure
>2rau_A Putative esterase; NP_343859.1, putative lipase, structural genomics, joint CEN structural genomics, JCSG; HET: PG4 UNL; 1.85A {Sulfolobus solfataricus P2} Back     alignment and structure
>1vkh_A Putative serine hydrolase; structural genomics, joint center structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.85A {Saccharomyces cerevisiae} SCOP: c.69.1.32 Back     alignment and structure
>1qlw_A Esterase; anisotropic refinement, atomic resolution, alpha/beta hydrolase; 1.09A {Alcaligenes SP} SCOP: c.69.1.15 PDB: 2wkw_A* Back     alignment and structure
>3vis_A Esterase; alpha/beta-hydrolase fold, polyethylene terephthal hydrolase; HET: PE4; 1.76A {Thermobifida alba} Back     alignment and structure
>2pbl_A Putative esterase/lipase/thioesterase; alpha/beta-hydrolases fold, structural genomics, joint cente structural genomics, JCSG; 1.79A {Silicibacter SP} SCOP: c.69.1.2 Back     alignment and structure
>4i19_A Epoxide hydrolase; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics, MCSG; 2.15A {Streptomyces carzinostaticus subsp} Back     alignment and structure
>3hxk_A Sugar hydrolase; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 3.20A {Lactococcus lactis subsp} Back     alignment and structure
>3f67_A Putative dienelactone hydrolase; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; 1.74A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3qmv_A Thioesterase, REDJ; alpha/beta hydrolase fold, hydrolase; 2.12A {Streptomyces coelicolor} PDB: 3qmw_A* Back     alignment and structure
>3ils_A PKS, aflatoxin biosynthesis polyketide synthase; A/B hydrolase, thioesterase, norsolorinic acid, P polyketide, acyltransferase; 1.70A {Aspergillus parasiticus} Back     alignment and structure
>1isp_A Lipase; alpha/beta hydrolase fold, hydrolase; 1.30A {Bacillus subtilis} SCOP: c.69.1.18 PDB: 1i6w_A 1r4z_A* 1r50_A* 2qxu_A 2qxt_A 1t4m_A 1t2n_A 3d2a_A 3qzu_A 3d2b_A 3d2c_A 3qmm_A Back     alignment and structure
>2jbw_A Dhpon-hydrolase, 2,6-dihydroxy-pseudo-oxynicotine hydrolase; alpha/beta hydrolase, META-cleavage pathway; 2.1A {Arthrobacter nicotinovorans} SCOP: c.69.1.41 Back     alignment and structure
>1fj2_A Protein (acyl protein thioesterase 1); alpha/beta hydrolase, serine hydrolase, SAD, anomalous diffr hydrolase; 1.50A {Homo sapiens} SCOP: c.69.1.14 Back     alignment and structure
>1ycd_A Hypothetical 27.3 kDa protein in AAP1-SMF2 intergenic region; esterase, lipase, serine hydrolase, structural genomics; HET: LI5; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>1auo_A Carboxylesterase; hydrolase; 1.80A {Pseudomonas fluorescens} SCOP: c.69.1.14 PDB: 1aur_A* Back     alignment and structure
>3fcy_A Xylan esterase 1; alpha/beta hydrolase, carbohydrate esterase, CE7; 2.10A {Thermoanaerobacterium SP} Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>3fnb_A Acylaminoacyl peptidase SMU_737; alpha-beta-alpha sandwich, helix bundle, structural genomics protein structure initiative; HET: PGE; 2.12A {Streptococcus mutans} Back     alignment and structure
>1whs_B Serine carboxypeptidase II; HET: NAG FUC; 2.00A {Triticum aestivum} SCOP: c.69.1.5 PDB: 1wht_B* 1bcs_B* 1bcr_B* 3sc2_B* Back     alignment and structure
>3bjr_A Putative carboxylesterase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 2.09A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>2zsh_A Probable gibberellin receptor GID1L1; plant hormone receptor, gibberellin, gibberellin signaling pathway, hydrolase, nucleus, receptor, developmental protein; HET: GA3; 1.80A {Arabidopsis thaliana} PDB: 2zsi_A* Back     alignment and structure
>2o7r_A CXE carboxylesterase; alpha/beta hydrolase; 1.40A {Actinidia eriantha} PDB: 2o7v_A Back     alignment and structure
>3bxp_A Putative lipase/esterase; putative carboxylesterase, structural genomics, joint center structural genomics, JCSG; HET: EPE; 1.70A {Lactobacillus plantarum WCFS1} PDB: 3d3n_A* Back     alignment and structure
>2qru_A Uncharacterized protein; alpha/beta-hydrolase, structural GENO PSI-2, protein structure initiative, midwest center for STR genomics, MCSG; 1.65A {Enterococcus faecalis} Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>3g02_A Epoxide hydrolase; alpha/beta hydrolase fold, enantioselective, mutant, directed evolution; 1.50A {Aspergillus niger} SCOP: c.69.1.11 PDB: 1qo7_A 3g0i_A* Back     alignment and structure
>3k2i_A Acyl-coenzyme A thioesterase 4; alpha/beta hydrolase fold seven-stranded beta-sandwich, structural genomics, structural genomics consortium, SGC; 2.40A {Homo sapiens} Back     alignment and structure
>2r8b_A AGR_C_4453P, uncharacterized protein ATU2452; APC6088, agrobacterium tumefaciens STR. C58 structural genomics, PSI-2; 2.56A {Agrobacterium tumefaciens str} SCOP: c.69.1.14 Back     alignment and structure
>2q0x_A Protein DUF1749, uncharacterized protein; alpha/beta hydrolase fold, structural genomics, structural G of pathogenic protozoa consortium; 2.20A {Trypanosoma brucei} Back     alignment and structure
>3cn9_A Carboxylesterase; alpha/beta hydrolase fold super-family, hydrolase; HET: 2PE; 2.09A {Pseudomonas aeruginosa} PDB: 3cn7_A* Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>2hdw_A Hypothetical protein PA2218; alpha/beta hydrolase fold, structural genomics, PSI, structure initiative; 2.00A {Pseudomonas aeruginosa} Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>1l7a_A Cephalosporin C deacetylase; structural genomics, alpha-beta-alpha sandwich, PSI, protein structure initiative; 1.50A {Bacillus subtilis} SCOP: c.69.1.25 PDB: 1odt_C 1ods_A 3fvt_A 3fvr_A 3fyu_A* 2xlb_A 2xlc_A 3fyt_A* 3fyu_B* Back     alignment and structure
