Citrus Sinensis ID: 037229

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------

MVRVLVDLKVEGAFDVVAERTPGAAVDGRPSDLTVGLESTFDQVWSCLVEEEQVGIIGLYGMEGWIQEQIRRKLGLVDDLWARKGLEEKAMNIFGILSKEFVLCWMMCGSELILTQMGVPVPNPKRMSKVLFTTRFVEVYGHKEADEMFRMECLRHEEAWKLFQMKVGKETMDDHSDIPKLVEIVTKECGGLPLVLVTTARAMAYKKTIFGLARGILTQMIHTSGAHNERYYNIGVLRKEEDGEGSVTLHDVIRDMALWIAYELAEEEENFWFMQEGTRRVSLKENKIGDLWETPTSPQLLTLFLNINPLSMIGGDLFQFKPCLKVLNLSNSPCLEKLPSRISRLVSLQHLDLSSSGILELPKELGFLGNLACLNLENTSSHGTITRQLRSNFSKPQVLRMFRFYGKAQYMKADSLPFGGSEFLVEQLCCLKHLNVFSITLKSSYALQKPNSEHTRSLEVLPLAEMRQLDKLHIAFCTRLQEFEIECPGRNLMDLTWLIFAPNFRKIDINQSSHMEEIICIDRLRKVSGGYKKILKRIYPDVLPLKNLKGITVSSCPNLKRLPLNSNSDQSRGLKLV

cHHHHHHHHHcccccEEcccccccccccccccccccHHHHHHHHHHHHHcccccEEEEEEEccHHHHHHHHHHHcccccHHccccHHHHHHHHHHHccccEEEEEEccccHHHHccccccccccccccEEEEEEccHHHHHcccccccEEcccccHHHHHHHHHHHcccccccccccHHHHHHHHHHHHccccHHHHHHHHHHHccHHHHHHHHHHHHHHHcccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEcccccccccccccccccccEEEEcccccccccccccccccccEEEEcccccccccccccccccccccEEEccccccccccHHHHccccccEEEccccccccccccHHccccccccEEEcccccccccccccccccccccHHHHHHHHccccccEEEEEEcccccccccccccccccEEEcccccccccEEEEccccccEEEEEEcccccccccccccccccccEEEEEccccccEEcccccccEEEcccccccccccccccccccccEEEEEccccccccccccccccccccEEc

cHHHHHHHHccccccEEcccccccccccccccccccHHHHHHHHHHHHHHcccccEEEEEEEHHHHHHHHHHHHccccHHcccccHHHHHHHHHHHHHHHHEEEHHHHHccccHHHccccccccccccEEEEEEccHHHHHHccccccEEEEcccHHHHHHHHHHHHcHHHHcccccHHHHHHHHHHHccccHHHHHHHHHHHcccccHHHHHHHHHHHHccHHHcccccHHHHHHHHHHHcccccHHHHHHHHHHEccccccccccHHHHEHHcccHHHHHHHHHHHHHHcccccHHHHHHHHHcccccccccHHHHHHccccEEEEcccccccccccHHHHHccccEEEEccccccHcccHHHHHHcccEEEEccccccHccccHHHHHHHHHccEEEEEccccccccccccHHHHHHHHHHHHHHHHHHHHHHccccHHcHHHHHHHHcccccccEEEcccccccccEEEEcccccccEEEEccccccccccHHHHccccccEEEEEccHHHHHHccHHHccEEEEcccccccccccccccccccEEEEEEccccccccccccccccccEEEEc

MVRVLVDLKVEGAFdvvaertpgaavdgrpsdltvglESTFDQVWSCLVEEEQVGIIGLYGMEGWIQEQIRRKLGLVDDLWARKGLEEKAMNIFGILSKEFVLCWMMCGSEliltqmgvpvpnpkrmskVLFTTRFVEVYGHKEADEMFRMECLRHEEAWKLFQMKVGketmddhsdipkLVEIVTKECGGLPLVLVTTARAMAYKKTIFGLARGILTQMIhtsgahneryynigvlrkeedgegsvtLHDVIRDMALWIAYELAEEEEnfwfmqegtrrvslkenkigdlwetptspqlltlflninplsmiggdlfqfkpclkvlnlsnspcleklpsRISRLVSLqhldlsssgilelpkelgflgnlaclnlentsshgtitrqlrsnfskpqVLRMFRFYGkaqymkadslpfggseFLVEQLCCLKHLNVFSITLKSsyalqkpnsehtrslevlplaeMRQLDKLHIAFCTRLQefeiecpgrnlmdLTWLifapnfrkidinqsshmEEIICIDRLRKVSGGYKKILKRiypdvlplknlkgitvsscpnlkrlplnsnsdqsrglklv

mvrvlvdlkvegafdvvaertpgaavdgrpsdLTVGLESTFDQVWSCLVEEEQVGIIGLYGMEGWIQEQIRRKLGLVDDLWARKGLEEKAMNIFGILSKEFVLCWMMCGSELILTQMGVPVPNPKRMSKVLFTTRFVEVYGHKEADEMFRMECLRHEEAWKLFQMKVGKETMDDHSDIPKLVEIVTKECGGLPLVLVTTARAMAYKKTIFGLARGILTQMIHTSGAHNERYYNIGVLRKEEDGEGSVTLHDVIRDMALWIAYELAEEEENFWFMQEGTRRVSLKENKIGDLWETPTSPQLLTLFLNINPLSMIGGDLFQFKPCLKVLNLSNSPCLEKLPSRISRLVSLQHLDLSSSGILELPKELGFLGNLACLNLENTSshgtitrqlrsnfskpqvLRMFRFYGKAQYMKADSLPFGGSEFLVEQLCCLKHLNVFSITLKSsyalqkpnsehTRSLEVLPLAEMRQLDKLHIAFCTRLQEFEIECPGRNLMDLTWLIFAPNFRKIDINQSSHMEEIICIDRLRKVSGGYKKILKriypdvlplknlkgitvsscpnlkrlplnsnsdqsrglklv

***VLVDLKVEGAFDVVAERTPGAAVDGRPSDLTVGLESTFDQVWSCLVEEEQVGIIGLYGMEGWIQEQIRRKLGLVDDLWARKGLEEKAMNIFGILSKEFVLCWMMCGSELILTQMGVPVPNPKRMSKVLFTTRFVEVYGHKEADEMFRMECLRHEEAWKLFQMKVGKETMDDHSDIPKLVEIVTKECGGLPLVLVTTARAMAYKKTIFGLARGILTQMIHTSGAHNERYYNIGVLRKEEDGEGSVTLHDVIRDMALWIAYELAEEEENFWFMQEGTRRVSLKENKIGDLWETPTSPQLLTLFLNINPLSMIGGDLFQFKPCLKVLNLSNSPCLEKLPSRISRLVSLQHLDLSSSGILELPKELGFLGNLACLNLENTSSHGTITRQLRSNFSKPQVLRMFRFYGKAQYMKADSLPFGGSEFLVEQLCCLKHLNVFSITLKSSYAL**********LEVLPLAEMRQLDKLHIAFCTRLQEFEIECPGRNLMDLTWLIFAPNFRKIDINQSSHMEEIICIDRLRKVSGGYKKILKRIYPDVLPLKNLKGITVSSCP********************

*VRVLVDLKVEGAFDVVAE*T************TVGLESTFDQVWSCLVEEEQVGIIGLYGMEGWIQEQIRRKLGLVDDLWA******KAMNIFGILSKEFVLCWMMCGSELILTQMGVPVPNPKRMSKVLFTTRFVEVYGHKEADEMFRMECLRHEEAWKLFQMKVGKETMDDHSDIPKLVEIVTKECGGLPLVLVTTARAMAYKKTIFGLARGILTQMIHTSGAHNERYYNIGVLRKEEDGEGSVTLHDVIRDMALWIAYELAEEEENFWFMQEGTRRVSLKENKIGDLWETPTSPQLLTLFLNINPLSMIGGDLFQFKPCLKVLNLSNSPCLEKLPSRISRLVSLQHLDLSSSGILELPKELGFLGNLACLNLENTSSHGTITRQLRSNFSKPQVLRMFRFYGKAQYMKADSLPFGGSEFLVEQLCCLKHLNVFSITLKSSYALQKPNSEHTRSLEVLPLAEMRQLDKLHIAFCTRLQEFEIECPGRNLMDLTWLIFAPNFRKIDINQSSHMEEIICIDRLRKVSGGYKKILKRIYPDVLPLKNLKGITVSSCPNLKRLPLNSNSDQ*RGLKLV

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		577	2.2.26 [Sep-21-2011]
O23317		719	Probable disease resistan	yes	no	0.873	0.700	0.282	5e-49
Q9FLB4		874	Putative disease resistan	yes	no	0.942	0.622	0.270	3e-45
Q9LVT4		843	Probable disease resistan	no	no	0.915	0.626	0.268	5e-37
Q8RXS5		888	Probable disease resistan	no	no	0.568	0.369	0.309	2e-30
Q9C8T9		898	Putative disease resistan	no	no	0.575	0.369	0.316	7e-30
Q9SSR8		375	Probable disease resistan	no	no	0.348	0.536	0.380	1e-29
Q8L3R3		885	Disease resistance protei	no	no	0.395	0.257	0.342	2e-29
O64973		889	Disease resistance protei	no	no	0.395	0.256	0.348	5e-29
Q9LW09		375	Putative disease resistan	no	no	0.348	0.536	0.375	5e-28
Q9SI85		893	Probable disease resistan	no	no	0.530	0.342	0.303	2e-27

>sp\|O23317\|DRL24_ARATH Probable disease resistance protein At4g14610 OS=Arabidopsis thaliana GN=At4g14610 PE=3 SV=1	Back alignment and function desciption

 Score =  196 bits (497), Expect = 5e-49,   Method: Compositional matrix adjust.
 Identities = 188/665 (28%), Positives = 288/665 (43%), Gaps = 161/665 (24%)

Query: 1   MVRVLVDLKVEGAFDVVAERTPGAAVDGRPSDLT-VGLESTFDQVWSCLVEEEQVGIIGL 59
           M++ + +L   G FDVV E    A V+  P   T VG E+  ++VW+ L+ ++   I+GL
Sbjct: 96  MLKEVENLSSRGVFDVVTEENLVAQVEEMPIQSTVVGQETMLERVWNTLM-KDGFKIMGL 154

Query: 60  YGMEG-------------------------W-----------IQEQIRRKLGLVDDLWAR 83
           YGM G                         W           IQE I ++LGL  + W +
Sbjct: 155 YGMGGVGKTTLLTQINKKFSETDGGFDIVMWVVVSKTSEIYRIQEDIAKRLGLTGEEWDK 214

Query: 84  KGLEEKAMNIFGILSK-EFVLCWMMCGSELILTQMGVPVPNPKRMSKVLFTTRFVEVYGH 142
           K   ++A++I  +L + +FVL       ++ L  +GVP P+ +  S V FTTR  +V G 
Sbjct: 215 KNENKRAVDIHNVLRRHKFVLLLDDIWEKVNLELVGVPYPSRENGSIVAFTTRSRDVCGR 274

Query: 143 KEADEMFRMECLRHEEAWKLFQMKVGKETMDDHSDIPKLVEIVTKECGGLPLVLVTTARA 202
              D+  ++ CL  E+AW LFQ KVG+ T+  H DIP+L + V ++C GLPL L      
Sbjct: 275 MGVDDPMQVSCLEPEDAWDLFQNKVGENTLKSHPDIPELAKQVAEKCRGLPLALNVIGET 334

Query: 203 MAYKKTIFGLARGILTQMIHTSGAHNERYYNIGVLRKEEDGEGSVTLHDVIRDMALWIAY 262
           MA K T+      I                       EE  +  V +HDV+R+MALWI+ 
Sbjct: 335 MACKSTVQEWRHAI----------------------DEEWKKTEVKMHDVVREMALWISS 372

Query: 263 ELAEEEENFWFMQEG--------------TRRVSLKENKIGDLWETPTSPQLLTLFLNIN 308
           +L + ++    ++ G               RR+SL +N++  +   PT PQL TL L  N
Sbjct: 373 DLGKHKDQC-IVRAGVGLHAVPEVKNWRAVRRMSLMKNELEKILGCPTCPQLTTLLLQKN 431

Query: 309 -PLSMIGGDLFQFKPCLKVLNLSNSPCLEKLPSRISRLVSLQHLDLSSSGILELPKELGF 367
             L  I G+ F+F P L VL+LS +  L  LP +IS    ++  + S  G+ E   E G 
Sbjct: 432 HKLVNISGEFFRFMPNLVVLDLSWNSSLTGLPKKISE---VETTNTSEFGVHE---EFGE 485

Query: 368 LGNLACLNLENTSSHGTITRQLRSNFSKPQVLRMFRFYGKAQYMKADSLPFGGSEFLVEQ 427
              +                      SK   L+  R     + +  +S          ++
Sbjct: 486 YAGV----------------------SKLLSLKTLRLQKSKKALDVNS---------AKE 514

Query: 428 LCCLKHLNVFSITLKSSYALQKPNSEHTRSLEVLPLAEMRQLDKLHIAFCTRLQEFEIE- 486
           L  L+H+ V +I + S             S ++L    M  + ++ I  C  ++E ++E 
Sbjct: 515 LQLLEHIEVLTIDIFSKV--------EEESFKILTFPSMCNIRRIGIWKCG-MKEIKVEM 565

Query: 487 ----------------CPGRNLMDLTWLIFAPNFRKIDINQSSHMEEIICIDRLRKVSGG 530
                           C G  L +LTWL+FAPN   +D   +  +E+II  ++   V+  
Sbjct: 566 RTSSCFSSLSKVVIGQCDG--LKELTWLLFAPNLTYLDARFAEQLEDIISEEKAASVTDE 623

Query: 531 YKKI-----------------LKRIYPDVLPLKNLKGITVSS-CPNLKRLPLNSNSDQSR 572
              I                 LK IY   L    L  + V   CP LK+LPLNS S  + 
Sbjct: 624 NASIIIPFQKLECLSLSDLPKLKSIYWSPLSFPRLSELAVQEHCPKLKKLPLNSKSGTA- 682

Query: 573 GLKLV 577
           G++LV
Sbjct: 683 GVELV 687

Probable disease resistance protein.
Arabidopsis thaliana (taxid: 3702)

>sp\|Q9FLB4\|DRL31_ARATH Putative disease resistance protein At5g05400 OS=Arabidopsis thaliana GN=At5g05400 PE=2 SV=1	Back alignment and function description

>sp\|Q9LVT4\|DRL37_ARATH Probable disease resistance protein At5g47250 OS=Arabidopsis thaliana GN=At5g47250 PE=2 SV=1	Back alignment and function description

>sp\|Q8RXS5\|DRL40_ARATH Probable disease resistance protein At5g63020 OS=Arabidopsis thaliana GN=At5g63020 PE=2 SV=2	Back alignment and function description

>sp\|Q9C8T9\|DRL19_ARATH Putative disease resistance protein At1g63350 OS=Arabidopsis thaliana GN=At1g63350 PE=2 SV=1	Back alignment and function description

>sp\|Q9SSR8\|DRL6_ARATH Probable disease resistance protein At1g52660 OS=Arabidopsis thaliana GN=At1g52660 PE=2 SV=1	Back alignment and function description

>sp\|Q8L3R3\|RFL1_ARATH Disease resistance protein RFL1 OS=Arabidopsis thaliana GN=RFL1 PE=3 SV=2	Back alignment and function description

>sp\|O64973\|RPS5_ARATH Disease resistance protein RPS5 OS=Arabidopsis thaliana GN=RPS5 PE=1 SV=2	Back alignment and function description

