Citrus Sinensis ID: 037352

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------19
YSEHIMEKMCPSCVSKDHHMIRRGFWTGEEDERLKSFILLNGEEGGWNWEDVPRGAGLLRCGKSCHDRWFNHLNPNIRRGDFTLEEDELIINLCRAGSKWTNIGLLLPGRTHKDVMNYCKTSYMRNKMSNRGVDLLLISDREGSHQQPHHLLLLLLLKRKTSFKKSLRPKFRRTNWMEKRAGNWIFISR
cccccccccccccccccccccccccccHHHHHHHHHHHHHHccccccccccccHHHHHHcccHHHHHHHccccccccccccccHHHHHHHHHHHHHccHHHHHHccccccccccHHHHcccHHHHHHHHHccccccccccccccccccHHHHHHHHHHccccccccccccccccccccccccccccccc
ccHHHcccccccccccHccccccccccHHHHHHHHHHHHHccccccccHcHccHHccccccHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHcHHHHHHHHccccccHHHHHHHHHHHHHHHHHHccccccccccccccccccccHHcHHHcccccHHcHHHHccccHHHHHccccccHHHHcc
ysehimekmcpscvskdhhmirrgfwtgeeDERLKSFILLngeeggwnwedvprgagllrcgkschdrwfnhlnpnirrgdftleEDELIINLCRAgskwtniglllpgrthkdvmnYCKTSymrnkmsnrGVDLLLISdregshqqpHHLLLLLLLKRKTSfkkslrpkfrrtnwmekragnwifisr
ysehimekmcpscvskdhhMIRRGFWTGEEDERLKSFILlngeeggwnwEDVPRGAGLLRCGKSCHDRWFNHLNPNIRRGDFTLEEDELIINLCragskwtniglllpgrthkdVMNYCKTSymrnkmsnRGVDLLLISDREGSHQQPHHLLLLLLLKRktsfkkslrpkfrrtnwmekragnwifisr
YSEHIMEKMCPSCVSKDHHMIRRGFWTGEEDERLKSFILLNGEEGGWNWEDVPRGAGLLRCGKSCHDRWFNHLNPNIRRGDFTLEEDELIINLCRAGSKWTNIGLLLPGRTHKDVMNYCKTSYMRNKMSNRGVDLLLISDREGSHQQPHHlllllllKRKTSFKKSLRPKFRRTNWMEKRAGNWIFISR
**********PSCVSKDHHMIRRGFWTGEEDERLKSFILLNGEEGGWNWEDVPRGAGLLRCGKSCHDRWFNHLNPNIRRGDFTLEEDELIINLCRAGSKWTNIGLLLPGRTHKDVMNYCKTSYMRNKMSNRGVDLLLISDR*****QPHHLLLLLLLKRKTSFKKSLRPKFRRTNWMEKRAGNWIFI**
************CVSKDHHMIRRGFWTGEEDERLKSFILLNGEEGGWNWEDVPRGAGLLRCGKSCHDRWFNHLNPNIRRGDFTLEEDELIINLCRAGSKWTNIGLLLPGRTHKDVMNYCKTSYMRN***********************************************************FIS*
YSEHIMEKMCPSCVSKDHHMIRRGFWTGEEDERLKSFILLNGEEGGWNWEDVPRGAGLLRCGKSCHDRWFNHLNPNIRRGDFTLEEDELIINLCRAGSKWTNIGLLLPGRTHKDVMNYCKTSYMRNKMSNRGVDLLLISDREGSHQQPHHLLLLLLLKRKTSFKKSLRPKFRRTNWMEKRAGNWIFISR
*****MEKMCPSCVSKDHHMIRRGFWTGEEDERLKSFILLNGEEGGWNWEDVPRGAGLLRCGKSCHDRWFNHLNPNIRRGDFTLEEDELIINLCRAGSKWTNIGLLLPGRTHKDVMNYCKTSYMRNKMSNRGVDLLLIS**************************************************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
YSEHIMEKMCPSCVSKDHHMIRRGFWTGEEDERLKSFILLNGEEGGWNWEDVPRGAGLLRCGKSCHDRWFNHLNPNIRRGDFTLEEDELIINLCRAGSKWTNIGLLLPGRTHKDVMNYCKTSYMRNKMSNRGVDLLLISDREGSHQQPHHLLLLLLLKRKTSFKKSLRPKFRRTNWMEKRAGNWIFISR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query189 2.2.26 [Sep-21-2011]
Q9SZP1 282 Transcription repressor M yes no 0.613 0.411 0.504 1e-24
P20025255 Myb-related protein Zm38 N/A no 0.613 0.454 0.479 9e-24
P20026267 Myb-related protein Hv1 O N/A no 0.613 0.434 0.479 1e-23
P81393232 Myb-related protein 308 O N/A no 0.682 0.556 0.460 2e-23
O49608274 Transcription factor MYB3 no no 0.613 0.423 0.479 2e-23
P81395274 Myb-related protein 330 O N/A no 0.613 0.423 0.471 3e-23
Q9FLR1 336 Transcription factor MYB2 no no 0.619 0.348 0.432 4e-22
Q9SPG5 338 Transcription factor MYB7 no no 0.693 0.387 0.402 1e-21
Q9S9K9257 Transcription factor MYB3 no no 0.613 0.451 0.471 1e-21
Q9SPG2 366 Transcription factor MYB2 no no 0.629 0.325 0.425 2e-21
>sp|Q9SZP1|MYB4_ARATH Transcription repressor MYB4 OS=Arabidopsis thaliana GN=MYB4 PE=1 SV=1 Back     alignment and function desciption
 Score =  112 bits (281), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 62/123 (50%), Positives = 81/123 (65%), Gaps = 7/123 (5%)

Query: 13  CVSKDHHMIRRGFWTGEEDERLKSFILLNGEEGGWNWEDVPRGAGLLRCGKSCHDRWFNH 72
           C  K H    +G WT EEDERL ++I  +GE     W  +P+ AGLLRCGKSC  RW N+
Sbjct: 6   CCEKAH--TNKGAWTKEEDERLVAYIKAHGE---GCWRSLPKAAGLLRCGKSCRLRWINY 60

Query: 73  LNPNIRRGDFTLEEDELIINL-CRAGSKWTNIGLLLPGRTHKDVMNYCKTSYMRNKMSNR 131
           L P+++RG+FT EEDELII L    G+KW+ I   LPGRT  ++ NY  T ++R K+ NR
Sbjct: 61  LRPDLKRGNFTEEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNT-HIRRKLINR 119

Query: 132 GVD 134
           G+D
Sbjct: 120 GID 122
Transcription repressor involved in regulation of protection against UV. Mediates transcriptional repression of CYP73A5, the gene encoding trans-cinnamate 4-monooxygenase, thereby regulating the accumulation of the UV-protectant compound sinapoylmalate.
Arabidopsis thaliana (taxid: 3702)
>sp|P20025|MYB38_MAIZE Myb-related protein Zm38 OS=Zea mays PE=2 SV=1 Back     alignment and function description
>sp|P20026|MYB1_HORVU Myb-related protein Hv1 OS=Hordeum vulgare GN=MYB1 PE=2 SV=1 Back     alignment and function description
>sp|P81393|MYB08_ANTMA Myb-related protein 308 OS=Antirrhinum majus GN=MYB308 PE=2 SV=1 Back     alignment and function description
>sp|O49608|MYB32_ARATH Transcription factor MYB32 OS=Arabidopsis thaliana GN=MYB32 PE=2 SV=1 Back     alignment and function description
>sp|P81395|MYB30_ANTMA Myb-related protein 330 OS=Antirrhinum majus GN=MYB330 PE=2 SV=1 Back     alignment and function description
>sp|Q9FLR1|MYB29_ARATH Transcription factor MYB29 OS=Arabidopsis thaliana GN=MYB29 PE=1 SV=1 Back     alignment and function description
>sp|Q9SPG5|MYB76_ARATH Transcription factor MYB76 OS=Arabidopsis thaliana GN=MYB76 PE=1 SV=1 Back     alignment and function description
>sp|Q9S9K9|MYB3_ARATH Transcription factor MYB3 OS=Arabidopsis thaliana GN=MYB3 PE=1 SV=1 Back     alignment and function description
>sp|Q9SPG2|MYB28_ARATH Transcription factor MYB28 OS=Arabidopsis thaliana GN=MYB28 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query189
363808126 303 uncharacterized protein LOC100808083 [Gl 0.613 0.382 0.504 7e-24
255645337 302 unknown [Glycine max] 0.613 0.384 0.504 9e-24
224122756 319 predicted protein [Populus trichocarpa] 0.613 0.363 0.487 3e-23
148524145 294 transcription factor MYB4 [Brassica rapa 0.783 0.503 0.440 4e-23
148524147 294 transcription factor MYB4 [Brassica rapa 0.783 0.503 0.440 4e-23
224145690 318 predicted protein [Populus trichocarpa] 0.613 0.364 0.495 4e-23
3941412282 putative transcription factor [Arabidops 0.613 0.411 0.504 5e-23
15233968282 transcription repressor MYB4 [Arabidopsi 0.613 0.411 0.504 5e-23
312283301 292 unnamed protein product [Thellungiella h 0.613 0.397 0.504 5e-23
359480894 290 PREDICTED: myb-related protein 330-like 0.613 0.4 0.487 6e-23
>gi|363808126|ref|NP_001242477.1| uncharacterized protein LOC100808083 [Glycine max] gi|255642080|gb|ACU21306.1| unknown [Glycine max] Back     alignment and taxonomy information
 Score =  115 bits (289), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 62/123 (50%), Positives = 84/123 (68%), Gaps = 7/123 (5%)

Query: 13  CVSKDHHMIRRGFWTGEEDERLKSFILLNGEEGGWNWEDVPRGAGLLRCGKSCHDRWFNH 72
           C  K+H    +G WT EEDERL ++I L+GE     W  +P+ AGLLRCGKSC  RW N+
Sbjct: 6   CCEKEH--TNKGAWTKEEDERLINYIKLHGEGC---WRSLPKAAGLLRCGKSCRLRWINY 60