>3d7r_A Esterase; alpha/beta fold, hydrolase; 2.01A {Staphylococcus aureus subsp} Back     alignment and structure
>1kez_A Erythronolide synthase; polyketide synthase, modular polyketide synthase, thioesterase, 6-DEB, TE, DEBS, alpha, beta-hydrolase; 2.80A {Saccharopolyspora erythraea} SCOP: c.69.1.22 PDB: 1mo2_A Back     alignment and structure
>3hlk_A Acyl-coenzyme A thioesterase 2, mitochondrial; alpha/beta hydrolase, alternative splicing, hydrolase, mitochondrion, polymorphism, serine esterase; 2.10A {Homo sapiens} Back     alignment and structure
>1vlq_A Acetyl xylan esterase; TM0077, structural genomics, JCSG, PR structure initiative, PSI, joint center for structural GENO hydrolase; 2.10A {Thermotoga maritima} SCOP: c.69.1.25 PDB: 3m81_A 3m83_A* 3m82_A* Back     alignment and structure
>2h1i_A Carboxylesterase; structural genomics, PSI-2, protein struct initiative, midwest center for structural genomics, MCSG, H; HET: MSE; 2.80A {Bacillus cereus} SCOP: c.69.1.14 Back     alignment and structure
>3u0v_A Lysophospholipase-like protein 1; alpha, beta hydrolase fold, hydrolase; 1.72A {Homo sapiens} Back     alignment and structure
>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} Back     alignment and structure
>4az3_B Lysosomal protective protein 20 kDa chain; hydrolase, drug discovery, carboxypeptidase, cardiovascular; HET: NAG S35; 2.04A {Homo sapiens} PDB: 4az0_B* Back     alignment and structure
>2cb9_A Fengycin synthetase; thioesterase, non-ribosomal peptide synthesis, alpha/beta- hydrolases, catalytic triade, hydrolase; 1.8A {Bacillus subtilis} PDB: 2cbg_A* Back     alignment and structure
>1jmk_C SRFTE, surfactin synthetase; thioesterase, non-ribosomal peptide synthesis, alpha-beta hydrolase, cyclic peptide; 1.71A {Bacillus subtilis} SCOP: c.69.1.22 Back     alignment and structure
>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... Back     alignment and structure
>2c7b_A Carboxylesterase, ESTE1; carboxyesterase, thermophilic enzyme, hydrolase, HSL, alpha/beta hydrolase fold; 2.3A {Uncultured archaeon} Back     alignment and structure
>3ebl_A Gibberellin receptor GID1; alpha/beta hydrolase, lipase, gibberellin signaling pathway, hydrolase, nucleus, hydrolase receptor; HET: GA4; 1.90A {Oryza sativa subsp} PDB: 3ed1_A* Back     alignment and structure
>4e15_A Kynurenine formamidase; alpha/beta hydrolase fold, hydrolase-hydrolase inhibitor COM; HET: SEB; 1.50A {Drosophila melanogaster} PDB: 4e14_A* 4e11_A Back     alignment and structure
>3lcr_A Tautomycetin biosynthetic PKS; alpha-beta hydrolase, thioesterase, polyketide synthase, phosphopantetheine, transferase, hydrolase; 2.00A {Streptomyces SP} Back     alignment and structure
>3ain_A 303AA long hypothetical esterase; carboxylesterase, thermophilic, dimer, archaea, R267G, hydro; 1.65A {Sulfolobus tokodaii} PDB: 3aio_A 3ail_A 3aik_A 3aim_A Back     alignment and structure
>3k6k_A Esterase/lipase; alpha/beta hydrolase fold; 2.20A {Uncultured bacterium} PDB: 3dnm_A Back     alignment and structure
>3mve_A FRSA, UPF0255 protein VV1_0328; FRSA,fermentation/respiration switch protein, hydrolase ACTI lyase; 2.20A {Vibrio vulnificus} PDB: 3our_A Back     alignment and structure
>4ao6_A Esterase; hydrolase, thermo label; 1.60A {Unidentified} PDB: 4ao7_A 4ao8_A Back     alignment and structure
>1lzl_A Heroin esterase; alpha/beta hydrolase; 1.30A {Rhodococcus SP} SCOP: c.69.1.2 PDB: 1lzk_A Back     alignment and structure
>3b5e_A MLL8374 protein; NP_108484.1, carboxylesterase, structural genomics, joint CE structural genomics, JCSG, protein structure initiative; 1.75A {Mesorhizobium loti} SCOP: c.69.1.14 Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>2hfk_A Pikromycin, type I polyketide synthase pikaiv; alpha/beta hydrolase, thioesterase; HET: E4H; 1.79A {Streptomyces venezuelae} PDB: 2h7x_A* 2h7y_A* 2hfj_A* 1mna_A 1mn6_A 1mnq_A Back     alignment and structure
>1lns_A X-prolyl dipeptidyl aminopetidase; alpha beta hydrolase fold; 2.20A {Lactococcus lactis} SCOP: a.40.2.1 b.18.1.13 c.69.1.21 Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>1jkm_A Brefeldin A esterase; serine hydrolase, degradation of brefeldin A, alpha/beta hydrolase family; 1.85A {Bacillus subtilis} SCOP: c.69.1.2 Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>1jji_A Carboxylesterase; alpha-beta hydrolase fold, hydrolase; HET: EPE; 2.20A {Archaeoglobus fulgidus} SCOP: c.69.1.2 Back     alignment and structure
>1gxs_B P-(S)-hydroxymandelonitrIle lyase chain B; inhibitor complex, cyanogenesis mechanism; HET: NAG FUL DKA; 2.3A {Sorghum bicolor} SCOP: c.69.1.5 Back     alignment and structure
>3qh4_A Esterase LIPW; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, tuberculosis, O LIPW, heroin esterase; 1.75A {Mycobacterium marinum} Back     alignment and structure
>2hm7_A Carboxylesterase; alpha/beta hydrolase fold, hydrolase; 2.00A {Alicyclobacillus acidocaldarius} PDB: 1evq_A* 1u4n_A 1qz3_A Back     alignment and structure
>2xe4_A Oligopeptidase B; hydrolase-inhibitor complex, hydrolase, protease inhibitor trypanosomes, CLAN SC; HET: FC0 RGL; 1.65A {Leishmania major} Back     alignment and structure