>sp\|Q9LW09\|DRL22_ARATH Putative disease resistance protein At3g15700 OS=Arabidopsis thaliana GN=At3g15700 PE=3 SV=1	Back alignment and function description

>sp\|Q9SI85\|DRL14_ARATH Probable disease resistance protein At1g62630 OS=Arabidopsis thaliana GN=At1g62630 PE=3 SV=2	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		577
147782775		778	hypothetical protein VITISV_017286 [Viti	0.920	0.682	0.351	2e-75
297741961		599	unnamed protein product [Vitis vinifera]	0.870	0.838	0.356	2e-67
298204683		613	unnamed protein product [Vitis vinifera]	0.835	0.786	0.362	4e-66
24461866		890	NBS-LRR type disease resistance protein	0.625	0.405	0.406	2e-65
147779772		910	hypothetical protein VITISV_011527 [Viti	0.902	0.572	0.328	1e-64
24461865		892	NBS-LRR type disease resistance protein	0.606	0.392	0.405	5e-58
317106749		1087	JHL25H03.3 [Jatropha curcas]	0.949	0.504	0.300	1e-56
147852651		882	hypothetical protein VITISV_017542 [Viti	0.925	0.605	0.305	6e-54
24461864		899	NBS-LRR type disease resistance protein	0.575	0.369	0.397	1e-51
359482672		905	PREDICTED: probable disease resistance p	0.960	0.612	0.283	1e-51

>gi\|147782775\|emb\|CAN76822.1\| hypothetical protein VITISV_017286 [Vitis vinifera]	Back alignment and taxonomy information

 Score =  290 bits (741), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 234/666 (35%), Positives = 320/666 (48%), Gaps = 135/666 (20%)

Query: 2   VRVLVDLKVEGAFDVVAERTPGAAVDGRPSDLTVGLESTFDQVWSCLVEEE--------- 52
           V  L +L+    FD+VA+R P A+VD RPS+ TVG+ STF++VWSCL EE+         
Sbjct: 123 VEDLNNLRSTRLFDMVADRLPPASVDERPSEPTVGMMSTFNKVWSCLGEEQVGIIGLYGL 182

Query: 53  -QVGIIGL--------------YGMEGW-----------IQEQIRRKLGLVDDLWARKGL 86
             VG   L              + +  W           +Q++I +K+G  D LW  K  
Sbjct: 183 GGVGKTTLLTQINNEFLKTTHDFDVVIWAVVSRDPDFPKVQDEIGKKVGFCDGLWRNKSK 242

Query: 87  EEKAMNIFGILSKE-FVLCWMMCGSELILTQMGVPVPNPKRMSKVLFTTRFVEVYGHKEA 145
           +EKA++IF  L K+ FVL        + L+ +GVPVPN +  SK++FTTR  +     EA
Sbjct: 243 DEKAIDIFRALRKKRFVLLLDDIWEPVNLSVLGVPVPNEEYKSKLVFTTRSEDACRQMEA 302

Query: 146 DEMFRMECLRHEEAWKLFQMKVGKETMDDHSDIPKLVEIVTKECGGLPLVLVTTARAMAY 205
            +  ++ECL  +E+W LFQ KVG++ +D H++IP L E+V KEC GLPL LV   RAMA 
Sbjct: 303 QKNIKVECLAWQESWDLFQKKVGQDALDSHAEIPMLAEMVAKECCGLPLALVIIGRAMAC 362

Query: 206 KKTIFGLARGILTQMIHTSGAHNERYYNIGVLRKEEDGEGSVTLHDVIRDMALWIAYELA 265
           KKT                    E  Y I VL      +G+ ++     +   W++    
Sbjct: 363 KKTT------------------EEWNYAIKVL------QGAASIFPEAPEFTRWVS---- 394

Query: 266 EEEENFWFMQEGTRRVSLKENKIGDLWETPTSPQLLTLFLNINPLSMIGGDLFQFKPCLK 325
                        +R+SL EN+I  L   P  P LLTLFL+ N L  I    FQF P L+
Sbjct: 395 ------------AKRISLMENRIEKLTRAPPCPNLLTLFLDHNNLRKITNGFFQFMPDLR 442

Query: 326 VLNLSNSPCLEKLPSRISRLVSLQHLDLSSSGILELPKELGFLGNLACLNLENTSSHGTI 385
           VL+LS +  L ++P     LVSLQ LDLS + I  LP EL  L NL CLNL  T     I
Sbjct: 443 VLSLSRNRRLTEIPLAFCNLVSLQCLDLSHTNIRLLPIELKNLQNLKCLNLNFTQILNVI 502

Query: 386 TRQLRSNFSKPQVLRMFRFYGKAQYMKADSLPFGGSEFLVEQLCCLKHLNVFSITLKSSY 445
            R L S+FS  +VLRM+      +      L  GG+E L+E+L  L  L+  SITL+ + 
Sbjct: 503 PRHLISSFSLLRVLRMYSCDFSDELTNCSDLS-GGNEDLLEELESLMQLHDLSITLERAT 561

Query: 446 ALQKPNSEH----TR-----------SLEVLPLAEMRQLDKLHIAFCTRLQEFEIECPGR 490
           AL +         TR           SL +  L  M+ L+KL I+ C+ L+  EI+  G 
Sbjct: 562 ALLRICDSKLQSCTRDVYLKILYGVTSLNISSLENMKCLEKLCISNCSALESLEIDYVGE 621

Query: 491 N---------------------------------LMDLTWLIFAPNFRKIDINQSSHMEE 517
                                             L DLTWLIFAPN   + +   + ME+
Sbjct: 622 EKKLLASYNLHNSMVRSHKCFNSLKHVRIDSCPILKDLTWLIFAPNLIHLGVVFCAKMEK 681

Query: 518 IICIDRLRKVSGGYKKI----------LKRIYPDVLPLKNLKGITVSSCPNLKRLPLNSN 567
           ++      +    + K+          LK IY   L + +LK I VSSCP LK+LPLNSN
Sbjct: 682 VLMPLGEGENGSPFAKLELLILIDLPELKSIYWKALRVPHLKEIRVSSCPQLKKLPLNSN 741

Query: 568 SDQSRG 573
           S    G
Sbjct: 742 STAGCG 747

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|297741961\|emb\|CBI33406.3\| unnamed protein product [Vitis vinifera]	Back alignment and taxonomy information

>gi\|298204683\|emb\|CBI25181.3\| unnamed protein product [Vitis vinifera]	Back alignment and taxonomy information

>gi\|24461866\|gb\|AAN62353.1\|AF506028_20 NBS-LRR type disease resistance protein [Citrus trifoliata]	Back alignment and taxonomy information

>gi\|147779772\|emb\|CAN65731.1\| hypothetical protein VITISV_011527 [Vitis vinifera]	Back alignment and taxonomy information

>gi\|24461865\|gb\|AAN62352.1\|AF506028_19 NBS-LRR type disease resistance protein [Citrus trifoliata]	Back alignment and taxonomy information

>gi\|317106749\|dbj\|BAJ53243.1\| JHL25H03.3 [Jatropha curcas]	Back alignment and taxonomy information

>gi\|147852651\|emb\|CAN80649.1\| hypothetical protein VITISV_017542 [Vitis vinifera]	Back alignment and taxonomy information

>gi\|24461864\|gb\|AAN62351.1\|AF506028_18 NBS-LRR type disease resistance protein [Citrus trifoliata]	Back alignment and taxonomy information

>gi\|359482672\|ref\|XP_003632805.1\| PREDICTED: probable disease resistance protein At1g12280-like [Vitis vinifera]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		577
TAIR\|locus:2034770		894	SUMM2 "AT1G12280" [Arabidopsis	0.249	0.161	0.379	7.8e-53
TAIR\|locus:2201986		885	RFL1 "AT1G12210" [Arabidopsis	0.284	0.185	0.371	2.6e-52
TAIR\|locus:2036214		851	AT1G15890 [Arabidopsis thalian	0.336	0.227	0.364	1e-51
TAIR\|locus:2201996		889	RPS5 "AT1G12220" [Arabidopsis	0.284	0.184	0.392	1.8e-46
TAIR\|locus:2132741		892	AT4G10780 [Arabidopsis thalian	0.249	0.161	0.365	2.5e-44
TAIR\|locus:2170892		848	AT5G43730 [Arabidopsis thalian	0.287	0.195	0.397	3e-40
TAIR\|locus:2166320		888	AT5G63020 [Arabidopsis thalian	0.249	0.162	0.393	3e-40
TAIR\|locus:2171589		948	AT5G47260 [Arabidopsis thalian	0.259	0.158	0.397	3.2e-40
TAIR\|locus:2008510		967	AT1G61190 "AT1G61190" [Arabido	0.249	0.148	0.372	7.8e-40
TAIR\|locus:2170902		862	AT5G43740 [Arabidopsis thalian	0.324	0.216	0.381	1.1e-39

TAIR\|locus:2034770 SUMM2 "AT1G12280" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 252 (93.8 bits), Expect = 7.8e-53, Sum P(4) = 7.8e-53
 Identities = 55/145 (37%), Positives = 81/145 (55%)

Query:    66 IQEQIRRKLGLVDDLWARKGLEEKAMNIFGILSKE-FVLCWMMCGSELILTQMGVPVPNP 124
             IQ  I ++L L  + W      ++A++I+ +L K+ FVL       ++ L  +GVP P+ 
Sbjct:   224 IQGDIGKRLDLGGEEWDNVNENQRALDIYNVLGKQKFVLLLDDIWEKVNLEVLGVPYPSR 283

Query:   125 KRMSKVLFTTRFVEVYGHKEADEMFRMECLRHEEAWKLFQMKVGKETMDDHSDIPKLVEI 184
             +   KV+FTTR  +V G    D+   + CL   EAW+LFQMKVG+ T+  H DIP+L   
Sbjct:   284 QNGCKVVFTTRSRDVCGRMRVDDPMEVSCLEPNEAWELFQMKVGENTLKGHPDIPELARK 343

Query:   185 VTKECGGLPLVLVTTARAMAYKKTI 209
             V  +C GLPL L      MA K+ +
Sbjct:   344 VAGKCCGLPLALNVIGETMACKRMV 368

GO:0006952 "defense response" evidence=IGI;ISS

GO:0043531 "ADP binding" evidence=IEA

TAIR\|locus:2201986 RFL1 "AT1G12210" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2036214 AT1G15890 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2201996 RPS5 "AT1G12220" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2132741 AT4G10780 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2170892 AT5G43730 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2166320 AT5G63020 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2171589 AT5G47260 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2008510 AT1G61190 "AT1G61190" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2170902 AT5G43740 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		577
pfam00931		285	pfam00931, NB-ARC, NB-ARC domain	6e-23
COG4886		394	COG4886, COG4886, Leucine-rich repeat (LRR) protei	3e-04
pfam13855		60	pfam13855, LRR_8, Leucine rich repeat	5e-04
PLN00113		968	PLN00113, PLN00113, leucine-rich repeat receptor-l	7e-04

>gnl\|CDD\|216202 pfam00931, NB-ARC, NB-ARC domain	Back alignment and domain information

 Score = 98.9 bits (247), Expect = 6e-23
 Identities = 54/214 (25%), Positives = 93/214 (43%), Gaps = 46/214 (21%)

Query: 38  ESTFDQVWSCLVEE-EQVGIIGLYGMEG------------------------W------- 65
           E   + +   L+E  + +G++G+ GM G                        W       
Sbjct: 2   EDMIEALIEKLLEMSDNLGVVGIVGMGGVGKTTLAKQIYNDDSVGGHFDSVAWVVVSKTY 61

Query: 66  ----IQEQIRRKLGLVDDLWARKGLEEKAMNIFGIL-SKEFVL----CWMMCGSELILTQ 116
               +Q+ I ++LGL D  W  K   E A+ I   L  K F+L     W     +    +
Sbjct: 62  TEFRLQKDILQELGLDDSDWVEKNESELAVKIKEALLRKRFLLVLDDVW----EKNDWDK 117

Query: 117 MGVPVPNPKRMSKVLFTTRFVEVYGH-KEADEMFRMECLRHEEAWKLFQMKVGKETMDDH 175
           +GVP P+ +  S+V+ TTR   V G      +   +E L  EE+W+LF  KV ++ +   
Sbjct: 118 IGVPFPDGENGSRVIVTTRSESVAGRMGGTSKPHEVESLEPEESWELFSNKVFEKELPPC 177

Query: 176 SDIPKLVEIVTKECGGLPLVLVTTARAMAYKKTI 209
            ++ ++ + + ++C GLPL L      +A+K T+
Sbjct: 178 PELEEVAKEIVEKCKGLPLALKVLGGLLAFKSTV 211

Length = 285

>gnl\|CDD\|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown]	Back alignment and domain information

>gnl\|CDD\|206026 pfam13855, LRR_8, Leucine rich repeat	Back alignment and domain information