Query: 73  LNPNIRRGDFTLEEDELIINL-CRAGSKWTNIGLLLPGRTHKDVMNYCKTSYMRNKMSNR 131
           L P+++RG+FT EEDELIINL    G+KW+ I   LPGRT  ++ NY  T +++ K+ +R
Sbjct: 61  LRPDLKRGNFTEEEDELIINLHSLLGNKWSLIAARLPGRTDNEIKNYWNT-HIKRKLYSR 119

Query: 132 GVD 134
           G+D
Sbjct: 120 GID 122

Source: Glycine max

Species: Glycine max

Genus: Glycine

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|255645337|gb|ACU23165.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|224122756|ref|XP_002330467.1| predicted protein [Populus trichocarpa] gi|222871879|gb|EEF09010.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|148524145|gb|ABQ81931.1| transcription factor MYB4 [Brassica rapa var. purpuraria] Back     alignment and taxonomy information
>gi|148524147|gb|ABQ81932.1| transcription factor MYB4 [Brassica rapa subsp. chinensis] gi|326631152|gb|ADZ98868.1| MYB domain protein 12 [Brassica rapa subsp. rapa] Back     alignment and taxonomy information
>gi|224145690|ref|XP_002325733.1| predicted protein [Populus trichocarpa] gi|222862608|gb|EEF00115.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|3941412|gb|AAC83582.1| putative transcription factor [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|15233968|ref|NP_195574.1| transcription repressor MYB4 [Arabidopsis thaliana] gi|56749359|sp|Q9SZP1.1|MYB4_ARATH RecName: Full=Transcription repressor MYB4; AltName: Full=Myb-related protein 4; Short=AtMYB4 gi|4467149|emb|CAB37518.1| putative transcription factor (MYB4) [Arabidopsis thaliana] gi|7270845|emb|CAB80526.1| putative transcription factor (MYB4) [Arabidopsis thaliana] gi|17979197|gb|AAL49837.1| putative transcription factor MYB4 [Arabidopsis thaliana] gi|21689787|gb|AAM67537.1| putative transcription factor MYB4 [Arabidopsis thaliana] gi|22655176|gb|AAM98178.1| putative transcription factor MYB4 [Arabidopsis thaliana] gi|30023754|gb|AAP13410.1| At4g38620 [Arabidopsis thaliana] gi|41619362|gb|AAS10085.1| MYB transcription factor [Arabidopsis thaliana] gi|332661555|gb|AEE86955.1| transcription repressor MYB4 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|312283301|dbj|BAJ34516.1| unnamed protein product [Thellungiella halophila] Back     alignment and taxonomy information
>gi|359480894|ref|XP_002268459.2| PREDICTED: myb-related protein 330-like [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query189
TAIR|locus:2059883269 MYB7 "myb domain protein 7" [A 0.613 0.431 0.495 1.7e-27
TAIR|locus:2121259 282 MYB4 "myb domain protein 4" [A 0.613 0.411 0.512 1.7e-27
TAIR|locus:2131576274 MYB32 "myb domain protein 32" 0.613 0.423 0.487 4.5e-27
TAIR|locus:2167968245 MYB99 "myb domain protein 99" 0.634 0.489 0.457 1.1e-25
TAIR|locus:2087690239 MYB10 "myb domain protein 10" 0.629 0.497 0.433 1.8e-25
TAIR|locus:2009452257 MYB3 "myb domain protein 3" [A 0.613 0.451 0.479 2.9e-25
TAIR|locus:1005716764212 HOS10 "high response to osmoti 0.613 0.547 0.447 1.6e-24
TAIR|locus:2133677236 MYB6 "myb domain protein 6" [A 0.613 0.491 0.455 1.6e-24
TAIR|locus:2162585 319 MYB49 "myb domain protein 49" 0.613 0.363 0.446 1.6e-24
TAIR|locus:2092820249 MYB5 "myb domain protein 5" [A 0.650 0.493 0.435 2e-24
TAIR|locus:2059883 MYB7 "myb domain protein 7" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 308 (113.5 bits), Expect = 1.7e-27, P = 1.7e-27
 Identities = 61/123 (49%), Positives = 84/123 (68%)

Query:    13 CVSKDHHMIRRGFWTGEEDERLKSFILLNGEEGGWNWEDVPRGAGLLRCGKSCHDRWFNH 72
             C  K+H  + +G WT EEDERL S+I  +GE  G  W  +PR AGLLRCGKSC  RW N+
Sbjct:     6 CCEKEH--MNKGAWTKEEDERLVSYIKSHGE--GC-WRSLPRAAGLLRCGKSCRLRWINY 60

Query:    73 LNPNIRRGDFTLEEDELIINL-CRAGSKWTNIGLLLPGRTHKDVMNYCKTSYMRNKMSNR 131
             L P+++RG+FT +EDELII L    G+KW+ I   LPGRT  ++ NY  T +++ K+ ++
Sbjct:    61 LRPDLKRGNFTHDEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNT-HIKRKLLSK 119

Query:   132 GVD 134
             G+D
Sbjct:   120 GID 122
GO:0003677 "DNA binding" evidence=IEA;ISS
GO:0005634 "nucleus" evidence=ISM
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=ISS
GO:0009651 "response to salt stress" evidence=IEP
GO:0009751 "response to salicylic acid stimulus" evidence=IEP
GO:0009737 "response to abscisic acid stimulus" evidence=RCA
GO:0009753 "response to jasmonic acid stimulus" evidence=RCA
GO:0009873 "ethylene mediated signaling pathway" evidence=RCA
GO:0006355 "regulation of transcription, DNA-dependent" evidence=ISS
TAIR|locus:2121259 MYB4 "myb domain protein 4" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2131576 MYB32 "myb domain protein 32" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2167968 MYB99 "myb domain protein 99" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2087690 MYB10 "myb domain protein 10" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2009452 MYB3 "myb domain protein 3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:1005716764 HOS10 "high response to osmotic stress 10" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2133677 MYB6 "myb domain protein 6" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2162585 MYB49 "myb domain protein 49" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2092820 MYB5 "myb domain protein 5" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
MYB4
MYB4; DNA binding / transcription factor; Encodes a R2R3 MYB protein which is involved in the response to UV-B. It functions as a repressor of target gene expression. One of its target genes encodes cinnamate 4-hydroxylase; mutants accumulate sinapate esters in their leaves. MYB4 binds to its own promoter and represses its own expression. Nuclear localization of MYB4 depends on the action of the beta importin SAD2. ; Transcription repressor involved in regulation of protection against UV. Mediates transcriptional repression of CYP73A5, the gene encoding trans-cinnamate 4-monooxygenase, [...] (282 aa)
(Arabidopsis thaliana)
Predicted Functional Partners:
C4H
C4H (CINNAMATE-4-HYDROXYLASE); trans-cinnamate 4-monooxygenase; Encodes a cinnamate-4-hydroxyla [...] (505 aa)
      • 0.954
TT4
TT4 (TRANSPARENT TESTA 4); naringenin-chalcone synthase; Encodes chalcone synthase (CHS), a key [...] (395 aa)
      • 0.914
4CL1
4CL1 (4-COUMARATE-COA LIGASE 1); 4-coumarate-CoA ligase; encodes an isoform of 4-coumarate-CoA [...] (561 aa)
      • 0.880
4CL3
4CL3; 4-coumarate-CoA ligase; encodes an isoform of 4-coumarate-CoA ligase (4CL), which is invo [...] (561 aa)
      • 0.874
TT8
TT8 (TRANSPARENT TESTA 8); DNA binding / transcription factor; TT8 is a regulation factor that [...] (518 aa)
    • • 0.835
SAD2
SAD2 (SUPER SENSITIVE TO ABA AND DROUGHT2); binding / protein transporter; SAD2 (super sensitiv [...] (1040 aa)
      • 0.742
ATMYC1
myc-related transcription factor (MYC1); MYC-related protein with a basic helix-loop-helix moti [...] (580 aa)
    •   0.669
F3H
F3H (FLAVANONE 3-HYDROXYLASE); naringenin 3-dioxygenase; Encodes flavanone 3-hydroxylase that i [...] (358 aa)
      • 0.575
DFR
DFR (DIHYDROFLAVONOL 4-REDUCTASE); dihydrokaempferol 4-reductase; dihydroflavonol reductase. Ca [...] (382 aa)
      • 0.567
TT5
TT5 (TRANSPARENT TESTA 5); chalcone isomerase; Catalyzes the conversion of chalcones into flava [...] (246 aa)
      • 0.534

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query189
PLN03212249 PLN03212, PLN03212, Transcription repressor MYB5; 3e-27
PLN03091 459 PLN03091, PLN03091, hypothetical protein; Provisio 1e-25
COG5147 512 COG5147, REB1, Myb superfamily proteins, including 4e-10
pfam1392159 pfam13921, Myb_DNA-bind_6, Myb-like DNA-binding do 1e-06
pfam0024947 pfam00249, Myb_DNA-binding, Myb-like DNA-binding d 9e-06
pfam0024947 pfam00249, Myb_DNA-binding, Myb-like DNA-binding d 9e-04
smart0071749 smart00717, SANT, SANT SWI3, ADA2, N-CoR and TFIII 0.001
smart0071749 smart00717, SANT, SANT SWI3, ADA2, N-CoR and TFIII 0.002
cd0016745 cd00167, SANT, 'SWI3, ADA2, N-CoR and TFIIIB' DNA- 0.003
>gnl|CDD|178751 PLN03212, PLN03212, Transcription repressor MYB5; Provisional Back     alignment and domain information 
 Score =  102 bits (256), Expect = 3e-27
 Identities = 56/131 (42%), Positives = 82/131 (62%), Gaps = 8/131 (6%)

Query: 5   IMEKMCPSCVSKDHHMIRRGFWTGEEDERLKSFILLNGEEGGWNWEDVPRGAGLLRCGKS 64
           + +K  P C       ++RG WT EEDE L SFI    +EG   W  +P+ AGLLRCGKS
Sbjct: 10  VSKKTTPCCTKMG---MKRGPWTVEEDEILVSFI---KKEGEGRWRSLPKRAGLLRCGKS 63