>4h0c_A Phospholipase/carboxylesterase; PSI-biology, midwest center for structural genomics, MCSG, hydrolase; HET: CIT; 1.62A {Dyadobacter fermentans} Back     alignment and structure
>3tej_A Enterobactin synthase component F; nonribosomal peptide, thioesterase, carrier domain, ATP- BIN enterobactin biosynthesis, ION transport, iron; HET: UF0; 1.90A {Escherichia coli} PDB: 2roq_A Back     alignment and structure
>3fak_A Esterase/lipase, ESTE5; HSL, hydrolase; 1.90A {Uncultured bacterium} PDB: 3g9t_A 3g9u_A 3g9z_A 3h17_A* 3h18_A* 3h19_A 3h1a_A 3h1b_A 3l1h_A 3l1i_A 3l1j_A 3v9a_A Back     alignment and structure
>4f21_A Carboxylesterase/phospholipase family protein; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.50A {Francisella tularensis subsp} Back     alignment and structure
>3ga7_A Acetyl esterase; phosphoserine, IDP00896, hydrolase, serine structural genomics, center for structural genomics of INFE diseases, csgid; HET: SEP MSE; 1.55A {Salmonella typhimurium} Back     alignment and structure
>3og9_A Protein YAHD A copper inducible hydrolase; alpha/beta hydrolase, copper homeostasis, malic acid; 1.88A {Lactococcus lactis subsp} SCOP: c.69.1.0 Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>4fhz_A Phospholipase/carboxylesterase; alpha/beta hydrolase superfamily, central beta-STR sheet, flanked alpha helices, hydrolase; 2.01A {Rhodobacter sphaeroides} PDB: 4ftw_A* Back     alignment and structure
>1ac5_A KEX1(delta)P; carboxypeptidase, hydrolase, glycoprotein, transmembrane; HET: NAG; 2.40A {Saccharomyces cerevisiae} SCOP: c.69.1.5 Back     alignment and structure
>4hvt_A Ritya.17583.B, post-proline cleaving enzyme; ssgcid, structural genomics, S structural genomics center for infectious disease; 1.70A {Rickettsia typhi} Back     alignment and structure
>1cpy_A Serine carboxypeptidase; hydrolase (carboxypeptidase); HET: NAG; 2.60A {Saccharomyces cerevisiae} SCOP: c.69.1.5 PDB: 1wpx_A* 1ysc_A* Back     alignment and structure
>3d59_A Platelet-activating factor acetylhydrolase; secreted protein, alpha/beta-hydrolase-fold, LDL-bound, lipoprotein associated phospholipase A2, LP-PLA2; 1.50A {Homo sapiens} PDB: 3d5e_A 3f97_A* 3f98_A 3f9c_A* 3f96_A* Back     alignment and structure
>1ivy_A Human protective protein; carboxypeptidase, serine carboxypeptidase, protective protei glycoprotein, zymogen; HET: NAG NDG; 2.20A {Homo sapiens} SCOP: c.69.1.5 Back     alignment and structure
>3tjm_A Fatty acid synthase; thioesterase domain, fatty acid synthesis, hydrolase-hydrola inhibitor complex; HET: 7FA; 1.48A {Homo sapiens} PDB: 1xkt_A Back     alignment and structure
>3lp5_A Putative cell surface hydrolase; structural genom PSI2, MCSG, protein structure initiative, midwest center FO structural genomics; 2.00A {Lactobacillus plantarum} Back     alignment and structure
>3i6y_A Esterase APC40077; lipase, structural genomics, PSI-2, PR structure initiative, midwest center for structural genomic hydrolase; HET: MSE; 1.75A {Oleispira antarctica} PDB: 3s8y_A Back     alignment and structure
>3ds8_A LIN2722 protein; unkonwn function, structural genomics, PSI, MCSG, P structure initiative; 1.80A {Listeria innocua} Back     alignment and structure
>3ls2_A S-formylglutathione hydrolase; psychrophilic organism; 2.20A {Pseudoalteromonas haloplanktis} SCOP: c.69.1.0 Back     alignment and structure
>4ezi_A Uncharacterized protein; alpha-beta hydrolases fold, structural genomics, joint cente structural genomics, JCSG; HET: MSE; 1.15A {Legionella pneumophila subsp} Back     alignment and structure
>3guu_A Lipase A; protein structure, hydrolase; HET: 1PE; 2.10A {Candida antarctica} PDB: 2veo_A* Back     alignment and structure
>2d81_A PHB depolymerase; alpha/beta hydrolase fold, circular permutation, hydrolase; HET: NAG RB3; 1.66A {Penicillium funiculosum} SCOP: c.69.1.37 PDB: 2d80_A* Back     alignment and structure
>3fcx_A FGH, esterase D, S-formylglutathione hydrolase; retinoblastoma, genetic marker, cytoplasm, cytoplasmic vesicle, polymorphism, serine esterase; 1.50A {Homo sapiens} SCOP: c.69.1.0 Back     alignment and structure
>3doh_A Esterase; alpha-beta hydrolase, beta sheet; 2.60A {Thermotoga maritima} PDB: 3doi_A Back     alignment and structure
>1jjf_A Xylanase Z, endo-1,4-beta-xylanase Z, 1,4-beta-D-xylan; feruloyl esterase, ferulic acid esterase, FAE_XYNZ, XYNZ, structural genomics; 1.75A {Clostridium thermocellum} SCOP: c.69.1.2 PDB: 1jt2_A* Back     alignment and structure
>4b6g_A Putative esterase; hydrolase, formaldehyde detoxification, alpha/beta serine HY; 1.40A {Neisseria meningitidis MC58} Back     alignment and structure
>3e4d_A Esterase D; S-formylglutathione hydrolase, hydrolase fold family, catalytic triad, kinetics, proposed reaction mechanism; HET: MSE; 2.01A {Agrobacterium tumefaciens} SCOP: c.69.1.0 Back     alignment and structure
>3h2g_A Esterase; xanthomonas oryzae PV. oryzae, cell WALL degrading enzyme, RICE, virulence, innate immune responses, pathogenesis; 1.86A {Xanthomonas oryzae PV} PDB: 3h2j_A 3h2k_A* 3h2h_A 3h2i_A Back     alignment and structure
>3fle_A SE_1780 protein; structural genomics, APC61035.1, PSI-2, protein structure in midwest center for structural genomics, MCSG; 2.01A {Staphylococcus epidermidis} Back     alignment and structure