>gnl\|CDD\|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		577
KOG4658		889	consensus Apoptotic ATPase [Signal transduction me	100.0
PLN03210		1153	Resistant to P. syringae 6; Provisional	100.0
PF00931		287	NB-ARC: NB-ARC domain; InterPro: IPR002182 This is	99.93
PLN00113		968	leucine-rich repeat receptor-like protein kinase;	99.77
PLN00113		968	leucine-rich repeat receptor-like protein kinase;	99.75
PLN03210		1153	Resistant to P. syringae 6; Provisional	99.74
KOG0444		1255	consensus Cytoskeletal regulator Flightless-I (con	99.73
KOG0444		1255	consensus Cytoskeletal regulator Flightless-I (con	99.66
KOG4194		873	consensus Membrane glycoprotein LIG-1 [Signal tran	99.65
KOG4194		873	consensus Membrane glycoprotein LIG-1 [Signal tran	99.64
KOG0472		565	consensus Leucine-rich repeat protein [Function un	99.55
KOG0617		264	consensus Ras suppressor protein (contains leucine	99.53
PRK15370		754	E3 ubiquitin-protein ligase SlrP; Provisional	99.5
KOG0472		565	consensus Leucine-rich repeat protein [Function un	99.49
KOG0617		264	consensus Ras suppressor protein (contains leucine	99.49
PRK15387		788	E3 ubiquitin-protein ligase SspH2; Provisional	99.48
PRK15370		754	E3 ubiquitin-protein ligase SlrP; Provisional	99.44
KOG0618		1081	consensus Serine/threonine phosphatase 2C containi	99.38
KOG0618		1081	consensus Serine/threonine phosphatase 2C containi	99.37
KOG4658		889	consensus Apoptotic ATPase [Signal transduction me	99.33
PRK15387		788	E3 ubiquitin-protein ligase SspH2; Provisional	99.27
KOG4237		498	consensus Extracellular matrix protein slit, conta	99.25
KOG0532		722	consensus Leucine-rich repeat (LRR) protein, conta	99.02
KOG0532		722	consensus Leucine-rich repeat (LRR) protein, conta	98.96
KOG4237		498	consensus Extracellular matrix protein slit, conta	98.95
PF14580		175	LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ	98.93
cd00116		319	LRR_RI Leucine-rich repeats (LRRs), ribonuclease i	98.93
cd00116		319	LRR_RI Leucine-rich repeats (LRRs), ribonuclease i	98.93
PF14580		175	LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ	98.88
COG4886		394	Leucine-rich repeat (LRR) protein [Function unknow	98.84
KOG3207		505	consensus Beta-tubulin folding cofactor E [Posttra	98.62
COG4886		394	Leucine-rich repeat (LRR) protein [Function unknow	98.61
KOG1259		490	consensus Nischarin, modulator of integrin alpha5	98.55
KOG1259		490	consensus Nischarin, modulator of integrin alpha5	98.55
KOG3207		505	consensus Beta-tubulin folding cofactor E [Posttra	98.51
PF13855		61	LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF	98.5
PF13855		61	LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF	98.4
PLN03150		623	hypothetical protein; Provisional	98.3
PRK15386		426	type III secretion protein GogB; Provisional	98.27
PRK15386		426	type III secretion protein GogB; Provisional	98.23
PLN03150		623	hypothetical protein; Provisional	98.22
PF12799		44	LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_	98.1
PF12799		44	LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_	98.09
KOG2120		419	consensus SCF ubiquitin ligase, Skp2 component [Po	98.08
KOG2120		419	consensus SCF ubiquitin ligase, Skp2 component [Po	98.08
KOG0531		414	consensus Protein phosphatase 1, regulatory subuni	98.0
KOG0531		414	consensus Protein phosphatase 1, regulatory subuni	97.83
KOG1859		1096	consensus Leucine-rich repeat proteins [General fu	97.8
KOG3665		699	consensus ZYG-1-like serine/threonine protein kina	97.78
KOG4341		483	consensus F-box protein containing LRR [General fu	97.77
KOG4579		177	consensus Leucine-rich repeat (LRR) protein associ	97.76
KOG1909		382	consensus Ran GTPase-activating protein [RNA proce	97.73
KOG1909		382	consensus Ran GTPase-activating protein [RNA proce	97.7
PF01637		234	Arch_ATPase: Archaeal ATPase; InterPro: IPR011579	97.69
PRK00411		394	cdc6 cell division control protein 6; Reviewed	97.65
KOG3665		699	consensus ZYG-1-like serine/threonine protein kina	97.61
TIGR03015		269	pepcterm_ATPase putative secretion ATPase, PEP-CTE	97.6
KOG2982		418	consensus Uncharacterized conserved protein [Funct	97.47
KOG4341		483	consensus F-box protein containing LRR [General fu	97.43
KOG1859		1096	consensus Leucine-rich repeat proteins [General fu	97.41
KOG4579		177	consensus Leucine-rich repeat (LRR) protein associ	97.34
PRK06893		229	DNA replication initiation factor; Validated	97.23
KOG1644		233	consensus U2-associated snRNP A' protein [RNA proc	97.17
KOG1644		233	consensus U2-associated snRNP A' protein [RNA proc	97.15
KOG2123		388	consensus Uncharacterized conserved protein [Funct	97.03
TIGR00635		305	ruvB Holliday junction DNA helicase, RuvB subunit.	96.94
TIGR02928		365	orc1/cdc6 family replication initiation protein. M	96.81
PF05729		166	NACHT: NACHT domain	96.8
KOG2982		418	consensus Uncharacterized conserved protein [Funct	96.76
KOG2739		260	consensus Leucine-rich acidic nuclear protein [Cel	96.64
PRK04841		903	transcriptional regulator MalT; Provisional	96.6
KOG2123		388	consensus Uncharacterized conserved protein [Funct	96.6
PRK13342		413	recombination factor protein RarA; Reviewed	96.52
PRK00080		328	ruvB Holliday junction DNA helicase RuvB; Reviewed	96.35
KOG1947		482	consensus Leucine rich repeat proteins, some prote	96.32
PF00560		22	LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le	96.11
PRK05564		313	DNA polymerase III subunit delta'; Validated	96.1
TIGR01242		364	26Sp45 26S proteasome subunit P45 family. Many pro	95.77
TIGR03420		226	DnaA_homol_Hda DnaA regulatory inactivator Hda. Me	95.63
PF00560		22	LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le	95.34
PRK00440		319	rfc replication factor C small subunit; Reviewed	95.26
KOG2739		260	consensus Leucine-rich acidic nuclear protein [Cel	95.1
PRK08727		233	hypothetical protein; Validated	95.05
COG5238		388	RNA1 Ran GTPase-activating protein (RanGAP) involv	94.97
PTZ00112		1164	origin recognition complex 1 protein; Provisional	94.9
PF13173		128	AAA_14: AAA domain	94.89
TIGR02397		355	dnaX_nterm DNA polymerase III, subunit gamma and t	94.69
PF13504		17	LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO	94.44
PRK07471		365	DNA polymerase III subunit delta'; Validated	94.22
PF13306		129	LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_	94.12
KOG2227		529	consensus Pre-initiation complex, subunit CDC6, AA	94.11
PRK14961		363	DNA polymerase III subunits gamma and tau; Provisi	93.96
PF13306		129	LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_	93.9
TIGR02903		615	spore_lon_C ATP-dependent protease, Lon family. Me	93.89
PRK12402		337	replication factor C small subunit 2; Reviewed	93.83
KOG0473		326	consensus Leucine-rich repeat protein [Function un	93.82
COG1474		366	CDC6 Cdc6-related protein, AAA superfamily ATPase	93.79
COG5238		388	RNA1 Ran GTPase-activating protein (RanGAP) involv	93.72
KOG1947		482	consensus Leucine rich repeat proteins, some prote	93.55
PRK08084		235	DNA replication initiation factor; Provisional	93.41
PRK14963		504	DNA polymerase III subunits gamma and tau; Provisi	93.4
PRK13341		725	recombination factor protein RarA/unknown domain f	93.38
PRK09087		226	hypothetical protein; Validated	93.37
PRK07003		830	DNA polymerase III subunits gamma and tau; Validat	93.35
PRK07940		394	DNA polymerase III subunit delta'; Validated	93.34
COG2909		894	MalT ATP-dependent transcriptional regulator [Tran	93.27
PLN03025		319	replication factor C subunit; Provisional	93.22
PF13504		17	LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO	93.07
PRK03992		389	proteasome-activating nucleotidase; Provisional	92.78
PRK05642		234	DNA replication initiation factor; Validated	92.75
COG3899		849	Predicted ATPase [General function prediction only	92.62
COG2256		436	MGS1 ATPase related to the helicase subunit of the	92.54
KOG0473		326	consensus Leucine-rich repeat protein [Function un	92.53
cd00009		151	AAA The AAA+ (ATPases Associated with a wide varie	92.3
PRK14955		397	DNA polymerase III subunits gamma and tau; Provisi	91.68
PRK14960		702	DNA polymerase III subunits gamma and tau; Provisi	91.54
PRK14970		367	DNA polymerase III subunits gamma and tau; Provisi	91.42
PRK06645		507	DNA polymerase III subunits gamma and tau; Validat	91.05
TIGR00678		188	holB DNA polymerase III, delta' subunit. At positi	90.97
PRK14949		944	DNA polymerase III subunits gamma and tau; Provisi	90.97
PRK06305		451	DNA polymerase III subunits gamma and tau; Validat	90.83
PRK14957		546	DNA polymerase III subunits gamma and tau; Provisi	90.78
PRK14962		472	DNA polymerase III subunits gamma and tau; Provisi	90.75
PRK08691		709	DNA polymerase III subunits gamma and tau; Validat	90.16
smart00369		26	LRR_TYP Leucine-rich repeats, typical (most popula	90.13
smart00370		26	LRR Leucine-rich repeats, outliers.	90.13
PHA02544		316	44 clamp loader, small subunit; Provisional	89.94
PRK04195		482	replication factor C large subunit; Provisional	89.76
PTZ00202		550	tuzin; Provisional	89.73
PRK14956		484	DNA polymerase III subunits gamma and tau; Provisi	89.58
KOG3864		221	consensus Uncharacterized conserved protein [Funct	89.33
PRK12323		700	DNA polymerase III subunits gamma and tau; Provisi	88.91
PRK14950		585	DNA polymerase III subunits gamma and tau; Provisi	88.52
PRK14951		618	DNA polymerase III subunits gamma and tau; Provisi	88.18
KOG3864		221	consensus Uncharacterized conserved protein [Funct	88.17
PRK14971		614	DNA polymerase III subunits gamma and tau; Provisi	88.07
PRK14959		624	DNA polymerase III subunits gamma and tau; Provisi	87.98
PRK07133		725	DNA polymerase III subunits gamma and tau; Validat	87.36
PRK08451		535	DNA polymerase III subunits gamma and tau; Validat	87.14
KOG0989		346	consensus Replication factor C, subunit RFC4 [Repl	87.14
PTZ00454		398	26S protease regulatory subunit 6B-like protein; P	87.13
smart00370		26	LRR Leucine-rich repeats, outliers.	86.78
smart00369		26	LRR_TYP Leucine-rich repeats, typical (most popula	86.78
PRK09111		598	DNA polymerase III subunits gamma and tau; Validat	86.49
PF14516		331	AAA_35: AAA-like domain	86.45
PRK07764		824	DNA polymerase III subunits gamma and tau; Validat	86.35
PRK05896		605	DNA polymerase III subunits gamma and tau; Validat	86.23
PRK06647		563	DNA polymerase III subunits gamma and tau; Validat	85.76
TIGR02639		731	ClpA ATP-dependent Clp protease ATP-binding subuni	85.21
PRK08903		227	DnaA regulatory inactivator Hda; Validated	85.15
TIGR02881		261	spore_V_K stage V sporulation protein K. Members o	85.08
PRK09112		351	DNA polymerase III subunit delta'; Validated	85.02
PRK14954		620	DNA polymerase III subunits gamma and tau; Provisi	83.57
PF05673		249	DUF815: Protein of unknown function (DUF815); Inte	83.51
TIGR02880		284	cbbX_cfxQ probable Rubsico expression protein CbbX	82.94
PRK07994		647	DNA polymerase III subunits gamma and tau; Validat	82.66
PRK14952		584	DNA polymerase III subunits gamma and tau; Provisi	81.85
PRK14953		486	DNA polymerase III subunits gamma and tau; Provisi	81.3

>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms]	Back alignment and domain information

Probab=100.00  E-value=5e-66  Score=562.63  Aligned_cols=551  Identities=37%  Similarity=0.581  Sum_probs=455.7

Q ss_pred             HHHHHHHhcCCcceeee-cCCCCccCCCCCCCc--cccHHHHHHHHHHhhcCCCceEEEEEeccc---------------
Q 037229            3 RVLVDLKVEGAFDVVAE-RTPGAAVDGRPSDLT--VGLESTFDQVWSCLVEEEQVGIIGLYGMEG---------------   64 (577)
Q Consensus         3 ~~v~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~--vGr~~~~~~i~~~L~~~~~~~vv~I~G~gG---------------   64 (577)
                      ++|.....++.++.++. ..+..-+...|....  ||.|..++++++.|.. ++..++||+||||               
T Consensus       126 ~~ve~l~~~~~~~~~~~~~~~~~~~e~~~~~~~~~VG~e~~~~kl~~~L~~-d~~~iv~i~GMGGvGKTTL~~qi~N~~~  204 (889)
T KOG4658|consen  126 REVESLGSKGVFEVVGESLDPREKVETRPIQSESDVGLETMLEKLWNRLME-DDVGIVGIYGMGGVGKTTLARQIFNKFD  204 (889)
T ss_pred             HHHHHhccccceecccccccchhhcccCCCCccccccHHHHHHHHHHHhcc-CCCCEEEEECCCcccHHHHHHHHhcccc
Confidence            45555555666666653 122222233332233  9999999999999999 5559999999999               


Q ss_pred             ----------h-----------hHHHHHHHhCCCcchhccCCHHHHHHHHHHhcc-ccEEEEEecCCChhhhcccCCCCC
Q 037229           65 ----------W-----------IQEQIRRKLGLVDDLWARKGLEEKAMNIFGILS-KEFVLCWMMCGSELILTQMGVPVP  122 (577)
Q Consensus        65 ----------w-----------~~~~i~~~l~~~~~~~~~~~~~~~~~~l~~~L~-kr~LlVLDdv~~~~~~~~l~~~~~  122 (577)
                                |           ++++|+..++..+..+.....++++..|.+.|+ |||+|||||||+..+|+.++.++|
T Consensus       205 ~v~~~Fd~~iWV~VSk~f~~~~iq~~Il~~l~~~~~~~~~~~~~~~~~~i~~~L~~krfllvLDDIW~~~dw~~I~~~~p  284 (889)
T KOG4658|consen  205 EVGNHFDGVIWVVVSKEFTTRKIQQTILERLGLLDEEWEDKEEDELASKLLNLLEGKRFLLVLDDIWEEVDWDKIGVPFP  284 (889)
T ss_pred             hhcccCceEEEEEEcccccHHhHHHHHHHHhccCCcccchhhHHHHHHHHHHHhccCceEEEEecccccccHHhcCCCCC
Confidence                      5           999999999886665566666899999999999 999999999999999999999999


Q ss_pred             CCCCCcEEEEEeCchhhhhc-CCCCceEecCCCCHHHHHHHHHHhhCCCCCCCCCChhHHHHHHHHHcCCCchHHHHHHH
Q 037229          123 NPKRMSKVLFTTRFVEVYGH-KEADEMFRMECLRHEEAWKLFQMKVGKETMDDHSDIPKLVEIVTKECGGLPLVLVTTAR  201 (577)
Q Consensus       123 ~~~~gsrIivTTR~~~v~~~-~~~~~~~~l~~L~~~~~~~Lf~~~a~~~~~~~~~~~~~~~~~i~~~c~glPLai~~~g~  201 (577)
                      ...+||||++|||++.||.. +++...++++.|+.+|||+||++.||.......+.++++|++++++|+|+|||++++|+
T Consensus       285 ~~~~g~KvvlTTRs~~V~~~~m~~~~~~~v~~L~~~eaW~LF~~~v~~~~~~~~~~i~~lak~v~~kC~GLPLAl~viG~  364 (889)
T KOG4658|consen  285 SRENGSKVVLTTRSEEVCGRAMGVDYPIEVECLTPEEAWDLFQKKVGPNTLGSHPDIEELAKEVAEKCGGLPLALNVLGG  364 (889)
T ss_pred             CccCCeEEEEEeccHhhhhccccCCccccccccCccccHHHHHHhhccccccccccHHHHHHHHHHHhCChHHHHHHHHH
Confidence            99899999999999999988 88889999999999999999999999886556666999999999999999999999999


Q ss_pred             HHhcCCCcccc---------------------------------------------------------------cccccc
Q 037229          202 AMAYKKTIFGL---------------------------------------------------------------ARGILT  218 (577)
Q Consensus       202 ~L~~~~~~~~W---------------------------------------------------------------a~g~i~  218 (577)
                      .|+.+.+.++|                                                               ||||+.
T Consensus       365 ~ma~K~t~~eW~~~~~~l~s~~~~~~~~~~~~i~~iLklSyd~L~~~lK~CFLycalFPED~~I~~e~Li~yWiaEGfi~  444 (889)
T KOG4658|consen  365 LLACKKTVQEWRRALNVLKSSLAADFSGMEESILPILKLSYDNLPEELKSCFLYCALFPEDYEIKKEKLIEYWIAEGFID  444 (889)
T ss_pred             HhcCCCcHHHHHHHHccccccccCCCCchhhhhHHhhhccHhhhhHHHHHHHHhhccCCcccccchHHHHHHHHhccCcC
Confidence            99999999999                                                               999999