Query: 65  CHDRWFNHLNPNIRRGDFTLEEDELIINLCR-AGSKWTNIGLLLPGRTHKDVMNYCKTSY 123
           C  RW N+L P+++RG  T +E++LI+ L R  G++W+ I   +PGRT  ++ NY  T +
Sbjct: 64  CRLRWMNYLRPSVKRGGITSDEEDLILRLHRLLGNRWSLIAGRIPGRTDNEIKNYWNT-H 122

Query: 124 MRNKMSNRGVD 134
           +R K+  +G+D
Sbjct: 123 LRKKLLRQGID 133

Length = 249
>gnl|CDD|215570 PLN03091, PLN03091, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|227476 COG5147, REB1, Myb superfamily proteins, including transcription factors and mRNA splicing factors [Transcription / RNA processing and modification / Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|206092 pfam13921, Myb_DNA-bind_6, Myb-like DNA-binding domain Back     alignment and domain information
>gnl|CDD|215818 pfam00249, Myb_DNA-binding, Myb-like DNA-binding domain Back     alignment and domain information
>gnl|CDD|215818 pfam00249, Myb_DNA-binding, Myb-like DNA-binding domain Back     alignment and domain information
>gnl|CDD|197842 smart00717, SANT, SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains Back     alignment and domain information
>gnl|CDD|197842 smart00717, SANT, SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains Back     alignment and domain information
>gnl|CDD|238096 cd00167, SANT, 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 189
PLN03212249 Transcription repressor MYB5; Provisional 100.0
PLN03091 459 hypothetical protein; Provisional 100.0
KOG0048238 consensus Transcription factor, Myb superfamily [T 100.0
KOG0049 939 consensus Transcription factor, Myb superfamily [T 99.79
KOG0049 939 consensus Transcription factor, Myb superfamily [T 99.77
PF1392160 Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: 99.72
COG5147 512 REB1 Myb superfamily proteins, including transcrip 99.62
KOG0050 617 consensus mRNA splicing protein CDC5 (Myb superfam 99.61
KOG0051607 consensus RNA polymerase I termination factor, Myb 99.53
PF0024948 Myb_DNA-binding: Myb-like DNA-binding domain; Inte 99.47
PF0024948 Myb_DNA-binding: Myb-like DNA-binding domain; Inte 99.46
PLN03212 249 Transcription repressor MYB5; Provisional 99.37
PF1392160 Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: 99.29
smart0071749 SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-bindi 99.23
PLN03091 459 hypothetical protein; Provisional 99.2
KOG0048 238 consensus Transcription factor, Myb superfamily [T 99.2
cd0016745 SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding do 99.14
smart0071749 SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-bindi 99.13
cd0016745 SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding do 98.97
KOG0051 607 consensus RNA polymerase I termination factor, Myb 98.76
COG5147512 REB1 Myb superfamily proteins, including transcrip 98.43
TIGR0155757 myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF c 97.98
KOG0457 438 consensus Histone acetyltransferase complex SAGA/A 97.81
TIGR02894161 DNA_bind_RsfA transcription factor, RsfA family. I 97.76
KOG0050 617 consensus mRNA splicing protein CDC5 (Myb superfam 97.65
KOG0457 438 consensus Histone acetyltransferase complex SAGA/A 97.56
TIGR0155757 myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF c 97.55
COG5259531 RSC8 RSC chromatin remodeling complex subunit RSC8 97.42
KOG1279506 consensus Chromatin remodeling factor subunit and 97.37
PF13325199 MCRS_N: N-terminal region of micro-spherule protei 97.3
KOG1279 506 consensus Chromatin remodeling factor subunit and 97.02
PF0891465 Myb_DNA-bind_2: Rap1 Myb domain; InterPro: IPR0150 97.0
COG5259 531 RSC8 RSC chromatin remodeling complex subunit RSC8 96.92
TIGR02894161 DNA_bind_RsfA transcription factor, RsfA family. I 96.84
PF1383790 Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; 96.49
PRK13923170 putative spore coat protein regulator protein YlbO 96.41
PF1383790 Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; 96.38
PF0891465 Myb_DNA-bind_2: Rap1 Myb domain; InterPro: IPR0150 96.02
COG5114 432 Histone acetyltransferase complex SAGA/ADA, subuni 95.88
PRK13923170 putative spore coat protein regulator protein YlbO 95.77
COG5114 432 Histone acetyltransferase complex SAGA/ADA, subuni 95.56
PF1387378 Myb_DNA-bind_5: Myb/SANT-like DNA-binding domain 95.16
PF1387378 Myb_DNA-bind_5: Myb/SANT-like DNA-binding domain 95.02
KOG2656 445 consensus DNA methyltransferase 1-associated prote 94.69
KOG4282 345 consensus Transcription factor GT-2 and related pr 92.41
PLN031421033 Probable chromatin-remodeling complex ATPase chain 92.2
COG5118507 BDP1 Transcription initiation factor TFIIIB, Bdp1 90.57
PF09111118 SLIDE: SLIDE; InterPro: IPR015195 The SLIDE domain 90.04
PF1277696 Myb_DNA-bind_3: Myb/SANT-like DNA-binding domain; 88.76
PF1162687 Rap1_C: TRF2-interacting telomeric protein/Rap1 - 86.7
COG5118507 BDP1 Transcription initiation factor TFIIIB, Bdp1 85.7
KOG4282 345 consensus Transcription factor GT-2 and related pr 85.32
PF0828154 Sigma70_r4_2: Sigma-70, region 4; InterPro: IPR013 85.26
PF13325199 MCRS_N: N-terminal region of micro-spherule protei 83.54
KOG1194 534 consensus Predicted DNA-binding protein, contains 82.66
PF09111118 SLIDE: SLIDE; InterPro: IPR015195 The SLIDE domain 81.47
>PLN03212 Transcription repressor MYB5; Provisional Back     alignment and domain information 
Probab=100.00  E-value=7.3e-40  Score=266.62  Aligned_cols=131  Identities=44%  Similarity=0.835  Sum_probs=122.1

Q ss_pred             cccCCCcccccCCCCcccCCCCHHHHHHHHHHHHHhCCCCCCCccccccccCCccCCCcccccccccCCCCccCCCCCHH
Q 037352            6 MEKMCPSCVSKDHHMIRRGFWTGEEDERLKSFILLNGEEGGWNWEDVPRGAGLLRCGKSCHDRWFNHLNPNIRRGDFTLE   85 (189)
Q Consensus         6 ~~~~~~~~~~~~~~~lkkg~WT~eED~~L~~~v~~~g~~~~~~W~~Ia~~~~~~Rt~~qc~~Rw~~~L~p~~~~~~WT~e   85 (189)
                      +.+.+++||.|.+  +++++||+|||++|+++|++||. .  +|..||..++++|+++||++||.++|+|.+++++||.|
T Consensus        10 ~~~~~~pcc~K~g--lKRg~WT~EEDe~L~~lV~kyG~-~--nW~~IAk~~g~gRT~KQCReRW~N~L~P~I~kgpWT~E   84 (249)
T PLN03212         10 VSKKTTPCCTKMG--MKRGPWTVEEDEILVSFIKKEGE-G--RWRSLPKRAGLLRCGKSCRLRWMNYLRPSVKRGGITSD   84 (249)
T ss_pred             CCCCCCCCcccCC--CcCCCCCHHHHHHHHHHHHHhCc-c--cHHHHHHhhhcCCCcchHHHHHHHhhchhcccCCCChH
Confidence            3456899999999  99999999999999999999997 5  99999999977899999999999999999999999999


Q ss_pred             HHHHHHHHhh-cCCccccccccCCCCCHHHHHHHHHHhhhhhhhhhcCCCCcccCCCC
Q 037352           86 EDELIINLCR-AGSKWTNIGLLLPGRTHKDVMNYCKTSYMRNKMSNRGVDLLLISDRE  142 (189)
Q Consensus        86 Ed~~L~~~v~-~g~~W~~Ia~~l~gRt~~q~k~rw~~~l~k~~~~~~~~~~~~~~~~~  142 (189)
                      ||++|++++. +|++|+.||+.|||||+++|||||+.++ ++++...++++.......
T Consensus        85 ED~lLlel~~~~GnKWs~IAk~LpGRTDnqIKNRWns~L-rK~l~r~~i~p~~~kp~~  141 (249)
T PLN03212         85 EEDLILRLHRLLGNRWSLIAGRIPGRTDNEIKNYWNTHL-RKKLLRQGIDPQTHKPLD  141 (249)
T ss_pred             HHHHHHHHHHhccccHHHHHhhcCCCCHHHHHHHHHHHH-hHHHHhcCCCCCCCCCCC
Confidence            9999999999 9999999999999999999999999999 888888898887765433