>2uz0_A Esterase, tributyrin esterase; alpha/beta hydrolase, hydrolase, A virulence facto LUNG infection; HET: MSE; 1.7A {Streptococcus pneumoniae} Back     alignment and structure
>3d0k_A Putative poly(3-hydroxybutyrate) depolymerase LPQ; alpha-beta-alpha sandwich, structural genomics, PSI-2; 1.83A {Bordetella parapertussis 12822} Back     alignment and structure
>2px6_A Thioesterase domain; thioesaterse domain, orlistat, fatty acid synthase, drug complex, tetrahydrolipstatin, transferase; HET: DH9; 2.30A {Homo sapiens} Back     alignment and structure
>1tca_A Lipase; hydrolase(carboxylic esterase); HET: NAG; 1.55A {Candida antarctica} SCOP: c.69.1.17 PDB: 1lbs_A* 1lbt_A* 1tcb_A* 1tcc_A* Back     alignment and structure
>1ei9_A Palmitoyl protein thioesterase 1; alpha/beta hydrolase, glycoprotein, hydrolase; HET: NDG NAG; 2.25A {Bos taurus} SCOP: c.69.1.13 PDB: 1eh5_A* 1exw_A* 3gro_A Back     alignment and structure
>2qm0_A BES; alpha-beta structure, structural genomics, PSI-2, protein ST initiative, midwest center for structural genomics, MCSG; HET: SVY; 1.84A {Bacillus cereus atcc 14579} Back     alignment and structure
>2vsq_A Surfactin synthetase subunit 3; ligase, peptidyl carrier protein, ligase phosphoprotein, TER module, phosphopantetheine; 2.60A {Bacillus subtilis} Back     alignment and structure
>2b9v_A Alpha-amino acid ester hydrolase; catalytic triad, alpha/beta-hydrolase; 2.00A {Acetobacter pasteurianus} SCOP: b.18.1.13 c.69.1.21 PDB: 2b4k_A 1nx9_A* 1ryy_A Back     alignment and structure
>3gff_A IROE-like serine hydrolase; NP_718593.1, structural genomics center for structural genomics, JCSG, protein structure INI PSI-2; 2.12A {Shewanella oneidensis} Back     alignment and structure
>1sfr_A Antigen 85-A; alpha/beta hydrolase, structural genomics, PSI, protein structure initiative, TB structural genomics consortium, TBSGC; 2.70A {Mycobacterium tuberculosis} SCOP: c.69.1.3 Back     alignment and structure
>1mpx_A Alpha-amino acid ester hydrolase; alpha/beta hydrolase, jellyroll, selenomethionine; 1.90A {Xanthomonas citri} SCOP: b.18.1.13 c.69.1.21 Back     alignment and structure
>1r88_A MPT51/MPB51 antigen; ALFA/beta hydrolase fold, FBPC1, immune system; 1.71A {Mycobacterium tuberculosis} SCOP: c.69.1.3 Back     alignment and structure
>3c8d_A Enterochelin esterase; alpha-beta-alpha sandwich, IROD, iron aquisition, structural genomics, PSI-2, protein structure initiative; HET: CIT; 1.80A {Shigella flexneri 2a str} SCOP: b.1.18.20 c.69.1.2 PDB: 2b20_A 3c87_A* 3c8h_A 3mga_A* Back     alignment and structure
>2gzs_A IROE protein; enterobactin, salmochelin, DFP, hydrolase, catalytic DYAD; HET: DFP; 1.40A {Escherichia coli} SCOP: c.69.1.38 PDB: 2gzr_A* Back     alignment and structure
>1dqz_A 85C, protein (antigen 85-C); fibronectin, structural genomics, PSI, protein structure initiative, TB structural genomics consortium; 1.50A {Mycobacterium tuberculosis} SCOP: c.69.1.3 PDB: 3hrh_A 1dqy_A 1va5_A* 1f0n_A* 1f0p_A* Back     alignment and structure
>3pic_A CIP2; alpha/beta hydrolase fold, glucuronoyl esterase, carbohydrat esterase family 15 (CE-15), N-linked glycosylation, secrete hydrolase; HET: NAG; 1.90A {Hypocrea jecorina} Back     alignment and structure
>4g4g_A 4-O-methyl-glucuronoyl methylesterase; alpha/beta hydrolase, 3-layer alpha/beta/alpha sandwich, ROS fold, glucuronoyl esterase; 1.55A {Myceliophthora thermophila} PDB: 4g4i_A 4g4j_A* Back     alignment and structure
>1gkl_A Endo-1,4-beta-xylanase Y; hydrolase, esterase family 1, inactive mutant; HET: FER; 1.4A {Clostridium thermocellum} SCOP: c.69.1.2 PDB: 1wb4_A* 1wb5_A* 1wb6_A* 1gkk_A* Back     alignment and structure
>3iii_A COCE/NOND family hydrolase; structural genomics, center for structural genomi infectious diseases, csgid; HET: MSE PLM; 1.95A {Staphylococcus aureus subsp} PDB: 3ib3_A* Back     alignment and structure
>2vz8_A Fatty acid synthase; transferase, phosphopantetheine, multienzyme, megasynthase, fatty acid synthesis; 3.2A {Sus scrofa} PDB: 2vz9_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 73
d2rhwa1283 c.69.1.10 (A:4-286) 2-hydroxy-6-oxo-6-phenylhexa-2 9e-17
d1zd3a2322 c.69.1.11 (A:225-547) Mammalian epoxide hydrolase, 4e-16
d1uk8a_271 c.69.1.10 (A:) Meta-cleavage product hydrolase Cum 2e-15
d1q0ra_297 c.69.1.28 (A:) Aclacinomycin methylesterase RdmC { 3e-15
d1j1ia_268 c.69.1.10 (A:) Meta cleavage compound hydrolase Ca 5e-15
d1bn7a_291 c.69.1.8 (A:) Haloalkane dehalogenase {Rhodococcus 1e-14
d1c4xa_281 c.69.1.10 (A:) 2-hydroxy-6-oxo-6-phenylhexa-2,4-di 2e-14
d1mtza_290 c.69.1.7 (A:) Tricorn interacting factor F1 {Archa 8e-14
d1a8sa_273 c.69.1.12 (A:) Chloroperoxidase F {Pseudomonas flu 6e-13
d1xkla_258 c.69.1.20 (A:) Salicylic acid-binding protein 2 (S 2e-12
d1b6ga_310 c.69.1.8 (A:) Haloalkane dehalogenase {Xanthobacte 3e-12
d1k8qa_377 c.69.1.6 (A:) Gastric lipase {Dog (Canis familiari 4e-12
d1r3da_264 c.69.1.35 (A:) Hypothetical protein VC1974 {Vibrio 4e-12
d1ehya_293 c.69.1.11 (A:) Bacterial epoxide hydrolase {Agroba 4e-12
d1hkha_279 c.69.1.12 (A:) Gamma-lactamase {Aureobacterium sp. 4e-12
d3c70a1256 c.69.1.20 (A:2-257) Hydroxynitrile lyase {Rubber t 4e-12
d1brta_277 c.69.1.12 (A:) Bromoperoxidase A2 {Streptomyces au 5e-12
d1va4a_271 c.69.1.12 (A:) Arylesterase {Pseudomonas fluoresce 1e-11
d1a88a_275 c.69.1.12 (A:) Chloroperoxidase L {Streptomyces li 1e-11
d1m33a_256 c.69.1.26 (A:) Biotin biosynthesis protein BioH {E 1e-11