Q ss_pred             ccCCchhHHHHHHHHHHHhhc----c--C--CCCCcEEehHHHHHHHHHHHhhhhhhccCceeeecC-------------
Q 037229          219 QMIHTSGAHNERYYNIGVLRK----E--E--DGEGSVTLHDVIRDMALWIAYELAEEEENFWFMQEG-------------  277 (577)
Q Consensus       219 ~~~~~~~~~~~~~~~~~~L~~----~--~--~~~~~~~mhdli~d~~~~~~~~~~~~~~~~~~~~~~-------------  277 (577)
                      +..+...++++|++|+.+|++    .  .  ++..+|+|||++||||.+++.+-+... ++.++..+             
T Consensus       445 ~~~~~~~~~d~G~~~i~~LV~~~Ll~~~~~~~~~~~~kmHDvvRe~al~ias~~~~~~-e~~iv~~~~~~~~~~~~~~~~  523 (889)
T KOG4658|consen  445 PLDGGETAEDVGYDYIEELVRASLLIEERDEGRKETVKMHDVVREMALWIASDFGKQE-ENQIVSDGVGLSEIPQVKSWN  523 (889)
T ss_pred             ccccccchhcchHHHHHHHHHHHHHhhcccccceeEEEeeHHHHHHHHHHhccccccc-cceEEECCcCccccccccchh
Confidence            976778999999999999999    1  1  467899999999999999999766655 43444431             


Q ss_pred             -eeEEEEecCCCCCCcCCCCCCCccEEeCccCC--CCCcchhhcCCCCcccEEEccCCCCCcccchhhhcCcCCCEEecc
Q 037229          278 -TRRVSLKENKIGDLWETPTSPQLLTLFLNINP--LSMIGGDLFQFKPCLKVLNLSNSPCLEKLPSRISRLVSLQHLDLS  354 (577)
Q Consensus       278 -~r~l~l~~~~~~~l~~~~~~~~Lr~L~l~~~~--~~~~~~~~~~~l~~L~~L~L~~~~~l~~lp~~i~~l~~L~~L~L~  354 (577)
                       +|+++++++.+..++....+++|++|.+.++.  +..++..+|..+++|++|||++|..+.++|.+|++|.|||||+++
T Consensus       524 ~~rr~s~~~~~~~~~~~~~~~~~L~tLll~~n~~~l~~is~~ff~~m~~LrVLDLs~~~~l~~LP~~I~~Li~LryL~L~  603 (889)
T KOG4658|consen  524 SVRRMSLMNNKIEHIAGSSENPKLRTLLLQRNSDWLLEISGEFFRSLPLLRVLDLSGNSSLSKLPSSIGELVHLRYLDLS  603 (889)
T ss_pred             heeEEEEeccchhhccCCCCCCccceEEEeecchhhhhcCHHHHhhCcceEEEECCCCCccCcCChHHhhhhhhhccccc
Confidence             89999999999999999999999999999996  788999999999999999999998999999999999999999999


Q ss_pred             CCCCCcccccccCCCcCcEecccccccccccchHHhcCCCCCcEEEeeeecCcccccccccCCccCcccccccccCCccC
Q 037229          355 SSGILELPKELGFLGNLACLNLENTSSHGTITRQLRSNFSKPQVLRMFRFYGKAQYMKADSLPFGGSEFLVEQLCCLKHL  434 (577)
Q Consensus       355 ~~~i~~lp~~i~~L~~L~~L~l~~~~~l~~lp~~~i~~l~~L~~L~l~~~~~~~~~~~~~~~~~~~~~~~~~~l~~L~~L  434 (577)
                      ++.++.+|.++++|++|++|++..+..+..+|.. +..|++||+|.+....            .......+.++.+|++|
T Consensus       604 ~t~I~~LP~~l~~Lk~L~~Lnl~~~~~l~~~~~i-~~~L~~Lr~L~l~~s~------------~~~~~~~l~el~~Le~L  670 (889)
T KOG4658|consen  604 DTGISHLPSGLGNLKKLIYLNLEVTGRLESIPGI-LLELQSLRVLRLPRSA------------LSNDKLLLKELENLEHL  670 (889)
T ss_pred             CCCccccchHHHHHHhhheeccccccccccccch-hhhcccccEEEeeccc------------cccchhhHHhhhcccch
Confidence            9999999999999999999999999777777653 6679999999998775            12355677888888999


Q ss_pred             ceeEEEecCcccccCCCccC-cc-----------cee--eecCCCCCCCcEEEecccCCceEEe----------------
Q 037229          435 NVFSITLKSSYALQKPNSEH-TR-----------SLE--VLPLAEMRQLDKLHIAFCTRLQEFE----------------  484 (577)
Q Consensus       435 ~~L~l~~~~~~~l~~l~~~~-l~-----------~L~--~~~l~~l~~L~~L~l~~~~~l~~l~----------------  484 (577)
                      +.+.+.......++.+.... +.           .+.  .+++..+.+|++|.|.+|...+...                
T Consensus       671 ~~ls~~~~s~~~~e~l~~~~~L~~~~~~l~~~~~~~~~~~~~~~~l~~L~~L~i~~~~~~e~~~~~~~~~~~~~~f~~l~  750 (889)
T KOG4658|consen  671 ENLSITISSVLLLEDLLGMTRLRSLLQSLSIEGCSKRTLISSLGSLGNLEELSILDCGISEIVIEWEESLIVLLCFPNLS  750 (889)
T ss_pred             hhheeecchhHhHhhhhhhHHHHHHhHhhhhcccccceeecccccccCcceEEEEcCCCchhhcccccccchhhhHHHHH
Confidence            88888654431122211110 00           000  3467789999999999998753210                


Q ss_pred             ----cccCCCCCCCCCccCCCCCcceEeeccCCCcceecCC--------------CcccEE-ecCCcccccccccCCCCC
Q 037229          485 ----IECPGRNLMDLTWLIFAPNFRKIDINQSSHMEEIICI--------------DRLRKV-SGGYKKILKRIYPDVLPL  545 (577)
Q Consensus       485 ----l~~~~~~l~~l~~l~~l~~L~~L~l~~~~~~~~~~~~--------------~~L~~L-~l~~~~~l~~l~~~~~~~  545 (577)
                          ..|.  ..+.+.|....|+|+.|.+..|..++++++.              .++..+ .+.+.+.++.+.+..-.+
T Consensus       751 ~~~~~~~~--~~r~l~~~~f~~~L~~l~l~~~~~~e~~i~~~k~~~~l~~~i~~f~~~~~l~~~~~l~~l~~i~~~~l~~  828 (889)
T KOG4658|consen  751 KVSILNCH--MLRDLTWLLFAPHLTSLSLVSCRLLEDIIPKLKALLELKELILPFNKLEGLRMLCSLGGLPQLYWLPLSF  828 (889)
T ss_pred             HHHhhccc--cccccchhhccCcccEEEEecccccccCCCHHHHhhhcccEEecccccccceeeecCCCCceeEecccCc
Confidence                1255  6777778888999999999999999988765              556666 466667777777777788


Q ss_pred             CCcceEeeecCCCCCcCCCCCCccc
Q 037229          546 KNLKGITVSSCPNLKRLPLNSNSDQ  570 (577)
Q Consensus       546 ~~L~~L~i~~c~~L~~lp~~~~~~~  570 (577)
                      ++|+.+.+..||++.++|..+....
T Consensus       829 ~~l~~~~ve~~p~l~~~P~~~~~~i  853 (889)
T KOG4658|consen  829 LKLEELIVEECPKLGKLPLLSTLTI  853 (889)
T ss_pred             cchhheehhcCcccccCccccccce
Confidence            9999999999999999999876543

>PLN03210 Resistant to P	Back alignment and domain information

>PF00931 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is the NB-ARC domain, a novel signalling motif found in bacteria and eukaryotes, shared by plant resistance gene products and regulators of cell death in animals []	Back alignment and domain information

>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional	Back alignment and domain information

>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional	Back alignment and domain information

>PLN03210 Resistant to P	Back alignment and domain information

>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton]	Back alignment and domain information

>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton]	Back alignment and domain information

>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms]	Back alignment and domain information

>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms]	Back alignment and domain information

>KOG0472 consensus Leucine-rich repeat protein [Function unknown]	Back alignment and domain information

>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms]	Back alignment and domain information

>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional	Back alignment and domain information

>KOG0472 consensus Leucine-rich repeat protein [Function unknown]	Back alignment and domain information

>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms]	Back alignment and domain information

>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional	Back alignment and domain information

>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional	Back alignment and domain information

>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms]	Back alignment and domain information

>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms]	Back alignment and domain information

>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms]	Back alignment and domain information

>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional	Back alignment and domain information

>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms]	Back alignment and domain information

>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton]	Back alignment and domain information

>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton]	Back alignment and domain information

>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms]	Back alignment and domain information

>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A	Back alignment and domain information

>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily	Back alignment and domain information

>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily	Back alignment and domain information

>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A	Back alignment and domain information

>COG4886 Leucine-rich repeat (LRR) protein [Function unknown]	Back alignment and domain information

>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>COG4886 Leucine-rich repeat (LRR) protein [Function unknown]	Back alignment and domain information

>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton]	Back alignment and domain information

>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton]	Back alignment and domain information

>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A	Back alignment and domain information

>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A	Back alignment and domain information

>PLN03150 hypothetical protein; Provisional	Back alignment and domain information

>PRK15386 type III secretion protein GogB; Provisional	Back alignment and domain information

>PRK15386 type III secretion protein GogB; Provisional	Back alignment and domain information

>PLN03150 hypothetical protein; Provisional	Back alignment and domain information

>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B	Back alignment and domain information

>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B	Back alignment and domain information

>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms]	Back alignment and domain information

>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms]	Back alignment and domain information

>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only]	Back alignment and domain information

>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only]	Back alignment and domain information

>KOG4341 consensus F-box protein containing LRR [General function prediction only]	Back alignment and domain information

>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only]	Back alignment and domain information

>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms]	Back alignment and domain information

>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms]	Back alignment and domain information

>PF01637 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 This domain has been found in a number of bacterial and archaeal proteins, all of which contain a conserved P-loop motif that is involved in binding ATP	Back alignment and domain information

>PRK00411 cdc6 cell division control protein 6; Reviewed	Back alignment and domain information

>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only]	Back alignment and domain information

>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily	Back alignment and domain information

>KOG2982 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG4341 consensus F-box protein containing LRR [General function prediction only]	Back alignment and domain information

>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only]	Back alignment and domain information

>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only]	Back alignment and domain information

>PRK06893 DNA replication initiation factor; Validated	Back alignment and domain information

>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification]	Back alignment and domain information

>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification]	Back alignment and domain information

>KOG2123 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit	Back alignment and domain information

>TIGR02928 orc1/cdc6 family replication initiation protein	Back alignment and domain information

>PF05729 NACHT: NACHT domain	Back alignment and domain information

>KOG2982 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only]	Back alignment and domain information

>PRK04841 transcriptional regulator MalT; Provisional	Back alignment and domain information

>KOG2123 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PRK13342 recombination factor protein RarA; Reviewed	Back alignment and domain information

>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed	Back alignment and domain information

>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only]	Back alignment and domain information

>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape []	Back alignment and domain information

>PRK05564 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>TIGR01242 26Sp45 26S proteasome subunit P45 family	Back alignment and domain information

>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda	Back alignment and domain information

>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape []	Back alignment and domain information

>PRK00440 rfc replication factor C small subunit; Reviewed	Back alignment and domain information

>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only]	Back alignment and domain information

>PRK08727 hypothetical protein; Validated	Back alignment and domain information

>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification]	Back alignment and domain information

>PTZ00112 origin recognition complex 1 protein; Provisional	Back alignment and domain information

>PF13173 AAA_14: AAA domain	Back alignment and domain information

>TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau	Back alignment and domain information

>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D	Back alignment and domain information

>PRK07471 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A	Back alignment and domain information

>KOG2227 consensus Pre-initiation complex, subunit CDC6, AAA+ superfamily ATPase [Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>PRK14961 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A	Back alignment and domain information

>TIGR02903 spore_lon_C ATP-dependent protease, Lon family	Back alignment and domain information

>PRK12402 replication factor C small subunit 2; Reviewed	Back alignment and domain information

>KOG0473 consensus Leucine-rich repeat protein [Function unknown]	Back alignment and domain information

>COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification]	Back alignment and domain information

>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only]	Back alignment and domain information

>PRK08084 DNA replication initiation factor; Provisional	Back alignment and domain information

>PRK14963 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed	Back alignment and domain information

>PRK09087 hypothetical protein; Validated	Back alignment and domain information

>PRK07003 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK07940 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>COG2909 MalT ATP-dependent transcriptional regulator [Transcription]	Back alignment and domain information

>PLN03025 replication factor C subunit; Provisional	Back alignment and domain information

>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D	Back alignment and domain information

>PRK03992 proteasome-activating nucleotidase; Provisional	Back alignment and domain information

>PRK05642 DNA replication initiation factor; Validated	Back alignment and domain information

>COG3899 Predicted ATPase [General function prediction only]	Back alignment and domain information

>COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair]	Back alignment and domain information

>KOG0473 consensus Leucine-rich repeat protein [Function unknown]	Back alignment and domain information

>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold	Back alignment and domain information

>PRK14955 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK14960 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK14970 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK06645 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>TIGR00678 holB DNA polymerase III, delta' subunit	Back alignment and domain information

>PRK14949 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK06305 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK14957 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK14962 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK08691 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily	Back alignment and domain information

>smart00370 LRR Leucine-rich repeats, outliers	Back alignment and domain information

>PHA02544 44 clamp loader, small subunit; Provisional	Back alignment and domain information

>PRK04195 replication factor C large subunit; Provisional	Back alignment and domain information

>PTZ00202 tuzin; Provisional	Back alignment and domain information

>PRK14956 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>KOG3864 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PRK12323 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK14950 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK14951 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>KOG3864 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PRK14971 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK14959 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK07133 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK08451 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>KOG0989 consensus Replication factor C, subunit RFC4 [Replication, recombination and repair]	Back alignment and domain information

>PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional	Back alignment and domain information

>smart00370 LRR Leucine-rich repeats, outliers	Back alignment and domain information

>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily	Back alignment and domain information

>PRK09111 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PF14516 AAA_35: AAA-like domain	Back alignment and domain information

>PRK07764 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK05896 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK06647 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA	Back alignment and domain information

>PRK08903 DnaA regulatory inactivator Hda; Validated	Back alignment and domain information

>TIGR02881 spore_V_K stage V sporulation protein K	Back alignment and domain information

>PRK09112 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PRK14954 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PF05673 DUF815: Protein of unknown function (DUF815); InterPro: IPR008533 This domain consists of several bacterial proteins of unknown function	Back alignment and domain information

>TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX	Back alignment and domain information