>PLN03091 hypothetical protein; Provisional Back     alignment and domain information
>KOG0048 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information
>KOG0049 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information
>KOG0049 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information
>PF13921 Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: 1A5J_A 1MBH_A 1GV5_A 1H89_C 1IDY_A 1MBK_A 1IDZ_A 1H88_C 1GVD_A 1MBG_A Back     alignment and domain information
>COG5147 REB1 Myb superfamily proteins, including transcription factors and mRNA splicing factors [Transcription / RNA processing and modification / Cell division and chromosome partitioning] Back     alignment and domain information
>KOG0050 consensus mRNA splicing protein CDC5 (Myb superfamily) [RNA processing and modification; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0051 consensus RNA polymerase I termination factor, Myb superfamily [Transcription] Back     alignment and domain information
>PF00249 Myb_DNA-binding: Myb-like DNA-binding domain; InterPro: IPR014778 The retroviral oncogene v-myb, and its cellular counterpart c-myb, encode nuclear DNA-binding proteins Back     alignment and domain information
>PF00249 Myb_DNA-binding: Myb-like DNA-binding domain; InterPro: IPR014778 The retroviral oncogene v-myb, and its cellular counterpart c-myb, encode nuclear DNA-binding proteins Back     alignment and domain information
>PLN03212 Transcription repressor MYB5; Provisional Back     alignment and domain information
>PF13921 Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: 1A5J_A 1MBH_A 1GV5_A 1H89_C 1IDY_A 1MBK_A 1IDZ_A 1H88_C 1GVD_A 1MBG_A Back     alignment and domain information
>smart00717 SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains Back     alignment and domain information
>PLN03091 hypothetical protein; Provisional Back     alignment and domain information
>KOG0048 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information
>cd00167 SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains Back     alignment and domain information
>smart00717 SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains Back     alignment and domain information
>cd00167 SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains Back     alignment and domain information
>KOG0051 consensus RNA polymerase I termination factor, Myb superfamily [Transcription] Back     alignment and domain information
>COG5147 REB1 Myb superfamily proteins, including transcription factors and mRNA splicing factors [Transcription / RNA processing and modification / Cell division and chromosome partitioning] Back     alignment and domain information
>TIGR01557 myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF class Back     alignment and domain information
>KOG0457 consensus Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] Back     alignment and domain information
>TIGR02894 DNA_bind_RsfA transcription factor, RsfA family Back     alignment and domain information
>KOG0050 consensus mRNA splicing protein CDC5 (Myb superfamily) [RNA processing and modification; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0457 consensus Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] Back     alignment and domain information
>TIGR01557 myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF class Back     alignment and domain information
>COG5259 RSC8 RSC chromatin remodeling complex subunit RSC8 [Chromatin structure and dynamics / Transcription] Back     alignment and domain information
>KOG1279 consensus Chromatin remodeling factor subunit and related transcription factors [Chromatin structure and dynamics] Back     alignment and domain information
>PF13325 MCRS_N: N-terminal region of micro-spherule protein Back     alignment and domain information
>KOG1279 consensus Chromatin remodeling factor subunit and related transcription factors [Chromatin structure and dynamics] Back     alignment and domain information
>PF08914 Myb_DNA-bind_2: Rap1 Myb domain; InterPro: IPR015010 Rap1 Myb adopts a canonical three-helix bundle tertiary structure, with the second and third helices forming a helix-turn-helix variant motif Back     alignment and domain information
>COG5259 RSC8 RSC chromatin remodeling complex subunit RSC8 [Chromatin structure and dynamics / Transcription] Back     alignment and domain information
>TIGR02894 DNA_bind_RsfA transcription factor, RsfA family Back     alignment and domain information
>PF13837 Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; PDB: 2EBI_A 2JMW_A Back     alignment and domain information
>PRK13923 putative spore coat protein regulator protein YlbO; Provisional Back     alignment and domain information
>PF13837 Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; PDB: 2EBI_A 2JMW_A Back     alignment and domain information
>PF08914 Myb_DNA-bind_2: Rap1 Myb domain; InterPro: IPR015010 Rap1 Myb adopts a canonical three-helix bundle tertiary structure, with the second and third helices forming a helix-turn-helix variant motif Back     alignment and domain information
>COG5114 Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] Back     alignment and domain information
>PRK13923 putative spore coat protein regulator protein YlbO; Provisional Back     alignment and domain information
>COG5114 Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] Back     alignment and domain information
>PF13873 Myb_DNA-bind_5: Myb/SANT-like DNA-binding domain Back     alignment and domain information
>PF13873 Myb_DNA-bind_5: Myb/SANT-like DNA-binding domain Back     alignment and domain information
>KOG2656 consensus DNA methyltransferase 1-associated protein-1 [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>KOG4282 consensus Transcription factor GT-2 and related proteins, contains trihelix DNA-binding/SANT domain [Transcription] Back     alignment and domain information
>PLN03142 Probable chromatin-remodeling complex ATPase chain; Provisional Back     alignment and domain information
>COG5118 BDP1 Transcription initiation factor TFIIIB, Bdp1 subunit [Transcription] Back     alignment and domain information
>PF09111 SLIDE: SLIDE; InterPro: IPR015195 The SLIDE domain adopts a secondary structure comprising a main core of three alpha-helices Back     alignment and domain information
>PF12776 Myb_DNA-bind_3: Myb/SANT-like DNA-binding domain; InterPro: IPR024752 This domain, found in a range of uncharacterised proteins, may be related to Myb/SANT-like DNA binding domains Back     alignment and domain information
>PF11626 Rap1_C: TRF2-interacting telomeric protein/Rap1 - C terminal domain; InterPro: IPR021661 This family of proteins represents the C-terminal domain of the protein Rap-1, which plays a distinct role in silencing at the silent mating-type loci and telomeres [] Back     alignment and domain information
>COG5118 BDP1 Transcription initiation factor TFIIIB, Bdp1 subunit [Transcription] Back     alignment and domain information
>KOG4282 consensus Transcription factor GT-2 and related proteins, contains trihelix DNA-binding/SANT domain [Transcription] Back     alignment and domain information
>PF08281 Sigma70_r4_2: Sigma-70, region 4; InterPro: IPR013249 The bacterial core RNA polymerase complex, which consists of five subunits, is sufficient for transcription elongation and termination but is unable to initiate transcription Back     alignment and domain information
>PF13325 MCRS_N: N-terminal region of micro-spherule protein Back     alignment and domain information
>KOG1194 consensus Predicted DNA-binding protein, contains Myb-like, SANT and ELM2 domains [Transcription] Back     alignment and domain information
>PF09111 SLIDE: SLIDE; InterPro: IPR015195 The SLIDE domain adopts a secondary structure comprising a main core of three alpha-helices Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query189
3zqc_A131 Structure Of The Trichomonas Vaginalis Myb3 Dna-Bin 3e-14
1h8a_C128 Crystal Structure Of Ternary Protein-Dna Complex3 L 2e-13
1mse_C105 Solution Structure Of A Specific Dna Complex Of The 7e-13
1gv2_A105 Crystal Structure Of C-Myb R2r3 Length = 105 2e-12
1h88_C159 Crystal Structure Of Ternary Protein-Dna Complex1 L 3e-12
1a5j_A110 Chicken B-Myb Dna Binding Domain, Repeat 2 And Repe 7e-12
3osf_A126 The Structure Of Protozoan Parasite Trichomonas Vag 2e-07
2k9n_A107 Solution Nmr Structure Of The R2r3 Dna Binding Doma 5e-05
>pdb|3ZQC|A Chain A, Structure Of The Trichomonas Vaginalis Myb3 Dna-Binding Domain Bound To A Promoter Sequence Reveals A Unique C- Terminal Beta-Hairpin Conformation Length = 131 Back     alignment and structure 
Iteration: 1

 Score = 74.7 bits (182), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 44/122 (36%), Positives = 66/122 (54%), Gaps = 9/122 (7%)
Query: 23  RGFWTGEEDERLKSFILLNGEEGGWNWEDVPRGAGLL--RCGKSCHDRWFNHLNPNIRRG 80
           +G +T  ED+ ++ ++  NG +   NW   PR    L  R  K C +RWFNHL+P + + 
Sbjct: 2   KGPFTEAEDDLIREYVKENGPQ---NW---PRITSFLPNRSPKQCRERWFNHLDPAVVKH 55
Query: 81  DFTLEEDELII-NLCRAGSKWTNIGLLLPGRTHKDVMNYCKTSYMRNKMSNRGVDLLLIS 139
            +T EEDE I  N  + GSKW+ I  L+PGRT   + N   +S  +   +N     +L+ 
Sbjct: 56  AWTPEEDETIFRNYLKLGSKWSVIAKLIPGRTDNAIKNRWNSSISKRISTNSNHKEILLP 115
Query: 140 DR 141
           DR
Sbjct: 116 DR 117
>pdb|1H8A|C Chain C, Crystal Structure Of Ternary Protein-Dna Complex3 Length = 128 Back     alignment and structure
>pdb|1MSE|C Chain C, Solution Structure Of A Specific Dna Complex Of The Myb Dna- Binding Domain With Cooperative Recognition Helices Length = 105 Back     alignment and structure
>pdb|1GV2|A Chain A, Crystal Structure Of C-Myb R2r3 Length = 105 Back     alignment and structure
>pdb|1H88|C Chain C, Crystal Structure Of Ternary Protein-Dna Complex1 Length = 159 Back     alignment and structure
>pdb|1A5J|A Chain A, Chicken B-Myb Dna Binding Domain, Repeat 2 And Repeat3, Nmr, 32 Structures Length = 110 Back     alignment and structure
>pdb|3OSF|A Chain A, The Structure Of Protozoan Parasite Trichomonas Vaginalis Myb2 In Complex With Mre-2f-13 Dna Length = 126 Back     alignment and structure
>pdb|2K9N|A Chain A, Solution Nmr Structure Of The R2r3 Dna Binding Domain Of Myb1 Protein From Protozoan Parasite Trichomonas Vaginalis Length = 107 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query189
1h8a_C128 AMV V-MYB, MYB transforming protein; transcription 9e-31
1h8a_C128 AMV V-MYB, MYB transforming protein; transcription 1e-12
3zqc_A131 MYB3; transcription-DNA complex, DNA-binding prote 2e-30
1gv2_A105 C-MYB, MYB proto-oncogene protein; transcription, 2e-30
3osg_A126 MYB21; transcription-DNA complex, MYB2, R2R3 domai 3e-30
1h89_C159 C-MYB, MYB proto-oncogene protein; transcription/D 9e-29
1h89_C159 C-MYB, MYB proto-oncogene protein; transcription/D 1e-20
2k9n_A107 MYB24; R2R3 domain, DNA-binding, nucleus, DNA bind 4e-28
2dim_A70 Cell division cycle 5-like protein; MYB_DNA-bindin 2e-16
2dim_A70 Cell division cycle 5-like protein; MYB_DNA-bindin 4e-04
1gvd_A52 MYB proto-oncogene protein; transcription, transcr 1e-14
1guu_A52 C-MYB, MYB proto-oncogene protein; transcription, 4e-12
2d9a_A60 B-MYB, MYB-related protein B; DNA binding, structu 3e-10
2d9a_A60 B-MYB, MYB-related protein B; DNA binding, structu 5e-04
2din_A66 Cell division cycle 5-like protein; MYB_DNA-bindin 3e-06
>1h8a_C AMV V-MYB, MYB transforming protein; transcription/DNA; 2.23A {Avian myeloblastosis virus} SCOP: a.4.1.3 a.4.1.3 Length = 128 Back     alignment and structure
 Score =  108 bits (271), Expect = 9e-31
 Identities = 41/109 (37%), Positives = 60/109 (55%), Gaps = 6/109 (5%)