d1wm1a_313 c.69.1.7 (A:) Proline aminopeptidase {Serratia mar 3e-11
d1azwa_313 c.69.1.7 (A:) Proline iminopeptidase {Xanthomonas 4e-11
d1mj5a_298 c.69.1.8 (A:) Haloalkane dehalogenase {Sphingomona 6e-11
d1imja_208 c.69.1.23 (A:) Ccg1/TafII250-interacting factor B 2e-10
d1qo7a_394 c.69.1.11 (A:) Bacterial epoxide hydrolase {Asperg 2e-10
d1a8qa_274 c.69.1.12 (A:) Bromoperoxidase A1 {Streptomyces au 4e-09
d1qlwa_318 c.69.1.15 (A:) A novel bacterial esterase {Alcalig 7e-08
d1pjaa_268 c.69.1.13 (A:) Palmitoyl protein thioesterase 2 {H 1e-07
d1tqha_242 c.69.1.29 (A:) Carboxylesterase Est {Bacillus stea 6e-07
d2h7xa1283 c.69.1.22 (A:9-291) Picromycin polyketide synthase 2e-04
d1uxoa_186 c.69.1.31 (A:) Hypothetical protein YdeN {Bacillus 3e-04
d1l7aa_318 c.69.1.25 (A:) Cephalosporin C deacetylase {Bacill 0.001
d2jbwa1360 c.69.1.41 (A:8-367) 2,6-dihydropseudooxynicotine h 0.002
>d2rhwa1 c.69.1.10 (A:4-286) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) {Burkholderia xenovorans [TaxId: 36873]} Length = 283 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: alpha/beta-Hydrolases
superfamily: alpha/beta-Hydrolases
family: Carbon-carbon bond hydrolase
domain: 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD)
species: Burkholderia xenovorans [TaxId: 36873]
 Score = 69.5 bits (168), Expect = 9e-17
 Identities = 16/61 (26%), Positives = 30/61 (49%)

Query: 1   VKQKTLIIWGEDDQIISSKLAVRLHCELPNAIIRQIPDCGHLPHVEKPGAVAKLIVEFIQ 60
           +K KT I WG DD+ +     ++L   + +A +     CGH    E      +L+++F++
Sbjct: 222 IKAKTFITWGRDDRFVPLDHGLKLLWNIDDARLHVFSKCGHWAQWEHADEFNRLVIDFLR 281

Query: 61  E 61
            
Sbjct: 282 H 282


>d1zd3a2 c.69.1.11 (A:225-547) Mammalian epoxide hydrolase, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 322 Back     information, alignment and structure
>d1uk8a_ c.69.1.10 (A:) Meta-cleavage product hydrolase CumD {Pseudomonas fluorescens [TaxId: 294]} Length = 271 Back     information, alignment and structure
>d1q0ra_ c.69.1.28 (A:) Aclacinomycin methylesterase RdmC {Streptomyces purpurascens [TaxId: 1924]} Length = 297 Back     information, alignment and structure
>d1j1ia_ c.69.1.10 (A:) Meta cleavage compound hydrolase CarC {Janthinobacterium sp. J3 [TaxId: 213804]} Length = 268 Back     information, alignment and structure
>d1bn7a_ c.69.1.8 (A:) Haloalkane dehalogenase {Rhodococcus sp. [TaxId: 1831]} Length = 291 Back     information, alignment and structure
>d1c4xa_ c.69.1.10 (A:) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) {Rhodococcus sp., strain rha1 [TaxId: 1831]} Length = 281 Back     information, alignment and structure
>d1mtza_ c.69.1.7 (A:) Tricorn interacting factor F1 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 290 Back     information, alignment and structure
>d1a8sa_ c.69.1.12 (A:) Chloroperoxidase F {Pseudomonas fluorescens [TaxId: 294]} Length = 273 Back     information, alignment and structure
>d1xkla_ c.69.1.20 (A:) Salicylic acid-binding protein 2 (SABP2) {Common tobacco (Nicotiana tabacum) [TaxId: 4097]} Length = 258 Back     information, alignment and structure
>d1b6ga_ c.69.1.8 (A:) Haloalkane dehalogenase {Xanthobacter autotrophicus [TaxId: 280]} Length = 310 Back     information, alignment and structure
>d1k8qa_ c.69.1.6 (A:) Gastric lipase {Dog (Canis familiaris) [TaxId: 9615]} Length = 377 Back     information, alignment and structure
>d1r3da_ c.69.1.35 (A:) Hypothetical protein VC1974 {Vibrio cholerae [TaxId: 666]} Length = 264 Back     information, alignment and structure
>d1ehya_ c.69.1.11 (A:) Bacterial epoxide hydrolase {Agrobacterium radiobacter [TaxId: 358]} Length = 293 Back     information, alignment and structure
>d1hkha_ c.69.1.12 (A:) Gamma-lactamase {Aureobacterium sp. [TaxId: 51671]} Length = 279 Back     information, alignment and structure
>d3c70a1 c.69.1.20 (A:2-257) Hydroxynitrile lyase {Rubber tree (Hevea brasiliensis) [TaxId: 3981]} Length = 256 Back     information, alignment and structure
>d1brta_ c.69.1.12 (A:) Bromoperoxidase A2 {Streptomyces aureofaciens [TaxId: 1894]} Length = 277 Back     information, alignment and structure
>d1va4a_ c.69.1.12 (A:) Arylesterase {Pseudomonas fluorescens [TaxId: 294]} Length = 271 Back     information, alignment and structure
>d1a88a_ c.69.1.12 (A:) Chloroperoxidase L {Streptomyces lividans [TaxId: 1916]} Length = 275 Back     information, alignment and structure
>d1m33a_ c.69.1.26 (A:) Biotin biosynthesis protein BioH {Escherichia coli [TaxId: 562]} Length = 256 Back     information, alignment and structure
>d1wm1a_ c.69.1.7 (A:) Proline aminopeptidase {Serratia marcescens [TaxId: 615]} Length = 313 Back     information, alignment and structure
>d1azwa_ c.69.1.7 (A:) Proline iminopeptidase {Xanthomonas campestris, pv. citri [TaxId: 339]} Length = 313 Back     information, alignment and structure
>d1mj5a_ c.69.1.8 (A:) Haloalkane dehalogenase {Sphingomonas paucimobilis, UT26, LinB [TaxId: 13689]} Length = 298 Back     information, alignment and structure
>d1imja_ c.69.1.23 (A:) Ccg1/TafII250-interacting factor B (Cib) {Human (Homo sapiens) [TaxId: 9606]} Length = 208 Back     information, alignment and structure
>d1qo7a_ c.69.1.11 (A:) Bacterial epoxide hydrolase {Aspergillus niger [TaxId: 5061]} Length = 394 Back     information, alignment and structure
>d1a8qa_ c.69.1.12 (A:) Bromoperoxidase A1 {Streptomyces aureofaciens [TaxId: 1894]} Length = 274 Back     information, alignment and structure