>PRK07994 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK14952 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK14953 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		577
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	9e-13
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	9e-13
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	1e-12
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	1e-08
3bz5_A		457	Internalin-J, INLJ; leucine rich repeat (LRR), cys	8e-11
3bz5_A		457	Internalin-J, INLJ; leucine rich repeat (LRR), cys	1e-07
3bz5_A		457	Internalin-J, INLJ; leucine rich repeat (LRR), cys	1e-05
1z6t_A		591	APAF-1, apoptotic protease activating factor 1; ca	4e-10
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	6e-10
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	6e-08
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	7e-07
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	7e-07
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	4e-06
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	2e-04
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	6e-04
3jqh_A		167	C-type lectin domain family 4 member M; DC-signr,	7e-10
3jqh_A		167	C-type lectin domain family 4 member M; DC-signr,	4e-09
3jqh_A		167	C-type lectin domain family 4 member M; DC-signr,	5e-09
3jqh_A		167	C-type lectin domain family 4 member M; DC-signr,	2e-06
2z66_A		306	Variable lymphocyte receptor B, TOLL-like recepto;	1e-09
2z66_A		306	Variable lymphocyte receptor B, TOLL-like recepto;	2e-08
2z66_A		306	Variable lymphocyte receptor B, TOLL-like recepto;	2e-07
2z66_A		306	Variable lymphocyte receptor B, TOLL-like recepto;	3e-05
2a5y_B		549	CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis	1e-09
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	2e-09
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	1e-07
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	1e-06
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	2e-06
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	2e-06
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	4e-09
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	3e-07
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	1e-06
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	2e-06
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	5e-05
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	5e-09
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	4e-07
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	2e-06
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	4e-06
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	6e-06
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	2e-05
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	3e-05
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	7e-05
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	2e-04
3o53_A		317	Protein LRIM1, AGAP006348-PA; leucine-rich repeat,	6e-09
3o53_A		317	Protein LRIM1, AGAP006348-PA; leucine-rich repeat,	3e-08
3o53_A		317	Protein LRIM1, AGAP006348-PA; leucine-rich repeat,	6e-08
3o53_A		317	Protein LRIM1, AGAP006348-PA; leucine-rich repeat,	1e-07
3o53_A		317	Protein LRIM1, AGAP006348-PA; leucine-rich repeat,	1e-06
3o53_A		317	Protein LRIM1, AGAP006348-PA; leucine-rich repeat,	4e-06
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	6e-09
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	6e-08
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	1e-07
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	2e-06
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	3e-06
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	5e-06
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	3e-04
3zyj_A		440	Leucine-rich repeat-containing protein 4C; cell ad	6e-09
3zyj_A		440	Leucine-rich repeat-containing protein 4C; cell ad	1e-06
3zyj_A		440	Leucine-rich repeat-containing protein 4C; cell ad	6e-06
3zyj_A		440	Leucine-rich repeat-containing protein 4C; cell ad	1e-04
3zyi_A		452	Leucine-rich repeat-containing protein 4; cell adh	1e-08
3zyi_A		452	Leucine-rich repeat-containing protein 4; cell adh	1e-06
3zyi_A		452	Leucine-rich repeat-containing protein 4; cell adh	2e-06
3zyi_A		452	Leucine-rich repeat-containing protein 4; cell adh	1e-04
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	1e-08
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	2e-08
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	4e-07
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	1e-05
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	2e-05
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	2e-05
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	3e-04
2id5_A		477	Lingo-1, leucine rich repeat neuronal 6A; CNS-spec	1e-08
2id5_A		477	Lingo-1, leucine rich repeat neuronal 6A; CNS-spec	6e-08
2id5_A		477	Lingo-1, leucine rich repeat neuronal 6A; CNS-spec	5e-07
2id5_A		477	Lingo-1, leucine rich repeat neuronal 6A; CNS-spec	7e-07
2id5_A		477	Lingo-1, leucine rich repeat neuronal 6A; CNS-spec	7e-07
2id5_A		477	Lingo-1, leucine rich repeat neuronal 6A; CNS-spec	9e-06
2id5_A		477	Lingo-1, leucine rich repeat neuronal 6A; CNS-spec	2e-05
2id5_A		477	Lingo-1, leucine rich repeat neuronal 6A; CNS-spec	2e-05
1xku_A		330	Decorin; proteoglycan, leucine-rich repeat, struct	2e-08
1xku_A		330	Decorin; proteoglycan, leucine-rich repeat, struct	1e-06
1xku_A		330	Decorin; proteoglycan, leucine-rich repeat, struct	2e-06
1xku_A		330	Decorin; proteoglycan, leucine-rich repeat, struct	2e-06
1xku_A		330	Decorin; proteoglycan, leucine-rich repeat, struct	2e-04
2ft3_A		332	Biglycan; proteoglycan, dimer interface, structura	2e-08
2ft3_A		332	Biglycan; proteoglycan, dimer interface, structura	1e-06
2ft3_A		332	Biglycan; proteoglycan, dimer interface, structura	1e-06
2ft3_A		332	Biglycan; proteoglycan, dimer interface, structura	3e-06
2ft3_A		332	Biglycan; proteoglycan, dimer interface, structura	3e-04
1ozn_A		285	Reticulon 4 receptor; NOGO receptor, MAD, myelinat	2e-08
1ozn_A		285	Reticulon 4 receptor; NOGO receptor, MAD, myelinat	1e-05
1ozn_A		285	Reticulon 4 receptor; NOGO receptor, MAD, myelinat	2e-05
1ozn_A		285	Reticulon 4 receptor; NOGO receptor, MAD, myelinat	2e-04
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	2e-08
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	1e-06
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	2e-05
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	2e-05
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	4e-05
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	1e-04
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	4e-08
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	1e-07
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	4e-06
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	5e-06
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	9e-06
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	9e-06
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	5e-05
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	1e-04
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	6e-04
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	5e-08
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	4e-07
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	7e-07
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	1e-04
1dce_A		567	Protein (RAB geranylgeranyltransferase alpha subun	6e-08
1dce_A		567	Protein (RAB geranylgeranyltransferase alpha subun	9e-06
1dce_A		567	Protein (RAB geranylgeranyltransferase alpha subun	1e-05
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	8e-08
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	1e-06
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	9e-06
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	1e-05
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	5e-04
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	9e-08
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	4e-07
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	2e-06
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	5e-06
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	3e-05
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	2e-04
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	1e-07
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	2e-06
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	9e-05
4ay9_X		350	Follicle-stimulating hormone receptor; hormone-rec	2e-07
4ay9_X		350	Follicle-stimulating hormone receptor; hormone-rec	8e-06
4ay9_X		350	Follicle-stimulating hormone receptor; hormone-rec	2e-04
2xwt_C		239	Thyrotropin receptor; signaling protein-immune sys	3e-07
2xwt_C		239	Thyrotropin receptor; signaling protein-immune sys	2e-05
2xwt_C		239	Thyrotropin receptor; signaling protein-immune sys	2e-05
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	3e-07
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	3e-05
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	3e-05
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	3e-05
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	5e-05
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	4e-04
2z80_A		353	TOLL-like receptor 2, variable lymphocyte recepto;	3e-07
2z80_A		353	TOLL-like receptor 2, variable lymphocyte recepto;	8e-07
2z80_A		353	TOLL-like receptor 2, variable lymphocyte recepto;	3e-06
2z80_A		353	TOLL-like receptor 2, variable lymphocyte recepto;	2e-04
2xot_A		361	Amphoterin-induced protein 1; cell adhesion, neuro	3e-07
2xot_A		361	Amphoterin-induced protein 1; cell adhesion, neuro	2e-06
2xot_A		361	Amphoterin-induced protein 1; cell adhesion, neuro	2e-04
3a79_B		562	TLR6, VLRB.59, TOLL-like receptor 6, variable lymp	4e-07
3a79_B		562	TLR6, VLRB.59, TOLL-like receptor 6, variable lymp	2e-04
3a79_B		562	TLR6, VLRB.59, TOLL-like receptor 6, variable lymp	2e-04
3cvr_A		571	Invasion plasmid antigen; leucine rich repeat and	4e-07
3cvr_A		571	Invasion plasmid antigen; leucine rich repeat and	9e-05
3cvr_A		571	Invasion plasmid antigen; leucine rich repeat and	2e-04
3cvr_A		571	Invasion plasmid antigen; leucine rich repeat and	5e-04
3cvr_A		571	Invasion plasmid antigen; leucine rich repeat and	5e-04
3cvr_A		571	Invasion plasmid antigen; leucine rich repeat and	6e-04
3fxi_A		605	TLR4, htoll, TOLL-like receptor 4; leucine rich re	8e-07
3fxi_A		605	TLR4, htoll, TOLL-like receptor 4; leucine rich re	1e-06
3fxi_A		605	TLR4, htoll, TOLL-like receptor 4; leucine rich re	4e-06
3fxi_A		605	TLR4, htoll, TOLL-like receptor 4; leucine rich re	4e-05
3fxi_A		605	TLR4, htoll, TOLL-like receptor 4; leucine rich re	2e-04
3v47_A		455	TOLL-like receptor 5B and variable lymphocyte REC	1e-06
3v47_A		455	TOLL-like receptor 5B and variable lymphocyte REC	4e-06
3v47_A		455	TOLL-like receptor 5B and variable lymphocyte REC	5e-05
3v47_A		455	TOLL-like receptor 5B and variable lymphocyte REC	1e-04
3v47_A		455	TOLL-like receptor 5B and variable lymphocyte REC	1e-04
2z62_A		276	TOLL-like receptor 4, variable lymphocyte recepto;	1e-06
2z62_A		276	TOLL-like receptor 4, variable lymphocyte recepto;	6e-04
4ezg_A		197	Putative uncharacterized protein; internalin-A, le	2e-06
4ezg_A		197	Putative uncharacterized protein; internalin-A, le	2e-05
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	2e-06
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	3e-06
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	3e-05
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	1e-04
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	2e-04
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	3e-04
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	3e-04
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	8e-04
1p9a_G		290	Platelet glycoprotein IB alpha chain precursor; pl	3e-06
1p9a_G		290	Platelet glycoprotein IB alpha chain precursor; pl	5e-06
1p9a_G		290	Platelet glycoprotein IB alpha chain precursor; pl	1e-04
1o6v_A		466	Internalin A; bacterial infection, extracellular r	3e-06
1o6v_A		466	Internalin A; bacterial infection, extracellular r	3e-06
1o6v_A		466	Internalin A; bacterial infection, extracellular r	9e-06
1o6v_A		466	Internalin A; bacterial infection, extracellular r	2e-05
1o6v_A		466	Internalin A; bacterial infection, extracellular r	2e-05
1o6v_A		466	Internalin A; bacterial infection, extracellular r	2e-05
1o6v_A		466	Internalin A; bacterial infection, extracellular r	4e-05
1o6v_A		466	Internalin A; bacterial infection, extracellular r	7e-04
2v70_A		220	SLIT-2, SLIT homolog 2 protein N-product; neurogen	4e-06
2z7x_B		520	TOLL-like receptor 1, variable lymphocyte recepto;	5e-06
2z7x_B		520	TOLL-like receptor 1, variable lymphocyte recepto;	9e-06
2z7x_B		520	TOLL-like receptor 1, variable lymphocyte recepto;	9e-05
2z7x_B		520	TOLL-like receptor 1, variable lymphocyte recepto;	5e-04
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	5e-06
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	2e-05
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	2e-05
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	4e-05
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	1e-04
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	1e-04
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	5e-04
1h6u_A		308	Internalin H; cell adhesion, leucine rich repeat,	6e-06
1xeu_A		263	Internalin C; cellular invasion, leucine-rich repe	7e-06
1xeu_A		263	Internalin C; cellular invasion, leucine-rich repe	6e-04
2v9t_B		220	SLIT homolog 2 protein N-product; structural prote	1e-05
1h6t_A		291	Internalin B; cell adhesion, leucine rich repeat,	1e-05
1h6t_A		291	Internalin B; cell adhesion, leucine rich repeat,	7e-04
1m9s_A		605	Internalin B; cell invasion, GW domains, SH3 domai	2e-05
1m9s_A		605	Internalin B; cell invasion, GW domains, SH3 domai	3e-05
1m9s_A		605	Internalin B; cell invasion, GW domains, SH3 domai	7e-05
2ifg_A		347	High affinity nerve growth factor receptor; TRK, T	1e-04
1ogq_A		313	PGIP-2, polygalacturonase inhibiting protein; inhi	1e-04
1ogq_A		313	PGIP-2, polygalacturonase inhibiting protein; inhi	1e-04
1wwl_A		312	Monocyte differentiation antigen CD14; LPS, immune	2e-04
1wwl_A		312	Monocyte differentiation antigen CD14; LPS, immune	2e-04
1wwl_A		312	Monocyte differentiation antigen CD14; LPS, immune	4e-04
3ogk_B		592	Coronatine-insensitive protein 1; leucine rich rep	3e-04
1ds9_A		198	Outer arm dynein; leucine-rich repeat, beta-BETA-a	4e-04
1ds9_A		198	Outer arm dynein; leucine-rich repeat, beta-BETA-a	4e-04
3e6j_A		229	Variable lymphocyte receptor diversity region; var	6e-04
1a9n_A		176	U2A', U2A'; complex (nuclear protein/RNA), RNA, sn	7e-04

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

 Score = 70.3 bits (171), Expect = 9e-13
 Identities = 64/538 (11%), Positives = 148/538 (27%), Gaps = 163/538 (30%)

Query: 27  DGRP-SDLTVGLESTFDQVWSCLVEEEQVGIIGLYGMEG----WIQEQIRRKLGLVDDL- 80
           D +  +   V     + ++   L+E      + + G+ G    W+   +     +   + 
Sbjct: 122 DNQVFAKYNVSRLQPYLKLRQALLELRPAKNVLIDGVLGSGKTWVALDVCLSYKVQCKMD 181

Query: 81  ----WARKGLEEKAMNIFGILSKEFVLCWMMCGSELILTQMGVPVPNP--------KRM- 127
               W           +  +L K   L + +  +    +     +           +R+ 
Sbjct: 182 FKIFWLNLKNCNSPETVLEMLQK---LLYQIDPNWTSRSDHSSNIKLRIHSIQAELRRLL 238

Query: 128 ---------------------------SKVLFTTRFVEV--------YGHKEADEMFRME 152
                                       K+L TTRF +V          H   D      
Sbjct: 239 KSKPYENCLLVLLNVQNAKAWNAFNLSCKILLTTRFKQVTDFLSAATTTHISLDHH--SM 296

Query: 153 CLRHEEAWKLFQMKVGKETMDDHSDIPKLVEIVTKECGGLPLVLVTTARAMA-------- 204
            L  +E   L    +         D+P+ V          P  L   A ++         
Sbjct: 297 TLTPDEVKSLLLKYLDCRP----QDLPREV------LTTNPRRLSIIAESIRDGLATWDN 346

Query: 205 YKKTIFGLARGILTQMIHTS------GAHNERYYNIGVLRKEEDGEGSVTLHDVIRDMAL 258
           +K     +    LT +I +S        + + +  + V          +    ++    +
Sbjct: 347 WKH----VNCDKLTTIIESSLNVLEPAEYRKMFDRLSVFPPSAH----IPT-ILL--SLI 395

Query: 259 WIAYELAEEEENFWFMQEGTRRVSLKENKIGDLWETPTSPQLLTLFLNINPLSMIGGDLF 318
           W     ++       + +  +   +++          ++  + +++L +         L 
Sbjct: 396 WFDVIKSDVMV---VVNKLHKYSLVEK------QPKESTISIPSIYLELKVKLENEYALH 446

Query: 319 QFKPCLKVLNLSNSP---CLEKLP---------SRISRLVSLQHLDLSSSG--ILELPK- 363
           +      +++  N P     + L          S I       HL        +      
Sbjct: 447 R-----SIVDHYNIPKTFDSDDLIPPYLDQYFYSHIGH-----HLKNIEHPERMTLFRMV 496

Query: 364 --ELGFLGNLACLNLENTSSHGTITRQLRSNFSKPQVLRMFRFYGKAQYMKADSLPFGG- 420
             +  FL       + + S+    +  + +       L+  +FY    Y+  +   +   
Sbjct: 497 FLDFRFLEQ----KIRHDSTAWNASGSILN------TLQQLKFYKP--YICDNDPKYERL 544

Query: 421 ----SEFLV---EQLCCLKHLNVFSITLKSSYALQKPNSEHTRSLEVLPLAEMRQLDK 471
                +FL    E L C K+ ++  I      AL   +        +   A  +Q+ +
Sbjct: 545 VNAILDFLPKIEENLICSKYTDLLRI------ALMAEDE------AIFEEAH-KQVQR 589

PyMOL of 1vt4

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328	Back alignment and structure

>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457	Back alignment and structure

>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457	Back alignment and structure