Query: 21  IRRGFWTGEEDERLKSFILLNGEEGGWNWEDVPRGAGLLRCGKSCHDRWFNHLNPNIRRG 80
           + +G WT EED+R+   +   G      W D+ +     R GK C +RW NHLNP +++ 
Sbjct: 25  LNKGPWTKEEDQRVIEHVQKYGP---KRWSDIAKHLKG-RIGKQCRERWHNHLNPEVKKT 80

Query: 81  DFTLEEDELIINL-CRAGSKWTNIGLLLPGRTHKDVMNYCKTSYMRNKM 128
            +T EED +I     R G++W  I  LLPGRT   V N+  ++ MR K+
Sbjct: 81  SWTEEEDRIIYQAHKRLGNRWAEIAKLLPGRTDNAVKNHWNST-MRRKV 128
>1h8a_C AMV V-MYB, MYB transforming protein; transcription/DNA; 2.23A {Avian myeloblastosis virus} SCOP: a.4.1.3 a.4.1.3 Length = 128 Back     alignment and structure
>3zqc_A MYB3; transcription-DNA complex, DNA-binding protein, nucleus; 2.90A {Trichomonas vaginalis} Length = 131 Back     alignment and structure
>1gv2_A C-MYB, MYB proto-oncogene protein; transcription, DNA binding, ION binding; 1.68A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 PDB: 1mse_C* 1msf_C* 1a5j_A 1idy_A 1idz_A 1mbj_A 1mbk_A Length = 105 Back     alignment and structure
>3osg_A MYB21; transcription-DNA complex, MYB2, R2R3 domain, DNA binding PR transcription factor; 2.00A {Trichomonas vaginalis} PDB: 3osf_A Length = 126 Back     alignment and structure
>1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C Length = 159 Back     alignment and structure
>1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C Length = 159 Back     alignment and structure
>2k9n_A MYB24; R2R3 domain, DNA-binding, nucleus, DNA binding protein; NMR {Trichomonas vaginalis} PDB: 2kdz_A Length = 107 Back     alignment and structure
>2dim_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2dim_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>1gvd_A MYB proto-oncogene protein; transcription, transcription regulation, C-MYB, DNA binding, ION binding, nuclear protein; 1.45A {Mus musculus} SCOP: a.4.1.3 PDB: 1gv5_A 1mbg_A 1mbh_A Length = 52 Back     alignment and structure
>1guu_A C-MYB, MYB proto-oncogene protein; transcription, transcription regulation, DNA binding, ION bindi proto-oncogene, nuclear protein, activator; 1.6A {Mus musculus} SCOP: a.4.1.3 PDB: 1mbe_A 1mbf_A Length = 52 Back     alignment and structure
>2d9a_A B-MYB, MYB-related protein B; DNA binding, structural genomics, unknown function, NPPSFA; NMR {Mus musculus} Length = 60 Back     alignment and structure
>2d9a_A B-MYB, MYB-related protein B; DNA binding, structural genomics, unknown function, NPPSFA; NMR {Mus musculus} Length = 60 Back     alignment and structure
>2din_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 66 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query189
1h8a_C128 AMV V-MYB, MYB transforming protein; transcription 100.0
1gv2_A105 C-MYB, MYB proto-oncogene protein; transcription, 100.0
3zqc_A131 MYB3; transcription-DNA complex, DNA-binding prote 100.0
2k9n_A107 MYB24; R2R3 domain, DNA-binding, nucleus, DNA bind 100.0
3osg_A126 MYB21; transcription-DNA complex, MYB2, R2R3 domai 100.0
1h89_C159 C-MYB, MYB proto-oncogene protein; transcription/D 100.0
1h89_C159 C-MYB, MYB proto-oncogene protein; transcription/D 99.97
1h8a_C128 AMV V-MYB, MYB transforming protein; transcription 99.88
2dim_A70 Cell division cycle 5-like protein; MYB_DNA-bindin 99.87
2llk_A73 Cyclin-D-binding MYB-like transcription factor 1; 99.76
1ign_A246 Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, 99.74
1gvd_A52 MYB proto-oncogene protein; transcription, transcr 99.74
2d9a_A60 B-MYB, MYB-related protein B; DNA binding, structu 99.73
2cu7_A72 KIAA1915 protein; nuclear protein, SANT domain, DN 99.73
2juh_A121 Telomere binding protein TBP1; helix, nucleus, nuc 99.72
2din_A66 Cell division cycle 5-like protein; MYB_DNA-bindin 99.72
1guu_A52 C-MYB, MYB proto-oncogene protein; transcription, 99.72
2roh_A122 RTBP1, telomere binding protein-1; plant, nucleus, 99.69
1ity_A69 TRF1; helix-turn-helix, telomeres, DNA binding, MY 99.69
2d9a_A60 B-MYB, MYB-related protein B; DNA binding, structu 99.67
3sjm_A64 Telomeric repeat-binding factor 2; human telomeric 99.66
1guu_A52 C-MYB, MYB proto-oncogene protein; transcription, 99.66
1gvd_A52 MYB proto-oncogene protein; transcription, transcr 99.65
1x41_A60 Transcriptional adaptor 2-like, isoform B; transcr 99.64
1w0t_A53 Telomeric repeat binding factor 1; telomere, DNA-b 99.63
1ity_A69 TRF1; helix-turn-helix, telomeres, DNA binding, MY 99.63
1x41_A60 Transcriptional adaptor 2-like, isoform B; transcr 99.63
2dim_A70 Cell division cycle 5-like protein; MYB_DNA-bindin 99.62
3zqc_A131 MYB3; transcription-DNA complex, DNA-binding prote 99.62
2din_A66 Cell division cycle 5-like protein; MYB_DNA-bindin 99.62
1w0t_A53 Telomeric repeat binding factor 1; telomere, DNA-b 99.61
2yum_A75 ZZZ3 protein, zinc finger ZZ-type-containing prote 99.6
2elk_A58 SPCC24B10.08C protein; hypothetical protein, struc 99.6
2yum_A75 ZZZ3 protein, zinc finger ZZ-type-containing prote 99.58
2elk_A58 SPCC24B10.08C protein; hypothetical protein, struc 99.58
2ltp_A89 Nuclear receptor corepressor 2; SMRT, TRAC, SGC, s 99.35
3sjm_A64 Telomeric repeat-binding factor 2; human telomeric 99.56
2cu7_A72 KIAA1915 protein; nuclear protein, SANT domain, DN 99.56
1gv2_A105 C-MYB, MYB proto-oncogene protein; transcription, 99.51
3osg_A126 MYB21; transcription-DNA complex, MYB2, R2R3 domai 99.51
2llk_A73 Cyclin-D-binding MYB-like transcription factor 1; 99.5
2cqr_A73 RSGI RUH-043, DNAJ homolog subfamily C member 1; m 99.48
2k9n_A107 MYB24; R2R3 domain, DNA-binding, nucleus, DNA bind 99.47
2ckx_A83 NGTRF1, telomere binding protein TBP1; nuclear pro 99.47
2ltp_A89 Nuclear receptor corepressor 2; SMRT, TRAC, SGC, s 99.17
2yus_A79 SWI/SNF-related matrix-associated actin- dependent 99.43
2aje_A105 Telomere repeat-binding protein; DNA-binding, Trp, 99.42
2yus_A79 SWI/SNF-related matrix-associated actin- dependent 99.4
2cjj_A93 Radialis; plant development, DNA-binding protein, 99.35
2cqr_A73 RSGI RUH-043, DNAJ homolog subfamily C member 1; m 99.35
1x58_A62 Hypothetical protein 4930532D21RIK; MUS musculus a 99.34
1ign_A 246 Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, 99.33
2ckx_A83 NGTRF1, telomere binding protein TBP1; nuclear pro 99.33
2aje_A105 Telomere repeat-binding protein; DNA-binding, Trp, 99.29
2juh_A121 Telomere binding protein TBP1; helix, nucleus, nuc 99.26
2roh_A122 RTBP1, telomere binding protein-1; plant, nucleus, 99.18
2cjj_A93 Radialis; plant development, DNA-binding protein, 99.1
2eqr_A61 N-COR1, N-COR, nuclear receptor corepressor 1; SAN 99.02
3hm5_A93 DNA methyltransferase 1-associated protein 1; DNA 98.99
2cqq_A72 RSGI RUH-037, DNAJ homolog subfamily C member 1; m 98.98
1x58_A62 Hypothetical protein 4930532D21RIK; MUS musculus a 98.96
2eqr_A61 N-COR1, N-COR, nuclear receptor corepressor 1; SAN 98.82
2iw5_B235 Protein corest, REST corepressor 1; oxidoreductase 98.73
2cqq_A72 RSGI RUH-037, DNAJ homolog subfamily C member 1; m 98.66
1wgx_A73 KIAA1903 protein; MYB DNA-binding domain, human cD 98.63
1wgx_A73 KIAA1903 protein; MYB DNA-binding domain, human cD 98.54
1fex_A59 TRF2-interacting telomeric RAP1 protein; helix tur 98.47
1fex_A59 TRF2-interacting telomeric RAP1 protein; helix tur 98.45
2xag_B482 REST corepressor 1; amine oxidase, chromatin regul 98.43
2iw5_B235 Protein corest, REST corepressor 1; oxidoreductase 98.43
4eef_G74 F-HB80.4, designed hemagglutinin binding protein; 98.28
4eef_G74 F-HB80.4, designed hemagglutinin binding protein; 98.2
1ug2_A95 2610100B20RIK gene product; hypothetical protein, 98.19
2lr8_A70 CAsp8-associated protein 2; structural genomics, n 97.49
2yqk_A63 Arginine-glutamic acid dipeptide repeats protein; 98.12
4iej_A93 DNA methyltransferase 1-associated protein 1; DNA 97.87
2yqk_A63 Arginine-glutamic acid dipeptide repeats protein; 97.8
1ofc_X304 ISWI protein; nuclear protein, chromatin remodelin 97.76
4a69_C94 Nuclear receptor corepressor 2; transcription, hyd 97.69
2crg_A70 Metastasis associated protein MTA3; transcription 97.65
2xag_B482 REST corepressor 1; amine oxidase, chromatin regul 97.62
3hm5_A93 DNA methyltransferase 1-associated protein 1; DNA 97.59
4a69_C94 Nuclear receptor corepressor 2; transcription, hyd 97.35
2crg_A70 Metastasis associated protein MTA3; transcription 97.32
2lr8_A70 CAsp8-associated protein 2; structural genomics, n 96.3
2ebi_A86 DNA binding protein GT-1; DNA-binding domain, phos 97.12
2ebi_A86 DNA binding protein GT-1; DNA-binding domain, phos 97.1
1ug2_A95 2610100B20RIK gene product; hypothetical protein, 96.93
2y9y_A374 Imitation switch protein 1 (DEL_ATPase); transcrip 95.8
4iej_A93 DNA methyltransferase 1-associated protein 1; DNA 95.44
4b4c_A211 Chromodomain-helicase-DNA-binding protein 1; chrom 93.15
1irz_A64 ARR10-B; helix-turn-helix, DNA binding protein; NM 91.98
2xb0_X270 Chromo domain-containing protein 1; hydrolase, DNA 91.97
1ofc_X304 ISWI protein; nuclear protein, chromatin remodelin 90.45
1irz_A64 ARR10-B; helix-turn-helix, DNA binding protein; NM 89.66
4b4c_A211 Chromodomain-helicase-DNA-binding protein 1; chrom 87.77
>1h8a_C AMV V-MYB, MYB transforming protein; transcription/DNA; 2.23A {Avian myeloblastosis virus} SCOP: a.4.1.3 a.4.1.3 Back     alignment and structure
Probab=100.00  E-value=8.4e-38  Score=234.65  Aligned_cols=121  Identities=34%  Similarity=0.669  Sum_probs=99.0