>d1qlwa_ c.69.1.15 (A:) A novel bacterial esterase {Alcaligenes sp. [TaxId: 512]} Length = 318 Back     information, alignment and structure
>d1pjaa_ c.69.1.13 (A:) Palmitoyl protein thioesterase 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 268 Back     information, alignment and structure
>d1tqha_ c.69.1.29 (A:) Carboxylesterase Est {Bacillus stearothermophilus [TaxId: 1422]} Length = 242 Back     information, alignment and structure
>d2h7xa1 c.69.1.22 (A:9-291) Picromycin polyketide synthase {Streptomyces venezuelae [TaxId: 54571]} Length = 283 Back     information, alignment and structure
>d1uxoa_ c.69.1.31 (A:) Hypothetical protein YdeN {Bacillus subtilis [TaxId: 1423]} Length = 186 Back     information, alignment and structure
>d1l7aa_ c.69.1.25 (A:) Cephalosporin C deacetylase {Bacillus subtilis [TaxId: 1423]} Length = 318 Back     information, alignment and structure
>d2jbwa1 c.69.1.41 (A:8-367) 2,6-dihydropseudooxynicotine hydrolase {Arthrobacter nicotinovorans [TaxId: 29320]} Length = 360 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query73
d1uk8a_271 Meta-cleavage product hydrolase CumD {Pseudomonas 99.64
d1j1ia_268 Meta cleavage compound hydrolase CarC {Janthinobac 99.64
d1c4xa_281 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolas 99.63
d1m33a_256 Biotin biosynthesis protein BioH {Escherichia coli 99.63
d1xkla_258 Salicylic acid-binding protein 2 (SABP2) {Common t 99.62
d1q0ra_297 Aclacinomycin methylesterase RdmC {Streptomyces pu 99.62
d2rhwa1283 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolas 99.62
d1zd3a2322 Mammalian epoxide hydrolase, C-terminal domain {Hu 99.62
d1bn7a_291 Haloalkane dehalogenase {Rhodococcus sp. [TaxId: 1 99.61
d3c70a1256 Hydroxynitrile lyase {Rubber tree (Hevea brasilien 99.61
d1mtza_290 Tricorn interacting factor F1 {Archaeon Thermoplas 99.56
d1a8sa_273 Chloroperoxidase F {Pseudomonas fluorescens [TaxId 99.55
d1brta_277 Bromoperoxidase A2 {Streptomyces aureofaciens [Tax 99.54
d1va4a_271 Arylesterase {Pseudomonas fluorescens [TaxId: 294] 99.52
d1a88a_275 Chloroperoxidase L {Streptomyces lividans [TaxId: 99.52
d1ehya_293 Bacterial epoxide hydrolase {Agrobacterium radioba 99.51
d1hkha_279 Gamma-lactamase {Aureobacterium sp. [TaxId: 51671] 99.51
d1a8qa_274 Bromoperoxidase A1 {Streptomyces aureofaciens [Tax 99.5
d1b6ga_310 Haloalkane dehalogenase {Xanthobacter autotrophicu 99.49
d1tqha_242 Carboxylesterase Est {Bacillus stearothermophilus 99.47
d1imja_208 Ccg1/TafII250-interacting factor B (Cib) {Human (H 99.42
d1wm1a_313 Proline aminopeptidase {Serratia marcescens [TaxId 99.38
d1azwa_313 Proline iminopeptidase {Xanthomonas campestris, pv 99.36
d1mj5a_298 Haloalkane dehalogenase {Sphingomonas paucimobilis 99.3
d1r3da_264 Hypothetical protein VC1974 {Vibrio cholerae [TaxI 99.25
d1k8qa_377 Gastric lipase {Dog (Canis familiaris) [TaxId: 961 99.23
d2fuka1218 XC6422 protein {Xanthomonas campestris [TaxId: 339 99.19
d1qo7a_394 Bacterial epoxide hydrolase {Aspergillus niger [Ta 99.18
d1l7aa_318 Cephalosporin C deacetylase {Bacillus subtilis [Ta 99.16
d1qlwa_318 A novel bacterial esterase {Alcaligenes sp. [TaxId 99.1
d1uxoa_186 Hypothetical protein YdeN {Bacillus subtilis [TaxI 99.06
d2hu7a2260 Acylamino-acid-releasing enzyme, C-terminal donain 98.88
d1jmkc_230 Surfactin synthetase, SrfA {Bacillus subtilis [Tax 98.85
d2vata1376 Acetyl-CoA:deacetylcephalosporin C acetyltransfera 98.82
d1dina_233 Dienelactone hydrolase {Pseudomonas sp., B13 [TaxI 98.79
d2jbwa1360 2,6-dihydropseudooxynicotine hydrolase {Arthrobact 98.78
d1vlqa_322 Acetyl xylan esterase TM0077 {Thermotoga maritima 98.78
d1thta_302 Myristoyl-ACP-specific thioesterase {Vibrio harvey 98.77
d2h7xa1283 Picromycin polyketide synthase {Streptomyces venez 98.76
d2i3da1218 Hypothetical protein Atu1826 {Agrobacterium tumefa 98.72
d2bgra2258 Dipeptidyl peptidase IV/CD26, C-terminal domain {P 98.69
d1ufoa_238 Hypothetical protein TT1662 {Thermus thermophilus 98.68
d1xfda2258 Dipeptidyl aminopeptidase-like protein 6, DPP6, C- 98.57
d1jfra_260 Lipase {Streptomyces exfoliatus [TaxId: 1905]} 98.54
g1wht.1409 Serine carboxypeptidase II {Wheat (Triticum vulgar 98.53
d1qfma2280 Prolyl oligopeptidase, C-terminal domain {Pig (Sus 98.51
d1pjaa_268 Palmitoyl protein thioesterase 2 {Human (Homo sapi 98.49
d2pl5a1362 Homoserine O-acetyltransferase {Leptospira interro 98.43
d1ivya_452 Human 'protective protein', HPP {Human (Homo sapie 98.4
d1wpxa1421 Serine carboxypeptidase II {Baker's yeast (Sacchar 98.39
d2b61a1357 Homoserine O-acetyltransferase {Haemophilus influe 98.38
g1gxs.1425 Hydroxynitrile lyase {Sorghum (Sorghum bicolor) [T 98.37
d1ac5a_483 Serine carboxypeptidase II {Baker's yeast (Sacchar 98.35
d1fj2a_229 Acyl protein thioesterase 1 {Human (Homo sapiens) 98.23
d1vkha_263 Putative serine hydrolase Ydr428c {Baker's yeast ( 98.2
d2h1ia1202 Carboxylesterase {Bacillus cereus [TaxId: 1396]} 98.19
d2r8ba1203 Uncharacterized protein Atu2452 {Agrobacterium tum 98.14
d1xkta_286 Fatty acid synthase {Human (Homo sapiens) [TaxId: 97.98
d1auoa_218 Carboxylesterase {Pseudomonas fluorescens [TaxId: 97.98
d1ispa_179 Lipase A {Bacillus subtilis [TaxId: 1423]} 97.82
d3b5ea1209 Uncharacterized protein Mll8374 {Mesorhizobium lot 97.66
d1mo2a_255 Erythromycin polyketide synthase {Saccharopolyspor 97.65
d1u4na_308 Carboxylesterase {Alicyclobacillus acidocaldarius 97.58