>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457	Back alignment and structure

>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Length = 591	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390	Back alignment and structure

>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306	Back alignment and structure

>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306	Back alignment and structure

>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306	Back alignment and structure

>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306	Back alignment and structure

>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Length = 549	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606	Back alignment and structure

>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317	Back alignment and structure

>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317	Back alignment and structure

>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317	Back alignment and structure

>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317	Back alignment and structure

>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317	Back alignment and structure

>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487	Back alignment and structure

>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440	Back alignment and structure

>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440	Back alignment and structure

>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440	Back alignment and structure

>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440	Back alignment and structure

>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452	Back alignment and structure

>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452	Back alignment and structure

>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452	Back alignment and structure

>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570	Back alignment and structure

>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477	Back alignment and structure

>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477	Back alignment and structure

>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477	Back alignment and structure

>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477	Back alignment and structure

>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477	Back alignment and structure

>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477	Back alignment and structure

>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477	Back alignment and structure

>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477	Back alignment and structure

>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330	Back alignment and structure

>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330	Back alignment and structure

>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330	Back alignment and structure

>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330	Back alignment and structure

>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330	Back alignment and structure

>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332	Back alignment and structure

>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332	Back alignment and structure

>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332	Back alignment and structure

>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332	Back alignment and structure

>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332	Back alignment and structure

>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285	Back alignment and structure

>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285	Back alignment and structure

>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285	Back alignment and structure

>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844	Back alignment and structure

>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567	Back alignment and structure

>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567	Back alignment and structure

>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606	Back alignment and structure

>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350	Back alignment and structure

>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350	Back alignment and structure

>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350	Back alignment and structure

>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239	Back alignment and structure

>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239	Back alignment and structure

>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347	Back alignment and structure

>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353	Back alignment and structure

>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353	Back alignment and structure

>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353	Back alignment and structure

>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353	Back alignment and structure

>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361	Back alignment and structure

>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361	Back alignment and structure

>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361	Back alignment and structure

>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562	Back alignment and structure

>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562	Back alignment and structure

>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562	Back alignment and structure

>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571	Back alignment and structure

>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571	Back alignment and structure

>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571	Back alignment and structure

>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571	Back alignment and structure

>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571	Back alignment and structure

>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571	Back alignment and structure

>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605	Back alignment and structure

>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605	Back alignment and structure

>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605	Back alignment and structure

>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605	Back alignment and structure

>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605	Back alignment and structure

>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455	Back alignment and structure

>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455	Back alignment and structure

>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455	Back alignment and structure

>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455	Back alignment and structure

>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455	Back alignment and structure

>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276	Back alignment and structure

>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276	Back alignment and structure

>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197	Back alignment and structure

>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290	Back alignment and structure

>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290	Back alignment and structure

>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466	Back alignment and structure

>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220	Back alignment and structure

>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520	Back alignment and structure

>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520	Back alignment and structure

>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520	Back alignment and structure

>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308	Back alignment and structure

>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263	Back alignment and structure

>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263	Back alignment and structure

>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220	Back alignment and structure

>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291	Back alignment and structure

>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291	Back alignment and structure

>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605	Back alignment and structure

>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605	Back alignment and structure

>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605	Back alignment and structure

>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347	Back alignment and structure

>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313	Back alignment and structure

>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313	Back alignment and structure

>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312	Back alignment and structure

>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312	Back alignment and structure

>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312	Back alignment and structure

>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592	Back alignment and structure

>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198	Back alignment and structure

>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198	Back alignment and structure

>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229	Back alignment and structure

>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		577
2a5y_B		549	CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis	99.96
3sfz_A		1249	APAF-1, apoptotic peptidase activating factor 1; a	99.89
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	99.88
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	99.88
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	99.87
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	99.86
2id5_A		477	Lingo-1, leucine rich repeat neuronal 6A; CNS-spec	99.86
1xku_A		330	Decorin; proteoglycan, leucine-rich repeat, struct	99.85
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	99.84
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	99.84
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	99.84
1ogq_A		313	PGIP-2, polygalacturonase inhibiting protein; inhi	99.84
1o6v_A		466	Internalin A; bacterial infection, extracellular r	99.84
3bz5_A		457	Internalin-J, INLJ; leucine rich repeat (LRR), cys	99.84
2z66_A		306	Variable lymphocyte receptor B, TOLL-like recepto;	99.84
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	99.83
2ft3_A		332	Biglycan; proteoglycan, dimer interface, structura	99.83
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	99.83
3zyi_A		452	Leucine-rich repeat-containing protein 4; cell adh	99.82
3zyj_A		440	Leucine-rich repeat-containing protein 4C; cell ad	99.82
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	99.82
3v47_A		455	TOLL-like receptor 5B and variable lymphocyte REC	99.82
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	99.82
2id5_A		477	Lingo-1, leucine rich repeat neuronal 6A; CNS-spec	99.81
2z80_A		353	TOLL-like receptor 2, variable lymphocyte recepto;	99.81
1o6v_A		466	Internalin A; bacterial infection, extracellular r	99.81
3v47_A		455	TOLL-like receptor 5B and variable lymphocyte REC	99.81
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	99.81
3a79_B		562	TLR6, VLRB.59, TOLL-like receptor 6, variable lymp	99.8
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	99.8
1z6t_A		591	APAF-1, apoptotic protease activating factor 1; ca	99.8
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	99.8
2z7x_B		520	TOLL-like receptor 1, variable lymphocyte recepto;	99.8
3bz5_A		457	Internalin-J, INLJ; leucine rich repeat (LRR), cys	99.8
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	99.79
2z80_A		353	TOLL-like receptor 2, variable lymphocyte recepto;	99.79
2z7x_B		520	TOLL-like receptor 1, variable lymphocyte recepto;	99.78
1ogq_A		313	PGIP-2, polygalacturonase inhibiting protein; inhi	99.78
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	99.78
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	99.77
3a79_B		562	TLR6, VLRB.59, TOLL-like receptor 6, variable lymp	99.77
2ft3_A		332	Biglycan; proteoglycan, dimer interface, structura	99.77
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	99.77
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	99.77
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	99.77
1ozn_A		285	Reticulon 4 receptor; NOGO receptor, MAD, myelinat	99.77
3zyj_A		440	Leucine-rich repeat-containing protein 4C; cell ad	99.77
3zyi_A		452	Leucine-rich repeat-containing protein 4; cell adh	99.77
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	99.77
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	99.77
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	99.76
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	99.76
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	99.76
2z66_A		306	Variable lymphocyte receptor B, TOLL-like recepto;	99.76
1xku_A		330	Decorin; proteoglycan, leucine-rich repeat, struct	99.76
1ozn_A		285	Reticulon 4 receptor; NOGO receptor, MAD, myelinat	99.75
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	99.75
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	99.75
3o53_A		317	Protein LRIM1, AGAP006348-PA; leucine-rich repeat,	99.75
1h6u_A		308	Internalin H; cell adhesion, leucine rich repeat,	99.74
1h6u_A		308	Internalin H; cell adhesion, leucine rich repeat,	99.74
2o6q_A		270	Variable lymphocyte receptor A; leucine-rich repea	99.74
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	99.73
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	99.73
1p9a_G		290	Platelet glycoprotein IB alpha chain precursor; pl	99.73
4g8a_A		635	TOLL-like receptor 4; leucine rich repeat MD-2 rel	99.72
3o53_A		317	Protein LRIM1, AGAP006348-PA; leucine-rich repeat,	99.71
3rfs_A		272	Internalin B, repeat modules, variable lymphocyte	99.71
2o6q_A		270	Variable lymphocyte receptor A; leucine-rich repea	99.71
2xwt_C		239	Thyrotropin receptor; signaling protein-immune sys	99.7
1p9a_G		290	Platelet glycoprotein IB alpha chain precursor; pl	99.7
3rfs_A		272	Internalin B, repeat modules, variable lymphocyte	99.7
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	99.7
2z62_A		276	TOLL-like receptor 4, variable lymphocyte recepto;	99.69
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	99.69
2xwt_C		239	Thyrotropin receptor; signaling protein-immune sys	99.69
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	99.68
1h6t_A		291	Internalin B; cell adhesion, leucine rich repeat,	99.68
2z62_A		276	TOLL-like receptor 4, variable lymphocyte recepto;	99.68
4g8a_A		635	TOLL-like receptor 4; leucine rich repeat MD-2 rel	99.67
1wwl_A		312	Monocyte differentiation antigen CD14; LPS, immune	99.67
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	99.67
1m9s_A		605	Internalin B; cell invasion, GW domains, SH3 domai	99.64
4ay9_X		350	Follicle-stimulating hormone receptor; hormone-rec	99.62
1wwl_A		312	Monocyte differentiation antigen CD14; LPS, immune	99.62
3m19_A		251	Variable lymphocyte receptor A diversity region; a	99.62
4ay9_X		350	Follicle-stimulating hormone receptor; hormone-rec	99.62
1h6t_A		291	Internalin B; cell adhesion, leucine rich repeat,	99.6
3m19_A		251	Variable lymphocyte receptor A diversity region; a	99.6
4glp_A		310	Monocyte differentiation antigen CD14; alpha beta	99.57
2ca6_A		386	RAN GTPase-activating protein 1; GAP, GTPase activ	99.56
2ast_B		336	S-phase kinase-associated protein 2; SCF-substrate	99.55
1m9s_A		605	Internalin B; cell invasion, GW domains, SH3 domai	99.54
4ezg_A		197	Putative uncharacterized protein; internalin-A, le	99.54
1xeu_A		263	Internalin C; cellular invasion, leucine-rich repe	99.54
2ast_B		336	S-phase kinase-associated protein 2; SCF-substrate	99.54
4ezg_A		197	Putative uncharacterized protein; internalin-A, le	99.53
2v9t_B		220	SLIT homolog 2 protein N-product; structural prote	99.53
3cvr_A		571	Invasion plasmid antigen; leucine rich repeat and	99.5
1xeu_A		263	Internalin C; cellular invasion, leucine-rich repe	99.5
3e6j_A		229	Variable lymphocyte receptor diversity region; var	99.5
2v70_A		220	SLIT-2, SLIT homolog 2 protein N-product; neurogen	99.49
3cvr_A		571	Invasion plasmid antigen; leucine rich repeat and	99.48
2o6s_A		208	Variable lymphocyte receptor B; leucine-rich repea	99.46
4glp_A		310	Monocyte differentiation antigen CD14; alpha beta	99.46
2o6s_A		208	Variable lymphocyte receptor B; leucine-rich repea	99.46
2v9t_B		220	SLIT homolog 2 protein N-product; structural prote	99.46
3e6j_A		229	Variable lymphocyte receptor diversity region; var	99.45
2ca6_A		386	RAN GTPase-activating protein 1; GAP, GTPase activ	99.45
3goz_A		362	Leucine-rich repeat-containing protein; LEGL7, NES	99.44
2xot_A		361	Amphoterin-induced protein 1; cell adhesion, neuro	99.42
1z7x_W		461	Ribonuclease inhibitor; leucine-rich repeat, enzym	99.41
1z7x_W		461	Ribonuclease inhibitor; leucine-rich repeat, enzym	99.4
2ell_A		168	Acidic leucine-rich nuclear phosphoprotein 32 FAM	99.4
2v70_A		220	SLIT-2, SLIT homolog 2 protein N-product; neurogen	99.39
2je0_A		149	Acidic leucine-rich nuclear phosphoprotein 32 FAM	99.38
2ell_A		168	Acidic leucine-rich nuclear phosphoprotein 32 FAM	99.38
3ogk_B		592	Coronatine-insensitive protein 1; leucine rich rep	99.36
2xot_A		361	Amphoterin-induced protein 1; cell adhesion, neuro	99.36
2je0_A		149	Acidic leucine-rich nuclear phosphoprotein 32 FAM	99.36
1a9n_A		176	U2A', U2A'; complex (nuclear protein/RNA), RNA, sn	99.36
3goz_A		362	Leucine-rich repeat-containing protein; LEGL7, NES	99.34
1a9n_A		176	U2A', U2A'; complex (nuclear protein/RNA), RNA, sn	99.34
3ogk_B		592	Coronatine-insensitive protein 1; leucine rich rep	99.33
2wfh_A		193	SLIT homolog 2 protein C-product; developmental pr	99.33
2o6r_A		177	Variable lymphocyte receptor B; leucine-rich repea	99.32
1w8a_A		192	SLIT protein; signaling protein, secreted protein,	99.32
2wfh_A		193	SLIT homolog 2 protein C-product; developmental pr	99.31
1w8a_A		192	SLIT protein; signaling protein, secreted protein,	99.31
4b8c_D		727	Glucose-repressible alcohol dehydrogenase transcr	99.27
1dce_A		567	Protein (RAB geranylgeranyltransferase alpha subun	99.26
4b8c_D		727	Glucose-repressible alcohol dehydrogenase transcr	99.22
1dce_A		567	Protein (RAB geranylgeranyltransferase alpha subun	99.22
2p1m_B		594	Transport inhibitor response 1 protein; F-BOX, leu	99.2
2p1m_B		594	Transport inhibitor response 1 protein; F-BOX, leu	99.19
2o6r_A		177	Variable lymphocyte receptor B; leucine-rich repea	99.17
1ds9_A		198	Outer arm dynein; leucine-rich repeat, beta-BETA-a	99.14
2r9u_A		174	Variable lymphocyte receptor; adaptive immunity, V	99.14
3g39_A		170	Variable lymphocyte receptor VLRB.2D; antibody, X-	99.12
2r9u_A		174	Variable lymphocyte receptor; adaptive immunity, V	99.1
3g39_A		170	Variable lymphocyte receptor VLRB.2D; antibody, X-	99.03
1ds9_A		198	Outer arm dynein; leucine-rich repeat, beta-BETA-a	99.03
2ifg_A		347	High affinity nerve growth factor receptor; TRK, T	98.75
3sb4_A		329	Hypothetical leucine rich repeat protein; LRR, rig	98.74
3sb4_A		329	Hypothetical leucine rich repeat protein; LRR, rig	98.73
2ifg_A		347	High affinity nerve growth factor receptor; TRK, T	98.7
4fdw_A		401	Leucine rich hypothetical protein; putative cell s	98.68
4fdw_A		401	Leucine rich hypothetical protein; putative cell s	98.65
2qen_A		350	Walker-type ATPase; unknown function; HET: ADP; 2.	98.41
3un9_A		372	NLR family member X1; leucine rich repeat (LRR), a	98.37
2fna_A		357	Conserved hypothetical protein; structural genomic	98.35
3un9_A		372	NLR family member X1; leucine rich repeat (LRR), a	98.3
1njg_A		250	DNA polymerase III subunit gamma; rossman-like fol	98.28
1w5s_A		412	Origin recognition complex subunit 2 ORC2; replica	98.22
2ra8_A		362	Uncharacterized protein Q64V53_bacfr; WGR domain,	98.1
2ra8_A		362	Uncharacterized protein Q64V53_bacfr; WGR domain,	97.89
3e4g_A		176	ATP synthase subunit S, mitochondrial; leucine-ric	97.85
3e4g_A		176	ATP synthase subunit S, mitochondrial; leucine-ric	97.83
1io0_A		185	Tropomodulin; LRR protein, right-handed super-heli	97.81
2chg_A		226	Replication factor C small subunit; DNA-binding pr	97.81
3rw6_A		267	Nuclear RNA export factor 1; retroviral constituti	97.75
2qby_A		386	CDC6 homolog 1, cell division control protein 6 ho	97.7
4gt6_A		394	Cell surface protein; leucine rich repeats, putati	97.64
1sxj_B		323	Activator 1 37 kDa subunit; clamp loader, processi	97.59
1io0_A		185	Tropomodulin; LRR protein, right-handed super-heli	97.57
4fs7_A		394	Uncharacterized protein; leucine-rich repeats, pro	97.56
2qby_B		384	CDC6 homolog 3, cell division control protein 6 ho	97.56
2v1u_A		387	Cell division control protein 6 homolog; DNA repli	97.46
3rw6_A		267	Nuclear RNA export factor 1; retroviral constituti	97.42
1fnn_A		389	CDC6P, cell division control protein 6; ORC1, AAA	97.33
4fs7_A		394	Uncharacterized protein; leucine-rich repeats, pro	97.14
4h09_A		379	Hypothetical leucine rich repeat protein; two LRR_	96.75
1iqp_A		327	RFCS; clamp loader, extended AAA-ATPase domain, co	96.71
1jr3_A		373	DNA polymerase III subunit gamma; processivity, pr	96.64
2chq_A		319	Replication factor C small subunit; DNA-binding pr	96.37
4gt6_A		394	Cell surface protein; leucine rich repeats, putati	96.25
1hqc_A		324	RUVB; extended AAA-ATPase domain, complex with nuc	96.1
3h4m_A		285	Proteasome-activating nucleotidase; ATPase, PAN, A	95.73
4h09_A		379	Hypothetical leucine rich repeat protein; two LRR_	95.12
3rfe_A		130	Platelet glycoprotein IB beta chain; platelet surf	95.04
3bos_A		242	Putative DNA replication factor; P-loop containing	95.0
3rfe_A		130	Platelet glycoprotein IB beta chain; platelet surf	94.81
2qz4_A		262	Paraplegin; AAA+, SPG7, protease, ADP, structural	94.32
1sxj_E		354	Activator 1 40 kDa subunit; clamp loader, processi	93.64
3te6_A		318	Regulatory protein SIR3; heterochromatin, gene sil	93.6
3d8b_A		357	Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s	93.44
1jbk_A		195	CLPB protein; beta barrel, chaperone; 1.80A {Esche	93.22
3eie_A		322	Vacuolar protein sorting-associated protein 4; AAA	92.86
1sxj_D		353	Activator 1 41 kDa subunit; clamp loader, processi	92.4
3syl_A		309	Protein CBBX; photosynthesis, rubisco activase, AA	92.14
1d2n_A		272	N-ethylmaleimide-sensitive fusion protein; hexamer	92.13
3pfi_A		338	Holliday junction ATP-dependent DNA helicase RUVB;	91.88
1xwi_A		322	SKD1 protein; VPS4B, AAA ATPase, protein transport	91.66
1pgv_A		197	TMD-1, tropomodulin TMD-1; structural genomics, PS	91.62
3u61_B		324	DNA polymerase accessory protein 44; AAA+, ATP hyd	91.21
1sxj_A		516	Activator 1 95 kDa subunit; clamp loader, processi	91.16
3pvs_A		447	Replication-associated recombination protein A; ma	90.96
3vfd_A		389	Spastin; ATPase, microtubule severing, hydrolase;	90.32
2qp9_X		355	Vacuolar protein sorting-associated protein 4; ATP	90.0
1pgv_A		197	TMD-1, tropomodulin TMD-1; structural genomics, PS	89.96
2zan_A		444	Vacuolar protein sorting-associating protein 4B; S	89.83
3b9p_A		297	CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc	88.03
3cf0_A		301	Transitional endoplasmic reticulum ATPase; AAA, P9	88.01
1a5t_A		334	Delta prime, HOLB; zinc finger, DNA replication; 2	87.61
2p65_A		187	Hypothetical protein PF08_0063; CLPB, malaria, str	84.07
3uk6_A		368	RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding	83.85
2z4s_A		440	Chromosomal replication initiator protein DNAA; AA	83.83
1l8q_A		324	Chromosomal replication initiator protein DNAA; AA	83.38
1sxj_C		340	Activator 1 40 kDa subunit; clamp loader, processi	83.2
1r6b_X		758	CLPA protein; AAA+, N-terminal domain, CLPS, cryst	83.1
4b4t_J		405	26S protease regulatory subunit 8 homolog; hydrola	82.41
2r62_A		268	Cell division protease FTSH homolog; ATPase domain	80.1