Q ss_pred             cccccccCCCcccccCC----CCcccCCCCHHHHHHHHHHHHHhCCCCCCCccccccccCCccCCCcccccccccCCCCc
Q 037352            2 SEHIMEKMCPSCVSKDH----HMIRRGFWTGEEDERLKSFILLNGEEGGWNWEDVPRGAGLLRCGKSCHDRWFNHLNPNI   77 (189)
Q Consensus         2 ~~~~~~~~~~~~~~~~~----~~lkkg~WT~eED~~L~~~v~~~g~~~~~~W~~Ia~~~~~~Rt~~qc~~Rw~~~L~p~~   77 (189)
                      |+.|.+++..+|..+..    |.+++|+||+|||++|+++|.+||. +  +|..||..|+ ||++.||++||.++|+|.+
T Consensus         2 a~~~~~Rt~~qC~~Rw~~~l~p~~~k~~Wt~eED~~L~~~v~~~g~-~--~W~~Ia~~l~-~Rt~~qcr~Rw~~~l~p~~   77 (128)
T 1h8a_C            2 EAVIKNRTDVQCQHRWQKVLNPELNKGPWTKEEDQRVIEHVQKYGP-K--RWSDIAKHLK-GRIGKQCRERWHNHLNPEV   77 (128)
T ss_dssp             --------------------CTTCCCSCCCHHHHHHHHHHHHHTCS-C--CHHHHHHHSS-SCCHHHHHHHHHHTTCSSS
T ss_pred             ccccCCCCHHHHHHHHHHhhCCCCCCCCCCHHHHHHHHHHHHHHCC-C--CHHHHHHHhc-CCcHHHHHHHHHHhccccc
Confidence            57889999999998765    6789999999999999999999997 5  8999999995 8999999999999999999