d1lzla_317 Heroin esterase {Rhodococcus sp. [TaxId: 1831]} 97.56
d1jkma_358 Carboxylesterase {Bacillus subtilis, brefeldin A e 97.38
d1jjia_311 Carboxylesterase {Archaeon Archaeoglobus fulgidus 97.31
d2pbla1261 Uncharacterized protein TM1040_2492 {Silicibacter 97.24
d2d81a1 318 Polyhydroxybutyrate depolymerase {Penicillium funi 97.22
d1jjfa_255 Feruloyl esterase domain of the cellulosomal xylan 96.92
d1lnsa3405 X-Prolyl dipeptidyl aminopeptidase PepX, middle do 96.58
d2gzsa1265 Enterobactin and salmochelin hydrolase IroE {Esche 94.24
d3c8da2246 Enterochelin esterase, catalytic domain {Shigella 94.21
d1ju3a2347 Bacterial cocaine esterase N-terminal domain {Rhod 92.82
d1mpxa2381 Alpha-amino acid ester hydrolase {Xanthomonas citr 88.66
>d1uk8a_ c.69.1.10 (A:) Meta-cleavage product hydrolase CumD {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: alpha/beta-Hydrolases
superfamily: alpha/beta-Hydrolases
family: Carbon-carbon bond hydrolase
domain: Meta-cleavage product hydrolase CumD
species: Pseudomonas fluorescens [TaxId: 294]
Probab=99.64  E-value=3.4e-16  Score=83.06  Aligned_cols=61  Identities=31%  Similarity=0.580  Sum_probs=58.1

Q ss_pred             CCccEEEEEcCCCcccCHHHHHHHHhhCCCcEEEEeCCCCccCCccChHHHHHHHHHHHhh
Q 037210            1 VKQKTLIIWGEDDQIISSKLAVRLHCELPNAIIRQIPDCGHLPHVEKPGAVAKLIVEFIQE   61 (73)
Q Consensus         1 i~~p~l~i~g~~d~~~~~~~~~~~~~~~~~~~~~~~~~~~H~~~~~~~~~~~~~~~~~~~~   61 (73)
                      +++|+++++|++|..++.+..+.+.+.+++.++..++++||+++.++|+++++.+.+||++
T Consensus       210 i~~P~lii~G~~D~~~~~~~~~~~~~~~~~~~~~~~~~~gH~~~~e~p~~~~~~i~~Fl~e  270 (271)
T d1uk8a_         210 LPNETLIIHGREDQVVPLSSSLRLGELIDRAQLHVFGRCGHWTQIEQTDRFNRLVVEFFNE  270 (271)
T ss_dssp             CCSCEEEEEETTCSSSCHHHHHHHHHHCTTEEEEEESSCCSCHHHHTHHHHHHHHHHHHHT
T ss_pred             hccceeEEecCCCCCcCHHHHHHHHHhCCCCEEEEECCCCCchHHHCHHHHHHHHHHHHhc
Confidence            5799999999999999999999999999999999999999999999999999999999975



>d1j1ia_ c.69.1.10 (A:) Meta cleavage compound hydrolase CarC {Janthinobacterium sp. J3 [TaxId: 213804]} Back     information, alignment and structure
>d1c4xa_ c.69.1.10 (A:) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) {Rhodococcus sp., strain rha1 [TaxId: 1831]} Back     information, alignment and structure
>d1m33a_ c.69.1.26 (A:) Biotin biosynthesis protein BioH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xkla_ c.69.1.20 (A:) Salicylic acid-binding protein 2 (SABP2) {Common tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1q0ra_ c.69.1.28 (A:) Aclacinomycin methylesterase RdmC {Streptomyces purpurascens [TaxId: 1924]} Back     information, alignment and structure
>d2rhwa1 c.69.1.10 (A:4-286) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) {Burkholderia xenovorans [TaxId: 36873]} Back     information, alignment and structure
>d1zd3a2 c.69.1.11 (A:225-547) Mammalian epoxide hydrolase, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bn7a_ c.69.1.8 (A:) Haloalkane dehalogenase {Rhodococcus sp. [TaxId: 1831]} Back     information, alignment and structure
>d3c70a1 c.69.1.20 (A:2-257) Hydroxynitrile lyase {Rubber tree (Hevea brasiliensis) [TaxId: 3981]} Back     information, alignment and structure
>d1mtza_ c.69.1.7 (A:) Tricorn interacting factor F1 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1a8sa_ c.69.1.12 (A:) Chloroperoxidase F {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1brta_ c.69.1.12 (A:) Bromoperoxidase A2 {Streptomyces aureofaciens [TaxId: 1894]} Back     information, alignment and structure
>d1va4a_ c.69.1.12 (A:) Arylesterase {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1a88a_ c.69.1.12 (A:) Chloroperoxidase L {Streptomyces lividans [TaxId: 1916]} Back     information, alignment and structure
>d1ehya_ c.69.1.11 (A:) Bacterial epoxide hydrolase {Agrobacterium radiobacter [TaxId: 358]} Back     information, alignment and structure
>d1hkha_ c.69.1.12 (A:) Gamma-lactamase {Aureobacterium sp. [TaxId: 51671]} Back     information, alignment and structure
>d1a8qa_ c.69.1.12 (A:) Bromoperoxidase A1 {Streptomyces aureofaciens [TaxId: 1894]} Back     information, alignment and structure
>d1b6ga_ c.69.1.8 (A:) Haloalkane dehalogenase {Xanthobacter autotrophicus [TaxId: 280]} Back     information, alignment and structure
>d1tqha_ c.69.1.29 (A:) Carboxylesterase Est {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1imja_ c.69.1.23 (A:) Ccg1/TafII250-interacting factor B (Cib) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wm1a_ c.69.1.7 (A:) Proline aminopeptidase {Serratia marcescens [TaxId: 615]} Back     information, alignment and structure
>d1azwa_ c.69.1.7 (A:) Proline iminopeptidase {Xanthomonas campestris, pv. citri [TaxId: 339]} Back     information, alignment and structure
>d1mj5a_ c.69.1.8 (A:) Haloalkane dehalogenase {Sphingomonas paucimobilis, UT26, LinB [TaxId: 13689]} Back     information, alignment and structure
>d1r3da_ c.69.1.35 (A:) Hypothetical protein VC1974 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1k8qa_ c.69.1.6 (A:) Gastric lipase {Dog (Canis familiaris) [TaxId: 9615]} Back     information, alignment and structure
>d2fuka1 c.69.1.36 (A:3-220) XC6422 protein {Xanthomonas campestris [TaxId: 339]} Back     information, alignment and structure
>d1qo7a_ c.69.1.11 (A:) Bacterial epoxide hydrolase {Aspergillus niger [TaxId: 5061]} Back     information, alignment and structure
>d1l7aa_ c.69.1.25 (A:) Cephalosporin C deacetylase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1qlwa_ c.69.1.15 (A:) A novel bacterial esterase {Alcaligenes sp. [TaxId: 512]} Back     information, alignment and structure
>d1uxoa_ c.69.1.31 (A:) Hypothetical protein YdeN {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2hu7a2 c.69.1.33 (A:322-581) Acylamino-acid-releasing enzyme, C-terminal donain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1jmkc_ c.69.1.22 (C:) Surfactin synthetase, SrfA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2vata1 c.69.1.40 (A:7-382) Acetyl-CoA:deacetylcephalosporin C acetyltransferase CefG {Acremonium chrysogenum [TaxId: 5044]} Back     information, alignment and structure
>d1dina_ c.69.1.9 (A:) Dienelactone hydrolase {Pseudomonas sp., B13 [TaxId: 306]} Back     information, alignment and structure
>d2jbwa1 c.69.1.41 (A:8-367) 2,6-dihydropseudooxynicotine hydrolase {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d1vlqa_ c.69.1.25 (A:) Acetyl xylan esterase TM0077 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1thta_ c.69.1.13 (A:) Myristoyl-ACP-specific thioesterase {Vibrio harveyi [TaxId: 669]} Back     information, alignment and structure
>d2h7xa1 c.69.1.22 (A:9-291) Picromycin polyketide synthase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d2i3da1 c.69.1.36 (A:2-219) Hypothetical protein Atu1826 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2bgra2 c.69.1.24 (A:509-766) Dipeptidyl peptidase IV/CD26, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1ufoa_ c.69.1.27 (A:) Hypothetical protein TT1662 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1xfda2 c.69.1.24 (A:592-849) Dipeptidyl aminopeptidase-like protein 6, DPP6, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jfra_ c.69.1.16 (A:) Lipase {Streptomyces exfoliatus [TaxId: 1905]} Back     information, alignment and structure
>d1qfma2 c.69.1.4 (A:431-710) Prolyl oligopeptidase, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1pjaa_ c.69.1.13 (A:) Palmitoyl protein thioesterase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2pl5a1 c.69.1.40 (A:5-366) Homoserine O-acetyltransferase {Leptospira interrogans [TaxId: 173]} Back     information, alignment and structure
>d1ivya_ c.69.1.5 (A:) Human 'protective protein', HPP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wpxa1 c.69.1.5 (A:1-421) Serine carboxypeptidase II {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2b61a1 c.69.1.40 (A:2-358) Homoserine O-acetyltransferase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1ac5a_ c.69.1.5 (A:) Serine carboxypeptidase II {Baker's yeast (Saccharomyces cerevisiae), kex1(delta)p [TaxId: 4932]} Back     information, alignment and structure
>d1fj2a_ c.69.1.14 (A:) Acyl protein thioesterase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vkha_ c.69.1.32 (A:) Putative serine hydrolase Ydr428c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2h1ia1 c.69.1.14 (A:1-202) Carboxylesterase {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d2r8ba1 c.69.1.14 (A:44-246) Uncharacterized protein Atu2452 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1xkta_ c.69.1.22 (A:) Fatty acid synthase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1auoa_ c.69.1.14 (A:) Carboxylesterase {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1ispa_ c.69.1.18 (A:) Lipase A {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d3b5ea1 c.69.1.14 (A:7-215) Uncharacterized protein Mll8374 {Mesorhizobium loti [TaxId: 381]} Back     information, alignment and structure
>d1mo2a_ c.69.1.22 (A:) Erythromycin polyketide synthase {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1u4na_ c.69.1.2 (A:) Carboxylesterase {Alicyclobacillus acidocaldarius [TaxId: 405212]} Back     information, alignment and structure
>d1lzla_ c.69.1.2 (A:) Heroin esterase {Rhodococcus sp. [TaxId: 1831]} Back     information, alignment and structure
>d1jkma_ c.69.1.2 (A:) Carboxylesterase {Bacillus subtilis, brefeldin A esterase [TaxId: 1423]} Back     information, alignment and structure
>d1jjia_ c.69.1.2 (A:) Carboxylesterase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2pbla1 c.69.1.2 (A:1-261) Uncharacterized protein TM1040_2492 {Silicibacter sp. tm1040 [TaxId: 292414]} Back     information, alignment and structure
>d2d81a1 c.69.1.37 (A:21-338) Polyhydroxybutyrate depolymerase {Penicillium funiculosum [TaxId: 28572]} Back     information, alignment and structure
>d1jjfa_ c.69.1.2 (A:) Feruloyl esterase domain of the cellulosomal xylanase z {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1lnsa3 c.69.1.21 (A:146-550) X-Prolyl dipeptidyl aminopeptidase PepX, middle domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d2gzsa1 c.69.1.38 (A:41-305) Enterobactin and salmochelin hydrolase IroE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3c8da2 c.69.1.2 (A:151-396) Enterochelin esterase, catalytic domain {Shigella flexneri 2a str. 2457T [TaxId: 198215]} Back     information, alignment and structure
>d1ju3a2 c.69.1.21 (A:5-351) Bacterial cocaine esterase N-terminal domain {Rhodococcus sp. mb1 [TaxId: 51612]} Back     information, alignment and structure
>d1mpxa2 c.69.1.21 (A:24-404) Alpha-amino acid ester hydrolase {Xanthomonas citri [TaxId: 346]} Back     information, alignment and structure