>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A*	Back alignment and structure

Probab=99.96  E-value=4.4e-29  Score=267.05  Aligned_cols=221  Identities=15%  Similarity=0.064  Sum_probs=169.2

Q ss_pred             cccHHHHHHHHHHhhcC--CCceEEEEEeccc--------------------------h-------------hHHHHHHH
Q 037229           35 VGLESTFDQVWSCLVEE--EQVGIIGLYGMEG--------------------------W-------------IQEQIRRK   73 (577)
Q Consensus        35 vGr~~~~~~i~~~L~~~--~~~~vv~I~G~gG--------------------------w-------------~~~~i~~~   73 (577)
                      |||++++++|.++|...  .+++||+||||||                          |             ++++|+.+
T Consensus       131 ~GR~~~~~~l~~~L~~~~~~~~~vv~I~G~gGvGKTtLA~~v~~~~~~~~~~~F~~~~wv~vs~~~~~~~~~~~~~il~~  210 (549)
T 2a5y_B          131 YIREYHVDRVIKKLDEMCDLDSFFLFLHGRAGSGKSVIASQALSKSDQLIGINYDSIVWLKDSGTAPKSTFDLFTDILLM  210 (549)
T ss_dssp             CCCHHHHHHHHHHHHHHTTSSSEEEEEECSTTSSHHHHHHHHHHHCSSTBTTTBSEEEEEECCCCSTTHHHHHHHHHHHH
T ss_pred             CCchHHHHHHHHHHhcccCCCceEEEEEcCCCCCHHHHHHHHHHhhhHHHhccCCcEEEEEECCCCCCCHHHHHHHHHHH
Confidence            69999999999999764  4689999999999                          2             45667777


Q ss_pred             hCCCcc-----hhccCCHHHHHHHHHHhcc-c-cEEEEEecCCChhhhcccCCCCCCCCCCcEEEEEeCchhhhhcCC-C
Q 037229           74 LGLVDD-----LWARKGLEEKAMNIFGILS-K-EFVLCWMMCGSELILTQMGVPVPNPKRMSKVLFTTRFVEVYGHKE-A  145 (577)
Q Consensus        74 l~~~~~-----~~~~~~~~~~~~~l~~~L~-k-r~LlVLDdv~~~~~~~~l~~~~~~~~~gsrIivTTR~~~v~~~~~-~  145 (577)
                      ++....     ..+..+.+.++..+++.|+ + ||||||||||+.+++ .+.     ..+||+||||||++.++..++ .
T Consensus       211 l~~~~~~~~~~~~~~~~~~~l~~~l~~~L~~~kr~LlVLDdv~~~~~~-~~~-----~~~gs~ilvTTR~~~v~~~~~~~  284 (549)
T 2a5y_B          211 LKSEDDLLNFPSVEHVTSVVLKRMICNALIDRPNTLFVFDDVVQEETI-RWA-----QELRLRCLVTTRDVEISNAASQT  284 (549)
T ss_dssp             HTTTSCCTTCCCCTTCCHHHHHHHHHHHHTTSTTEEEEEEEECCHHHH-HHH-----HHTTCEEEEEESBGGGGGGCCSC
T ss_pred             HhcCcccccccccccccHHHHHHHHHHHHcCCCcEEEEEECCCCchhh-ccc-----ccCCCEEEEEcCCHHHHHHcCCC
Confidence            765421     1123456778899999999 7 999999999998764 111     126999999999999998886 4


Q ss_pred             CceEecCCCCHHHHHHHHHHhhCCCCCCCCCChhHHHHHHHHHcCCCchHHHHHHHHHhcCCCcccc-------------
Q 037229          146 DEMFRMECLRHEEAWKLFQMKVGKETMDDHSDIPKLVEIVTKECGGLPLVLVTTARAMAYKKTIFGL-------------  212 (577)
Q Consensus       146 ~~~~~l~~L~~~~~~~Lf~~~a~~~~~~~~~~~~~~~~~i~~~c~glPLai~~~g~~L~~~~~~~~W-------------  212 (577)
                      ..+|++++|+.++||+||.++||...  .++.+.+++.+|+++|+|+|||++++|+.|+.+ . .+|             
T Consensus       285 ~~~~~l~~L~~~ea~~Lf~~~a~~~~--~~~~~~~~~~~I~~~c~GlPLAl~~~g~~l~~~-~-w~~~~~l~~~l~~~~~  360 (549)
T 2a5y_B          285 CEFIEVTSLEIDECYDFLEAYGMPMP--VGEKEEDVLNKTIELSSGNPATLMMFFKSCEPK-T-FEKMAQLNNKLESRGL  360 (549)
T ss_dssp             EEEEECCCCCHHHHHHHHHHTSCCCC----CHHHHHHHHHHHHHTTCHHHHHHHHTTCCSS-S-HHHHHHHHHHHHHHCS
T ss_pred             CeEEECCCCCHHHHHHHHHHHhcCCC--CchhHHHHHHHHHHHhCCChHHHHHHHHHhccc-h-HHHHHHhHHHhhcccH
Confidence            46899999999999999999998764  246788899999999999999999999887653 1 111             


Q ss_pred             ---------------------------------------------------cc--ccccccCCchhHHHHHHHHHHHhhc
Q 037229          213 ---------------------------------------------------AR--GILTQMIHTSGAHNERYYNIGVLRK  239 (577)
Q Consensus       213 ---------------------------------------------------a~--g~i~~~~~~~~~~~~~~~~~~~L~~  239 (577)
                                                                         |+  ||+........+++++. |+++|++
T Consensus       361 ~~i~~~l~~Sy~~L~~~lk~~f~~Ls~~er~l~~~ls~fp~~~~i~i~~w~a~~~G~i~~~~~~~~~~~~~~-~l~~L~~  439 (549)
T 2a5y_B          361 VGVECITPYSYKSLAMALQRCVEVLSDEDRSALAFAVVMPPGVDIPVKLWSCVIPVDICSNEEEQLDDEVAD-RLKRLSK  439 (549)
T ss_dssp             STTCCCSSSSSSSHHHHHHHHHHTSCHHHHHHTTGGGSSCTTCCEEHHHHHHHSCC-------CCCTHHHHH-HHHHTTT
T ss_pred             HHHHHHHhcccccccHHHHHHHhccchhhhhHhhheeeeCCCCeeeeeeeeeeccceeccCCCCCCHHHHHH-HHHHHHH
Confidence                                                               44  66655432345677777 9999999


Q ss_pred             -------cCCCCCcEEehHHHHHHHHHHHhhhhh
Q 037229          240 -------EEDGEGSVTLHDVIRDMALWIAYELAE  266 (577)
Q Consensus       240 -------~~~~~~~~~mhdli~d~~~~~~~~~~~  266 (577)
                             ..+...+|+|||++|++|+.++.+++.
T Consensus       440 rsLl~~~~~~~~~~~~mHdlv~~~a~~~~~~~~~  473 (549)
T 2a5y_B          440 RGALLSGKRMPVLTFKIDHIIHMFLKHVVDAQTI  473 (549)
T ss_dssp             BSSCSEEECSSSCEEECCHHHHHHHHTTSCTHHH
T ss_pred             cCCeeEecCCCceEEEeChHHHHHHHHHHHHHHH
Confidence                   123456899999999999988876543

PyMOL of 2a5y

>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A*	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV}	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV}	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae}	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B}	Back alignment and structure

>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens}	Back alignment and structure

>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A*	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae}	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A*	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B}	Back alignment and structure

>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A	Back alignment and structure

>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes}	Back alignment and structure

>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri}	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae}	Back alignment and structure

>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus}	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae}	Back alignment and structure

>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A	Back alignment and structure

>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens}	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A*	Back alignment and structure

>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A*	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron}	Back alignment and structure

>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens}	Back alignment and structure

>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens}	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A	Back alignment and structure

>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A*	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A*	Back alignment and structure

>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus}	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697}	Back alignment and structure

>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens}	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A*	Back alignment and structure

>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens}	Back alignment and structure

>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes}	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens}	Back alignment and structure

>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens}	Back alignment and structure

>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens}	Back alignment and structure

>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A*	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron}	Back alignment and structure

>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus}	Back alignment and structure

>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus}	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A*	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens}	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens}	Back alignment and structure

>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A*	Back alignment and structure

>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens}	Back alignment and structure

>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A*	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A*	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium}	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697}	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens}	Back alignment and structure

>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri}	Back alignment and structure

>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A*	Back alignment and structure

>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A*	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A*	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae}	Back alignment and structure

>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae}	Back alignment and structure

>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1	Back alignment and structure

>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1	Back alignment and structure

>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri}	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A*	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A*	Back alignment and structure

>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A	Back alignment and structure

>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A*	Back alignment and structure

>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae}	Back alignment and structure

>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A	Back alignment and structure

>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri}	Back alignment and structure

>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C*	Back alignment and structure

>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A	Back alignment and structure

>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A	Back alignment and structure

>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A*	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A	Back alignment and structure

>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C*	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae}	Back alignment and structure

>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A	Back alignment and structure

>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A*	Back alignment and structure

>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A*	Back alignment and structure

>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus}	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium}	Back alignment and structure

>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A	Back alignment and structure

>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C*	Back alignment and structure

>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus}	Back alignment and structure

>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A	Back alignment and structure

>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C*	Back alignment and structure

>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A	Back alignment and structure

>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A	Back alignment and structure

>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens}	Back alignment and structure

>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A	Back alignment and structure

>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A	Back alignment and structure

>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A	Back alignment and structure

>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes}	Back alignment and structure

>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes}	Back alignment and structure

>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A	Back alignment and structure

>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes}	Back alignment and structure

>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A	Back alignment and structure

>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A}	Back alignment and structure

>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes}	Back alignment and structure

>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus}	Back alignment and structure

>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens}	Back alignment and structure

>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A}	Back alignment and structure

>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri}	Back alignment and structure

>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens}	Back alignment and structure

>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri}	Back alignment and structure

>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A	Back alignment and structure

>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus}	Back alignment and structure

>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A	Back alignment and structure

>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp}	Back alignment and structure

>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus}	Back alignment and structure

>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I	Back alignment and structure

>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I	Back alignment and structure

>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A	Back alignment and structure

>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens}	Back alignment and structure

>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A	Back alignment and structure

>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A	Back alignment and structure

>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B*	Back alignment and structure

>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus}	Back alignment and structure

>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A	Back alignment and structure

>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4	Back alignment and structure

>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp}	Back alignment and structure

>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4	Back alignment and structure

>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B*	Back alignment and structure

>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens}	Back alignment and structure

>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri}	Back alignment and structure

>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7	Back alignment and structure

>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens}	Back alignment and structure

>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7	Back alignment and structure

>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C}	Back alignment and structure

>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A*	Back alignment and structure

>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C}	Back alignment and structure

>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A*	Back alignment and structure

>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B*	Back alignment and structure

>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B*	Back alignment and structure

>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri}	Back alignment and structure

>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A	Back alignment and structure

>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus}	Back alignment and structure

>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D	Back alignment and structure

>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus}	Back alignment and structure

>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D	Back alignment and structure

>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A	Back alignment and structure

>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7	Back alignment and structure

>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron}	Back alignment and structure

>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron}	Back alignment and structure

>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7	Back alignment and structure

>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A	Back alignment and structure

>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A	Back alignment and structure

>2qen_A Walker-type ATPase; unknown function; HET: ADP; 2.25A {Pyrococcus abyssi}	Back alignment and structure

>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens}	Back alignment and structure

>2fna_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE ADP; 2.00A {Sulfolobus solfataricus} SCOP: a.4.5.11 c.37.1.20	Back alignment and structure

>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens}	Back alignment and structure

>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A*	Back alignment and structure

>1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A*	Back alignment and structure

>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis}	Back alignment and structure

>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis}	Back alignment and structure

>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A	Back alignment and structure

>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A	Back alignment and structure

>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1	Back alignment and structure

>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus}	Back alignment and structure

>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A	Back alignment and structure

>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus}	Back alignment and structure

>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165}	Back alignment and structure

>1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20	Back alignment and structure

>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1	Back alignment and structure

>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus}	Back alignment and structure

>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus}	Back alignment and structure

>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix}	Back alignment and structure

>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A	Back alignment and structure

>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20	Back alignment and structure

>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus}	Back alignment and structure

>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum}	Back alignment and structure

>1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20	Back alignment and structure

>1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B*	Back alignment and structure

>2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A	Back alignment and structure

>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165}	Back alignment and structure

>1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C*	Back alignment and structure

>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii}	Back alignment and structure

>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum}	Back alignment and structure

>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A*	Back alignment and structure

>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A	Back alignment and structure

>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A*	Back alignment and structure

>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens}	Back alignment and structure

>1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20	Back alignment and structure

>3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae}	Back alignment and structure

>3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens}	Back alignment and structure

>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20	Back alignment and structure

>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C	Back alignment and structure

>1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20	Back alignment and structure

>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A*	Back alignment and structure

>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A*	Back alignment and structure

>3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp}	Back alignment and structure

>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens}	Back alignment and structure

>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1	Back alignment and structure

>3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B*	Back alignment and structure

>1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20	Back alignment and structure

>3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli}	Back alignment and structure

>3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens}	Back alignment and structure

>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A*	Back alignment and structure

>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1	Back alignment and structure

>2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A	Back alignment and structure

>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster}	Back alignment and structure

>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus}	Back alignment and structure

>1a5t_A Delta prime, HOLB; zinc finger, DNA replication; 2.20A {Escherichia coli K12} SCOP: a.80.1.1 c.37.1.20 PDB: 1jr3_E* 1xxh_E* 1xxi_E* 3glf_E* 3glg_E* 3glh_E* 3gli_E*	Back alignment and structure

>2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum}	Back alignment and structure

>3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D*	Back alignment and structure

>2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A*	Back alignment and structure

>1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A*	Back alignment and structure

>1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20	Back alignment and structure

>1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X*	Back alignment and structure

>4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae}	Back alignment and structure

>2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A*	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	E-value
Query		577
d2a5yb3		277	c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenor	3e-08
d1xkua_		305	c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99	2e-05
d2omza2		384	c.10.2.1 (A:33-416) Internalin A {Listeria monocyt	2e-05
d2omza2		384	c.10.2.1 (A:33-416) Internalin A {Listeria monocyt	0.001
d1jl5a_		353	c.10.2.6 (A:) Leucine rich effector protein YopM {	3e-05
d1jl5a_		353	c.10.2.6 (A:) Leucine rich effector protein YopM {	3e-04
d1m9la_		198	c.10.3.1 (A:) Outer arm dynein light chain 1 {Gree	0.003
d1ogqa_		313	c.10.2.8 (A:) Polygalacturonase inhibiting protein	0.003

>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Length = 277	Back information, alignment and structure


class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: CED-4, NB-ARC domain
species: Caenorhabditis elegans [TaxId: 6239]

 Score = 52.9 bits (126), Expect = 3e-08
 Identities = 13/80 (16%), Positives = 28/80 (35%), Gaps = 3/80 (3%)

Query: 128 SKVLFTTRFVEVYGH-KEADEMFRMECLRHEEAWKLFQMKVGKETMDDHSDIPKLVEIVT 186
            + L TTR VE+     +  E   +  L  +E +   +       + +      ++    
Sbjct: 158 LRCLVTTRDVEISNAASQTCEFIEVTSLEIDECYDFLEAYGMPMPVGEK--EEDVLNKTI 215

Query: 187 KECGGLPLVLVTTARAMAYK 206
           +   G P  L+   ++   K
Sbjct: 216 ELSSGNPATLMMFFKSCEPK 235

PyMOL of d2a5yb3

>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305	Back information, alignment and structure

>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384	Back information, alignment and structure

>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384	Back information, alignment and structure

>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353	Back information, alignment and structure

>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353	Back information, alignment and structure

>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Length = 198	Back information, alignment and structure

>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313	Back information, alignment and structure

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		577
d2a5yb3		277	CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI	99.94
d2omza2		384	Internalin A {Listeria monocytogenes [TaxId: 1639]	99.73
d1xkua_		305	Decorin {Cow (Bos taurus) [TaxId: 9913]}	99.72
d1p9ag_		266	von Willebrand factor binding domain of glycoprote	99.68
d2omza2		384	Internalin A {Listeria monocytogenes [TaxId: 1639]	99.67
d1ogqa_		313	Polygalacturonase inhibiting protein PGIP {Kidney	99.67
d1xkua_		305	Decorin {Cow (Bos taurus) [TaxId: 9913]}	99.67
d1h6ta2		210	Internalin B {Listeria monocytogenes [TaxId: 1639]	99.64
d1p9ag_		266	von Willebrand factor binding domain of glycoprote	99.64
d2omxa2		199	Internalin B {Listeria monocytogenes [TaxId: 1639]	99.63
d1h6ua2		227	Internalin H {Listeria monocytogenes [TaxId: 1639]	99.63
d1h6ua2		227	Internalin H {Listeria monocytogenes [TaxId: 1639]	99.6
d2omxa2		199	Internalin B {Listeria monocytogenes [TaxId: 1639]	99.59
d1ogqa_		313	Polygalacturonase inhibiting protein PGIP {Kidney	99.57
d1ozna_		284	Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma	99.57
d1h6ta2		210	Internalin B {Listeria monocytogenes [TaxId: 1639]	99.56
d1jl5a_		353	Leucine rich effector protein YopM {Yersinia pesti	99.56
d1ozna_		284	Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma	99.55
d1xwdc1		242	Follicle-stimulating hormone receptor {Human (Homo	99.48
d1jl5a_		353	Leucine rich effector protein YopM {Yersinia pesti	99.43
d1dcea3		124	Rab geranylgeranyltransferase alpha-subunit, C-ter	99.4
d1dcea3		124	Rab geranylgeranyltransferase alpha-subunit, C-ter	99.37
d1xwdc1		242	Follicle-stimulating hormone receptor {Human (Homo	99.34
d1a9na_		162	Splicesomal U2A' protein {Human (Homo sapiens) [Ta	99.34
d2astb2		284	Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa	99.31
d1a9na_		162	Splicesomal U2A' protein {Human (Homo sapiens) [Ta	99.31
d1w8aa_		192	Slit {Fruit fly (Drosophila melanogaster) [TaxId:	99.27
d2astb2		284	Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa	99.27
d1w8aa_		192	Slit {Fruit fly (Drosophila melanogaster) [TaxId:	99.17
d1m9la_		198	Outer arm dynein light chain 1 {Green algae (Chlam	99.08
d1m9la_		198	Outer arm dynein light chain 1 {Green algae (Chlam	99.03
d2ifga3		156	High affinity nerve growth factor receptor, N-term	98.9
d2ifga3		156	High affinity nerve growth factor receptor, N-term	98.76
d2ca6a1		344	Rna1p (RanGAP1), N-terminal domain {Fission yeast	98.33
d2ca6a1		344	Rna1p (RanGAP1), N-terminal domain {Fission yeast	98.1
d2fnaa2		283	Archaeal ATPase SSO1545 {Sulfolobus solfataricus [	97.7
d1koha1		162	mRNA export factor tap {Human (Homo sapiens) [TaxI	97.69
d1z7xw1		460	Ribonuclease inhibitor {Human (Homo sapiens) [TaxI	97.54
d1koha1		162	mRNA export factor tap {Human (Homo sapiens) [TaxI	97.41
d1z7xw1		460	Ribonuclease inhibitor {Human (Homo sapiens) [TaxI	97.07
d1pgva_		167	Tropomodulin C-terminal domain {nematode (Caenorha	96.75
d1pgva_		167	Tropomodulin C-terminal domain {nematode (Caenorha	96.4
d1r6bx2		268	ClpA, an Hsp100 chaperone, AAA+ modules {Escherich	95.83
d1io0a_		166	Tropomodulin C-terminal domain {Chicken (Gallus ga	95.75
d1sxjc2		227	Replication factor C3 {Baker's yeast (Saccharomyce	95.58
d1io0a_		166	Tropomodulin C-terminal domain {Chicken (Gallus ga	95.55
d1njfa_		239	delta prime subunit of DNA polymerase III, N-domai	95.43
d1sxjb2		224	Replication factor C4 {Baker's yeast (Saccharomyce	94.39
d1fnna2		276	CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T	94.07
d1sxje2		252	Replication factor C5 {Baker's yeast (Saccharomyce	93.94
d1ixza_		247	AAA domain of cell division protein FtsH {Thermus	93.59
d1sxjd2		237	Replication factor C2 {Baker's yeast (Saccharomyce	93.4
d1iqpa2		231	Replication factor C {Archaeon Pyrococcus furiosus	93.23
d1lv7a_		256	AAA domain of cell division protein FtsH {Escheric	92.18
d1e32a2		258	Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu	92.16
d1w5sa2		287	CDC6-like protein APE0152, N-terminal domain {Aero	92.13
d1a5ta2		207	delta prime subunit of DNA polymerase III, N-domai	92.02
d1jbka_		195	ClpB, AAA+ modules {Escherichia coli [TaxId: 562]}	91.6
d1qvra2		387	ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2	87.04
d1in4a2		238	Holliday junction helicase RuvB {Thermotoga mariti	82.36
d1r7ra3		265	Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu	81.78
d1l8qa2		213	Chromosomal replication initiation factor DnaA {Aq	81.46

>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]}	Back information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: CED-4, NB-ARC domain
species: Caenorhabditis elegans [TaxId: 6239]

Probab=99.94  E-value=8.5e-27  Score=224.04  Aligned_cols=172  Identities=16%  Similarity=0.079  Sum_probs=134.3

Q ss_pred             CCccccHHHHHHHHHHhhcC--CCceEEEEEeccc--------------------------h-----------h---HHH
Q 037229           32 DLTVGLESTFDQVWSCLVEE--EQVGIIGLYGMEG--------------------------W-----------I---QEQ   69 (577)
Q Consensus        32 ~~~vGr~~~~~~i~~~L~~~--~~~~vv~I~G~gG--------------------------w-----------~---~~~   69 (577)
                      ..+|||+.++++|+++|...  .+.++|+|+||||                          |           +   ...
T Consensus        20 ~~~~gR~~~~~~i~~~L~~~~~~~~~~v~I~GmgGiGKTtLA~~v~~~~~~~~~~~f~~~~Wv~vs~~~~~~~l~~~~~~   99 (277)
T d2a5yb3          20 MTCYIREYHVDRVIKKLDEMCDLDSFFLFLHGRAGSGKSVIASQALSKSDQLIGINYDSIVWLKDSGTAPKSTFDLFTDI   99 (277)
T ss_dssp             CCSCCCHHHHHHHHHHHHHHTTSSSEEEEEECSTTSSHHHHHHHHHHHCSSTBTTTBSEEEEEECCCCSTTHHHHHHHHH
T ss_pred             CceeCcHHHHHHHHHHHHhccCCCceEEEEECCCCCCHHHHHHHHHHhhhhhhhhcCceEEEEEecCCCCHHHHHHHHHH
Confidence            56899999999999999764  6789999999999                          3           2   222


Q ss_pred             HHHHhCCCcc-----hhccCCHHHHHHHHHHhcc-ccEEEEEecCCChhhhcccCCCCCCCCCCcEEEEEeCchhhhhcC
Q 037229           70 IRRKLGLVDD-----LWARKGLEEKAMNIFGILS-KEFVLCWMMCGSELILTQMGVPVPNPKRMSKVLFTTRFVEVYGHK  143 (577)
Q Consensus        70 i~~~l~~~~~-----~~~~~~~~~~~~~l~~~L~-kr~LlVLDdv~~~~~~~~l~~~~~~~~~gsrIivTTR~~~v~~~~  143 (577)
                      ++..++....     .....+.......+.+.+. +|+|+||||||+..+|+.+.      ..|||||||||++.++..+
T Consensus       100 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~L~~kr~LlVLDDv~~~~~~~~~~------~~~srilvTTR~~~v~~~~  173 (277)
T d2a5yb3         100 LLMLKSEDDLLNFPSVEHVTSVVLKRMICNALIDRPNTLFVFDDVVQEETIRWAQ------ELRLRCLVTTRDVEISNAA  173 (277)
T ss_dssp             HHHHTTTSCCTTCCCCTTCCHHHHHHHHHHHHTTSTTEEEEEEEECCHHHHHHHH------HTTCEEEEEESBGGGGGGC
T ss_pred             HHHHhcchhhcCCccchhhhhHHHHHHHHHHHhccCCeeEecchhhHHhhhhhhc------ccCceEEEEeehHHHHHhc
Confidence            2333322111     0122333445556788899 99999999999999987653      3489999999999999887


Q ss_pred             CCC-ceEecCCCCHHHHHHHHHHhhCCCCCCCCCChhHHHHHHHHHcCCCchHHHHHHHHHhcCCCcccc
Q 037229          144 EAD-EMFRMECLRHEEAWKLFQMKVGKETMDDHSDIPKLVEIVTKECGGLPLVLVTTARAMAYKKTIFGL  212 (577)
Q Consensus       144 ~~~-~~~~l~~L~~~~~~~Lf~~~a~~~~~~~~~~~~~~~~~i~~~c~glPLai~~~g~~L~~~~~~~~W  212 (577)
                      ... +.|++++|+.+|||+||+.++|...  ..+..++++++|+++|+|+|||++++|+.|+. ++.+.|
T Consensus       174 ~~~~~~~~l~~L~~~ea~~Lf~~~~~~~~--~~~~~~~~~~~iv~~c~GlPLAl~~ig~~l~~-k~~~~~  240 (277)
T d2a5yb3         174 SQTCEFIEVTSLEIDECYDFLEAYGMPMP--VGEKEEDVLNKTIELSSGNPATLMMFFKSCEP-KTFEKM  240 (277)
T ss_dssp             CSCEEEEECCCCCHHHHHHHHHHTSCCCC----CHHHHHHHHHHHHHTTCHHHHHHHHTTCCS-SSHHHH
T ss_pred             CCCCceEECCCCCHHHHHHHHHHHhCCcc--CchhhHHHHHHHHHHhCCCHHHHHHHHHHhcc-CCHHHH
Confidence            655 6899999999999999999998765  34567889999999999999999999999987 455555

PyMOL of d2a5yb3

>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]}	Back information, alignment and structure

>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]}	Back information, alignment and structure

>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]}	Back information, alignment and structure

>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]}	Back information, alignment and structure

>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}	Back information, alignment and structure

>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}	Back information, alignment and structure

>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]}	Back information, alignment and structure

>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]}	Back information, alignment and structure

>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}	Back information, alignment and structure

>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}	Back information, alignment and structure

>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]}	Back information, alignment and structure

>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]}	Back information, alignment and structure

>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]}	Back information, alignment and structure

>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]}	Back information, alignment and structure

>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]}	Back information, alignment and structure

>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]}	Back information, alignment and structure

>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]}	Back information, alignment and structure

>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]}	Back information, alignment and structure

>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]}	Back information, alignment and structure