Q ss_pred             cCCCCCHHHHHHHHHHhh-cCCccccccccCCCCCHHHHHHHHHHhhhhhh
Q 037352           78 RRGDFTLEEDELIINLCR-AGSKWTNIGLLLPGRTHKDVMNYCKTSYMRNK  127 (189)
Q Consensus        78 ~~~~WT~eEd~~L~~~v~-~g~~W~~Ia~~l~gRt~~q~k~rw~~~l~k~~  127 (189)
                      ++++||+|||++|+++|. ||++|+.||+.|||||+++|++||+.++ +++
T Consensus        78 ~~~~WT~eEd~~L~~~~~~~G~~W~~Ia~~l~gRt~~~~k~r~~~~~-~~~  127 (128)
T 1h8a_C           78 KKTSWTEEEDRIIYQAHKRLGNRWAEIAKLLPGRTDNAVKNHWNSTM-RRK  127 (128)
T ss_dssp             CCSCCCHHHHHHHHHHHHHHCSCHHHHGGGSTTCCHHHHHHHHHTTT-TC-
T ss_pred             ccccCCHHHHHHHHHHHHHHCcCHHHHHHHCCCCCHHHHHHHHHHHH-hcc
Confidence            999999999999999999 9999999999999999999999999998 544
>1gv2_A C-MYB, MYB proto-oncogene protein; transcription, DNA binding, ION binding; 1.68A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 PDB: 1mse_C* 1msf_C* 1a5j_A 1idy_A 1idz_A 1mbj_A 1mbk_A Back     alignment and structure
>3zqc_A MYB3; transcription-DNA complex, DNA-binding protein, nucleus; 2.90A {Trichomonas vaginalis} Back     alignment and structure
>2k9n_A MYB24; R2R3 domain, DNA-binding, nucleus, DNA binding protein; NMR {Trichomonas vaginalis} PDB: 2kdz_A Back     alignment and structure
>3osg_A MYB21; transcription-DNA complex, MYB2, R2R3 domain, DNA binding PR transcription factor; 2.00A {Trichomonas vaginalis} PDB: 3osf_A Back     alignment and structure
>1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C Back     alignment and structure
>1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C Back     alignment and structure
>1h8a_C AMV V-MYB, MYB transforming protein; transcription/DNA; 2.23A {Avian myeloblastosis virus} SCOP: a.4.1.3 a.4.1.3 Back     alignment and structure
>2dim_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2llk_A Cyclin-D-binding MYB-like transcription factor 1; helix bundle, SGC, structural genomics consortium, NESG, NOR structural genomics consortium; NMR {Homo sapiens} Back     alignment and structure
>1ign_A Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, DNA binding protein/DNA complex; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.6 a.4.1.6 PDB: 3ukg_A Back     alignment and structure
>1gvd_A MYB proto-oncogene protein; transcription, transcription regulation, C-MYB, DNA binding, ION binding, nuclear protein; 1.45A {Mus musculus} SCOP: a.4.1.3 PDB: 1gv5_A 1mbg_A 1mbh_A Back     alignment and structure
>2d9a_A B-MYB, MYB-related protein B; DNA binding, structural genomics, unknown function, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2cu7_A KIAA1915 protein; nuclear protein, SANT domain, DNA binding, regulation of transcription, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>2juh_A Telomere binding protein TBP1; helix, nucleus, nuclear protein; NMR {Nicotiana glutinosa} Back     alignment and structure
>2din_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1guu_A C-MYB, MYB proto-oncogene protein; transcription, transcription regulation, DNA binding, ION bindi proto-oncogene, nuclear protein, activator; 1.6A {Mus musculus} SCOP: a.4.1.3 PDB: 1mbe_A 1mbf_A Back     alignment and structure
>2roh_A RTBP1, telomere binding protein-1; plant, nucleus, DNA binding protein; NMR {Oryza sativa} Back     alignment and structure
>1ity_A TRF1; helix-turn-helix, telomeres, DNA binding, MYB domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1iv6_A Back     alignment and structure
>2d9a_A B-MYB, MYB-related protein B; DNA binding, structural genomics, unknown function, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>3sjm_A Telomeric repeat-binding factor 2; human telomeric repeat binding protein 2, telomere, telomeri homeodomain proteins amino acid sequence; HET: DNA; 1.35A {Homo sapiens} PDB: 1xg1_A 1vfc_A 1vf9_A 1w0u_A Back     alignment and structure
>1guu_A C-MYB, MYB proto-oncogene protein; transcription, transcription regulation, DNA binding, ION bindi proto-oncogene, nuclear protein, activator; 1.6A {Mus musculus} SCOP: a.4.1.3 PDB: 1mbe_A 1mbf_A Back     alignment and structure
>1gvd_A MYB proto-oncogene protein; transcription, transcription regulation, C-MYB, DNA binding, ION binding, nuclear protein; 1.45A {Mus musculus} SCOP: a.4.1.3 PDB: 1gv5_A 1mbg_A 1mbh_A Back     alignment and structure
>1x41_A Transcriptional adaptor 2-like, isoform B; transcriptional adaptor protein2, transcriptional activation, MYB domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1w0t_A Telomeric repeat binding factor 1; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle; 2.00A {Homo sapiens} SCOP: a.4.1.4 PDB: 1ba5_A Back     alignment and structure
>1ity_A TRF1; helix-turn-helix, telomeres, DNA binding, MYB domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1iv6_A Back     alignment and structure
>1x41_A Transcriptional adaptor 2-like, isoform B; transcriptional adaptor protein2, transcriptional activation, MYB domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2dim_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3zqc_A MYB3; transcription-DNA complex, DNA-binding protein, nucleus; 2.90A {Trichomonas vaginalis} Back     alignment and structure
>2din_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1w0t_A Telomeric repeat binding factor 1; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle; 2.00A {Homo sapiens} SCOP: a.4.1.4 PDB: 1ba5_A Back     alignment and structure
>2yum_A ZZZ3 protein, zinc finger ZZ-type-containing protein 3; transcription, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2elk_A SPCC24B10.08C protein; hypothetical protein, structural genomics, NPPSFA; NMR {Schizosaccharomyces pombe} Back     alignment and structure
>2yum_A ZZZ3 protein, zinc finger ZZ-type-containing protein 3; transcription, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2elk_A SPCC24B10.08C protein; hypothetical protein, structural genomics, NPPSFA; NMR {Schizosaccharomyces pombe} Back     alignment and structure
>2ltp_A Nuclear receptor corepressor 2; SMRT, TRAC, SGC, structural genomics consortium, NESG, north structural genomics consortium; NMR {Homo sapiens} Back     alignment and structure
>3sjm_A Telomeric repeat-binding factor 2; human telomeric repeat binding protein 2, telomere, telomeri homeodomain proteins amino acid sequence; HET: DNA; 1.35A {Homo sapiens} PDB: 1xg1_A 1vfc_A 1vf9_A 1w0u_A Back     alignment and structure
>2cu7_A KIAA1915 protein; nuclear protein, SANT domain, DNA binding, regulation of transcription, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>1gv2_A C-MYB, MYB proto-oncogene protein; transcription, DNA binding, ION binding; 1.68A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 PDB: 1mse_C* 1msf_C* 1a5j_A 1idy_A 1idz_A 1mbj_A 1mbk_A Back     alignment and structure
>3osg_A MYB21; transcription-DNA complex, MYB2, R2R3 domain, DNA binding PR transcription factor; 2.00A {Trichomonas vaginalis} PDB: 3osf_A Back     alignment and structure
>2llk_A Cyclin-D-binding MYB-like transcription factor 1; helix bundle, SGC, structural genomics consortium, NESG, NOR structural genomics consortium; NMR {Homo sapiens} Back     alignment and structure
>2cqr_A RSGI RUH-043, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>2k9n_A MYB24; R2R3 domain, DNA-binding, nucleus, DNA binding protein; NMR {Trichomonas vaginalis} PDB: 2kdz_A Back     alignment and structure
>2ckx_A NGTRF1, telomere binding protein TBP1; nuclear protein; 1.9A {Nicotiana tabacum} SCOP: a.4.1.3 PDB: 2qhb_A Back     alignment and structure
>2ltp_A Nuclear receptor corepressor 2; SMRT, TRAC, SGC, structural genomics consortium, NESG, north structural genomics consortium; NMR {Homo sapiens} Back     alignment and structure
>2yus_A SWI/SNF-related matrix-associated actin- dependent regulator of chromatin subfamily...; SWI/SNF complex 155 kDa subunit, BRG1-associated factor 155; NMR {Homo sapiens} Back     alignment and structure
>2aje_A Telomere repeat-binding protein; DNA-binding, Trp, MYB motif, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.3 Back     alignment and structure
>2yus_A SWI/SNF-related matrix-associated actin- dependent regulator of chromatin subfamily...; SWI/SNF complex 155 kDa subunit, BRG1-associated factor 155; NMR {Homo sapiens} Back     alignment and structure
>2cjj_A Radialis; plant development, DNA-binding protein, MYB transcription FA DNA-binding, nuclear protein, floral asymmetry; 1.9A {Antirrhinum majus} SCOP: a.4.1.3 Back     alignment and structure
>2cqr_A RSGI RUH-043, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>1x58_A Hypothetical protein 4930532D21RIK; MUS musculus adult MALE testis cDNA, riken FULL-length enriched library, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>1ign_A Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, DNA binding protein/DNA complex; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.6 a.4.1.6 PDB: 3ukg_A Back     alignment and structure
>2ckx_A NGTRF1, telomere binding protein TBP1; nuclear protein; 1.9A {Nicotiana tabacum} SCOP: a.4.1.3 PDB: 2qhb_A Back     alignment and structure
>2aje_A Telomere repeat-binding protein; DNA-binding, Trp, MYB motif, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.3 Back     alignment and structure
>2juh_A Telomere binding protein TBP1; helix, nucleus, nuclear protein; NMR {Nicotiana glutinosa} Back     alignment and structure
>2roh_A RTBP1, telomere binding protein-1; plant, nucleus, DNA binding protein; NMR {Oryza sativa} Back     alignment and structure
>2cjj_A Radialis; plant development, DNA-binding protein, MYB transcription FA DNA-binding, nuclear protein, floral asymmetry; 1.9A {Antirrhinum majus} SCOP: a.4.1.3 Back     alignment and structure
>2eqr_A N-COR1, N-COR, nuclear receptor corepressor 1; SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3hm5_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin, structural genomics consortium, SGC, activator, chromatin regulator; HET: DNA; 1.80A {Homo sapiens} Back     alignment and structure
>2cqq_A RSGI RUH-037, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>1x58_A Hypothetical protein 4930532D21RIK; MUS musculus adult MALE testis cDNA, riken FULL-length enriched library, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2eqr_A N-COR1, N-COR, nuclear receptor corepressor 1; SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2iw5_B Protein corest, REST corepressor 1; oxidoreductase-transcription regulator complex, oxidoreductase/repressor complex, histone demethylase, FAD; HET: FAD; 2.57A {Homo sapiens} SCOP: a.4.1.3 PDB: 2uxn_B* 2uxx_B* 2y48_B* 2v1d_B* 2x0l_B* Back     alignment and structure
>2cqq_A RSGI RUH-037, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>1wgx_A KIAA1903 protein; MYB DNA-binding domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>1wgx_A KIAA1903 protein; MYB DNA-binding domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>1fex_A TRF2-interacting telomeric RAP1 protein; helix turn helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Synthetic} SCOP: a.4.1.3 Back     alignment and structure
>1fex_A TRF2-interacting telomeric RAP1 protein; helix turn helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Synthetic} SCOP: a.4.1.3 Back     alignment and structure
>2xag_B REST corepressor 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_B* 2xah_B* 2xaj_B* 2xaq_B* 2xas_B* Back     alignment and structure
>2iw5_B Protein corest, REST corepressor 1; oxidoreductase-transcription regulator complex, oxidoreductase/repressor complex, histone demethylase, FAD; HET: FAD; 2.57A {Homo sapiens} SCOP: a.4.1.3 PDB: 2uxn_B* 2uxx_B* 2y48_B* 2v1d_B* 2x0l_B* Back     alignment and structure
>4eef_G F-HB80.4, designed hemagglutinin binding protein; immunoglobulin, fusion of virus membrane with membrane, membrane fusion, sialic acid, virion; HET: NAG BMA; 2.70A {Artificial gene} Back     alignment and structure
>4eef_G F-HB80.4, designed hemagglutinin binding protein; immunoglobulin, fusion of virus membrane with membrane, membrane fusion, sialic acid, virion; HET: NAG BMA; 2.70A {Artificial gene} Back     alignment and structure
>1ug2_A 2610100B20RIK gene product; hypothetical protein, MYB-like DNA binding domain, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: a.4.1.3 Back     alignment and structure
>2lr8_A CAsp8-associated protein 2; structural genomics, northeast structural genomics consortiu PSI-biology, apoptosis; NMR {Homo sapiens} Back     alignment and structure
>2yqk_A Arginine-glutamic acid dipeptide repeats protein; structure genomics, SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4iej_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin regulator, repressor, structural joint center for structural genomics; HET: DNA; 1.45A {Homo sapiens} PDB: 3hm5_A* Back     alignment and structure
>2yqk_A Arginine-glutamic acid dipeptide repeats protein; structure genomics, SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1ofc_X ISWI protein; nuclear protein, chromatin remodeling factor, ATPase, SANT domain, nucleosome recognition; HET: GLC G4D; 1.9A {Drosophila melanogaster} SCOP: a.4.1.3 a.4.1.13 a.187.1.1 PDB: 2nog_A Back     alignment and structure
>4a69_C Nuclear receptor corepressor 2; transcription, hydrolase; HET: I0P; 2.06A {Homo sapiens} PDB: 1xc5_A Back     alignment and structure
>2crg_A Metastasis associated protein MTA3; transcription factor, helix turn helix, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.3 Back     alignment and structure
>2xag_B REST corepressor 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_B* 2xah_B* 2xaj_B* 2xaq_B* 2xas_B* Back     alignment and structure
>3hm5_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin, structural genomics consortium, SGC, activator, chromatin regulator; HET: DNA; 1.80A {Homo sapiens} Back     alignment and structure
>4a69_C Nuclear receptor corepressor 2; transcription, hydrolase; HET: I0P; 2.06A {Homo sapiens} PDB: 1xc5_A Back     alignment and structure
>2crg_A Metastasis associated protein MTA3; transcription factor, helix turn helix, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.3 Back     alignment and structure
>2lr8_A CAsp8-associated protein 2; structural genomics, northeast structural genomics consortiu PSI-biology, apoptosis; NMR {Homo sapiens} Back     alignment and structure
>2ebi_A DNA binding protein GT-1; DNA-binding domain, phosphorylation; HET: DNA; NMR {Arabidopsis thaliana} PDB: 2jmw_A* Back     alignment and structure
>2ebi_A DNA binding protein GT-1; DNA-binding domain, phosphorylation; HET: DNA; NMR {Arabidopsis thaliana} PDB: 2jmw_A* Back     alignment and structure
>1ug2_A 2610100B20RIK gene product; hypothetical protein, MYB-like DNA binding domain, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: a.4.1.3 Back     alignment and structure
>2y9y_A Imitation switch protein 1 (DEL_ATPase); transcription, nuclear protein complex, chromatin remodeling nucleosome remodeling; 3.25A {Saccharomyces cerevisiae} PDB: 2y9z_A Back     alignment and structure
>4iej_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin regulator, repressor, structural joint center for structural genomics; HET: DNA; 1.45A {Homo sapiens} PDB: 3hm5_A* Back     alignment and structure
>4b4c_A Chromodomain-helicase-DNA-binding protein 1; chromatin-remodeling, histone acetylation COMP chromatin regulation, transcription; 1.62A {Homo sapiens} Back     alignment and structure
>1irz_A ARR10-B; helix-turn-helix, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.11 Back     alignment and structure
>2xb0_X Chromo domain-containing protein 1; hydrolase, DNA-binding protein, transcription, chromatin REG; HET: GOL; 2.00A {Saccharomyces cerevisiae} PDB: 3ted_A Back     alignment and structure
>1ofc_X ISWI protein; nuclear protein, chromatin remodeling factor, ATPase, SANT domain, nucleosome recognition; HET: GLC G4D; 1.9A {Drosophila melanogaster} SCOP: a.4.1.3 a.4.1.13 a.187.1.1 PDB: 2nog_A Back     alignment and structure
>1irz_A ARR10-B; helix-turn-helix, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.11 Back     alignment and structure
>4b4c_A Chromodomain-helicase-DNA-binding protein 1; chromatin-remodeling, histone acetylation COMP chromatin regulation, transcription; 1.62A {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 189
d1igna186 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Ba 3e-13
d1igna186 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Ba 4e-04
d1gvda_52 a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus 7e-11
d1guua_50 a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus 4e-10
d2ckxa183 a.4.1.3 (A:578-660) Telomere binding protein TBP1 5e-09
d1w0ua_55 a.4.1.4 (A:) Telomeric repeat binding factor 2, TR 5e-08
d1w0ta_52 a.4.1.4 (A:) DNA-binding domain of human telomeric 2e-07
d2cu7a165 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sap 1e-06
d2cqra160 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 3e-05
d1x41a147 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, T 6e-04
d2cjja163 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Anti 0.002
d1gv2a247 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mou 0.003
d1xc5a168 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 0.004
>d1igna1 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 86 Back     information, alignment and structure

class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: DNA-binding domain of rap1
domain: DNA-binding domain of rap1
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

 Score = 60.3 bits (146), Expect = 3e-13
 Identities = 13/89 (14%), Positives = 28/89 (31%), Gaps = 6/89 (6%)

Query: 23  RGFWTGEEDERLKSFILLNGEEGGWNWEDVPRGAGLL--RCGKSCHDRWFNHLNPNIRRG 80
           +  +T EEDE +   +  N              +  +    G S   R+  +L+  +   
Sbjct: 1   KASFTDEEDEFILDVVRKNPT-RRTTHTLYDEISHYVPNHTGNSIRHRFRVYLSKRLEYV 59

Query: 81  DFTLEEDELIINLCRAGSKWTNIGLLLPG 109
               +  +L+ +            +L P 
Sbjct: 60  YEVDKFGKLVRD---DDGNLIKTKVLPPS 85
>d1igna1 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 86 Back     information, alignment and structure
>d1gvda_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 52 Back     information, alignment and structure
>d1guua_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 50 Back     information, alignment and structure
>d2ckxa1 a.4.1.3 (A:578-660) Telomere binding protein TBP1 {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Length = 83 Back     information, alignment and structure
>d1w0ua_ a.4.1.4 (A:) Telomeric repeat binding factor 2, TRF2 {Human (Homo sapiens) [TaxId: 9606]} Length = 55 Back     information, alignment and structure
>d1w0ta_ a.4.1.4 (A:) DNA-binding domain of human telomeric protein, hTRF1 {Human (Homo sapiens) [TaxId: 9606]} Length = 52 Back     information, alignment and structure
>d2cu7a1 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d2cqra1 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 60 Back     information, alignment and structure
>d1x41a1 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, TADA2L, isoform b {Human (Homo sapiens) [TaxId: 9606]} Length = 47 Back     information, alignment and structure
>d2cjja1 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Antirrhinum majus) [TaxId: 4151]} Length = 63 Back     information, alignment and structure
>d1gv2a2 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 47 Back     information, alignment and structure
>d1xc5a1 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 68 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query189
d1igna186 DNA-binding domain of rap1 {Baker's yeast (Sacchar 99.79
d1gvda_52 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.79
d1gv2a247 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.73
d1guua_50 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.73
d1gvda_52 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.69
d1guua_50 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.62
d2ckxa183 Telomere binding protein TBP1 {Tobacco (Nicotiana 99.61
d1w0ua_55 Telomeric repeat binding factor 2, TRF2 {Human (Ho 99.61
d1gv2a247 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.58
d1w0ta_52 DNA-binding domain of human telomeric protein, hTR 99.55
d1igna186 DNA-binding domain of rap1 {Baker's yeast (Sacchar 99.54
d1w0ta_52 DNA-binding domain of human telomeric protein, hTR 99.52
d1x41a147 Transcriptional adaptor 2-like, TADA2L, isoform b 99.51
d1w0ua_55 Telomeric repeat binding factor 2, TRF2 {Human (Ho 99.5
d2cu7a165 MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 960 99.46
d1x41a147 Transcriptional adaptor 2-like, TADA2L, isoform b 99.46
d2cqra160 DnaJ homolog subfamily C member 1 {Human (Homo sap 99.45
d2cqra160 DnaJ homolog subfamily C member 1 {Human (Homo sap 99.45
d2cu7a165 MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 960 99.39
d2cjja163 Radialis {Garden snapdragon (Antirrhinum majus) [T 99.39
d1ug2a_95 2610100b20rik gene product {Mouse (Mus musculus) [ 99.37
d2cjja163 Radialis {Garden snapdragon (Antirrhinum majus) [T 99.31
d2ckxa183 Telomere binding protein TBP1 {Tobacco (Nicotiana 99.28
d2iw5b165 REST corepressor 1, CoREST {Human (Homo sapiens) [ 99.23
d1xc5a168 Nuclear receptor corepressor 2 {Human (Homo sapien 99.22
d2iw5b165 REST corepressor 1, CoREST {Human (Homo sapiens) [ 99.09
d1xc5a168 Nuclear receptor corepressor 2 {Human (Homo sapien 99.0
d1ug2a_95 2610100b20rik gene product {Mouse (Mus musculus) [ 98.79
d2crga157 Metastasis associated protein MTA3 {Mouse (Mus mus 98.2
d2cqqa159 DnaJ homolog subfamily C member 1 {Human (Homo sap 98.14
d2cqqa159 DnaJ homolog subfamily C member 1 {Human (Homo sap 98.07
d2crga157 Metastasis associated protein MTA3 {Mouse (Mus mus 98.06
d1x58a149 Hypothetical protein 4930532d21rik {Mouse (Mus mus 97.57
d1fexa_59 Rap1 {Human (Homo sapiens) [TaxId: 9606]} 97.29
d1fexa_59 Rap1 {Human (Homo sapiens) [TaxId: 9606]} 96.78
d1wgxa_73 Hypothetical protein C14orf106 (KIAA1903) {Human ( 96.42
d1irza_64 Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId 96.08
d1wgxa_73 Hypothetical protein C14orf106 (KIAA1903) {Human ( 95.99
d1irza_64 Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId 95.76
d1x58a149 Hypothetical protein 4930532d21rik {Mouse (Mus mus 95.48
d1ofcx152 SANT domain of the nucleosome remodeling ATPase IS 83.86
>d1igna1 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: DNA-binding domain of rap1
domain: DNA-binding domain of rap1
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

Probab=99.79  E-value=2.3e-22  Score=138.86  Aligned_cols=72  Identities=15%  Similarity=0.082  Sum_probs=64.5

Q ss_pred             cCCCCHHHHHHHHHHHHHhCCC--CCCCccccccccCCccCCCcccccccccCCCCccCCCCCHHHHHHHHHHhh
Q 037352           23 RGFWTGEEDERLKSFILLNGEE--GGWNWEDVPRGAGLLRCGKSCHDRWFNHLNPNIRRGDFTLEEDELIINLCR   95 (189)
Q Consensus        23 kg~WT~eED~~L~~~v~~~g~~--~~~~W~~Ia~~~~~~Rt~~qc~~Rw~~~L~p~~~~~~WT~eEd~~L~~~v~   95 (189)
                      |++||+|||++|+++|.+||..  ...+|..||..|+ |||+.||++||.++|+|.+++++||.+||.+|++++.
T Consensus         1 k~~WT~eED~~L~~~v~~~g~~~~~~~~W~~IA~~lp-gRt~~qcr~Rw~~~L~p~l~~~~~t~~ed~ll~d~~~   74 (86)
T d1igna1           1 KASFTDEEDEFILDVVRKNPTRRTTHTLYDEISHYVP-NHTGNSIRHRFRVYLSKRLEYVYEVDKFGKLVRDDDG   74 (86)
T ss_dssp             CCCCCHHHHHHHHHHHHTSGGGTTCSHHHHHHTTTST-TSCHHHHHHHHHHTTGGGCCCEECBCTTSCBCBCTTS
T ss_pred             CCCCCHHHHHHHHHHHHHhCcCcCCccCHHHHHHHcC-CCCHHHHHHHHHHHcCccccCCCCCCchhHHHHHHhh
Confidence            6899999999999999999861  1225999999994 9999999999999999999999999999998877664
>d1gvda_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gv2a2 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1guua_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gvda_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1guua_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ckxa1 a.4.1.3 (A:578-660) Telomere binding protein TBP1 {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1w0ua_ a.4.1.4 (A:) Telomeric repeat binding factor 2, TRF2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gv2a2 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1w0ta_ a.4.1.4 (A:) DNA-binding domain of human telomeric protein, hTRF1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1igna1 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1w0ta_ a.4.1.4 (A:) DNA-binding domain of human telomeric protein, hTRF1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x41a1 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, TADA2L, isoform b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w0ua_ a.4.1.4 (A:) Telomeric repeat binding factor 2, TRF2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cu7a1 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x41a1 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, TADA2L, isoform b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqra1 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqra1 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cu7a1 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cjja1 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Antirrhinum majus) [TaxId: 4151]} Back     information, alignment and structure
>d1ug2a_ a.4.1.3 (A:) 2610100b20rik gene product {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cjja1 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Antirrhinum majus) [TaxId: 4151]} Back     information, alignment and structure
>d2ckxa1 a.4.1.3 (A:578-660) Telomere binding protein TBP1 {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d2iw5b1 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xc5a1 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2iw5b1 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xc5a1 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ug2a_ a.4.1.3 (A:) 2610100b20rik gene product {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2crga1 a.4.1.3 (A:8-64) Metastasis associated protein MTA3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqqa1 a.4.1.3 (A:8-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqqa1 a.4.1.3 (A:8-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2crga1 a.4.1.3 (A:8-64) Metastasis associated protein MTA3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x58a1 a.4.1.1 (A:8-56) Hypothetical protein 4930532d21rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fexa_ a.4.1.3 (A:) Rap1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fexa_ a.4.1.3 (A:) Rap1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wgxa_ a.4.1.3 (A:) Hypothetical protein C14orf106 (KIAA1903) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1irza_ a.4.1.11 (A:) Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wgxa_ a.4.1.3 (A:) Hypothetical protein C14orf106 (KIAA1903) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1irza_ a.4.1.11 (A:) Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1x58a1 a.4.1.1 (A:8-56) Hypothetical protein 4930532d21rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ofcx1 a.4.1.3 (X:799-850) SANT domain of the nucleosome remodeling ATPase ISWI {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure