Citrus Sinensis ID: 037424
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 231 | ||||||
| 75321780 | 1447 | RecName: Full=Pleiotropic drug resistanc | 0.861 | 0.137 | 0.661 | 2e-69 | |
| 346306027 | 1172 | ABCG subfamily transporter protein [Sola | 0.861 | 0.169 | 0.632 | 7e-66 | |
| 147780242 | 1417 | hypothetical protein VITISV_037751 [Viti | 0.861 | 0.140 | 0.646 | 9e-65 | |
| 225450466 | 1448 | PREDICTED: pleiotropic drug resistance p | 0.861 | 0.137 | 0.646 | 1e-64 | |
| 224109722 | 1406 | predicted protein [Populus trichocarpa] | 0.857 | 0.140 | 0.587 | 8e-60 | |
| 356565445 | 1452 | PREDICTED: pleiotropic drug resistance p | 0.870 | 0.138 | 0.558 | 1e-58 | |
| 15231821 | 1450 | ABC transporter G family member 37 [Arab | 0.861 | 0.137 | 0.601 | 2e-58 | |
| 297816648 | 1450 | ATPDR9/PDR9 [Arabidopsis lyrata subsp. l | 0.861 | 0.137 | 0.601 | 5e-58 | |
| 224099040 | 1476 | predicted protein [Populus trichocarpa] | 0.961 | 0.150 | 0.544 | 3e-55 | |
| 255556558 | 1393 | ATP-binding cassette transporter, putati | 0.839 | 0.139 | 0.582 | 7e-54 |
| >gi|75321780|sp|Q5W274.1|PDR3_TOBAC RecName: Full=Pleiotropic drug resistance protein 3; AltName: Full=NtPDR3 gi|55056942|emb|CAH39853.1| PDR-like ABC transporter [Nicotiana tabacum] | Back alignment and taxonomy information |
|---|
Score = 268 bits (684), Expect = 2e-69, Method: Compositional matrix adjust.
Identities = 135/204 (66%), Positives = 167/204 (81%), Gaps = 5/204 (2%)
Query: 1 MAQMIGTDEIESVRIELAEIGRSLKSSFRLQTSSFRSSSAISSRRED--TDVENALQWAE 58
MAQ++G+DEIES R++LAEIGRSL+SSFR Q+SSFRS+SA+S+ ++D D EN L WA
Sbjct: 1 MAQLVGSDEIESFRMDLAEIGRSLRSSFRGQSSSFRSNSALSASQKDDAVDEENMLAWAA 60
Query: 59 IERLPTYDRLKTSLFD-VNSNKDLVDNQGKQAINVTKLGALERHVFIEKLIKHIEHDNLQ 117
IERLPT+DRL++SLF+ +N N V K+ +VTKLGALERHVFIEK+IKHIEHDNLQ
Sbjct: 61 IERLPTFDRLRSSLFEEINGNDANVKR--KRVTDVTKLGALERHVFIEKMIKHIEHDNLQ 118
Query: 118 LLRKIRKRMDKVGVKLPTIEVRYKNLWVEAKCEVVHGKPLPTLWNSFKGMISVLPKLSGY 177
LL KIRKR+DKVGV+LPT+EVRYKNL +EA+CE+VHGKPLPTLWNS K + L +L G
Sbjct: 119 LLHKIRKRIDKVGVELPTVEVRYKNLTIEAECELVHGKPLPTLWNSLKSITMNLARLPGL 178
Query: 178 KSLEAKINILNRVSGILKPGSVNL 201
+S AKI ILN VSG++KPG + L
Sbjct: 179 QSELAKIKILNDVSGVIKPGRMTL 202
|
Source: Nicotiana tabacum Species: Nicotiana tabacum Genus: Nicotiana Family: Solanaceae Order: Solanales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|346306027|gb|AEO22188.1| ABCG subfamily transporter protein [Solanum tuberosum] | Back alignment and taxonomy information |
|---|
| >gi|147780242|emb|CAN65735.1| hypothetical protein VITISV_037751 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|225450466|ref|XP_002280231.1| PREDICTED: pleiotropic drug resistance protein 3-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|224109722|ref|XP_002333208.1| predicted protein [Populus trichocarpa] gi|222835114|gb|EEE73549.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|356565445|ref|XP_003550950.1| PREDICTED: pleiotropic drug resistance protein 3-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|15231821|ref|NP_190916.1| ABC transporter G family member 37 [Arabidopsis thaliana] gi|75334941|sp|Q9LFH0.1|AB37G_ARATH RecName: Full=ABC transporter G family member 37; Short=ABC transporter ABCG.37; Short=AtABCG37; AltName: Full=Probable pleiotropic drug resistance protein 9 gi|6729499|emb|CAB67655.1| ABC transporter-like protein [Arabidopsis thaliana] gi|28144337|tpg|DAA00877.1| TPA_exp: PDR9 ABC transporter [Arabidopsis thaliana] gi|332645574|gb|AEE79095.1| ABC transporter G family member 37 [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|297816648|ref|XP_002876207.1| ATPDR9/PDR9 [Arabidopsis lyrata subsp. lyrata] gi|297322045|gb|EFH52466.1| ATPDR9/PDR9 [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|224099040|ref|XP_002311359.1| predicted protein [Populus trichocarpa] gi|222851179|gb|EEE88726.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|255556558|ref|XP_002519313.1| ATP-binding cassette transporter, putative [Ricinus communis] gi|223541628|gb|EEF43177.1| ATP-binding cassette transporter, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 231 | ||||||
| TAIR|locus:2084081 | 1450 | ABCG37 "ATP-binding cassette G | 0.861 | 0.137 | 0.563 | 1.7e-54 | |
| TAIR|locus:2049867 | 1413 | ABCG33 "ATP-binding cassette G | 0.649 | 0.106 | 0.594 | 1.4e-41 | |
| TAIR|locus:2037703 | 1442 | ABCG35 "ATP-binding cassette G | 0.770 | 0.123 | 0.394 | 1.8e-25 | |
| TAIR|locus:2025931 | 1469 | PEN3 "PENETRATION 3" [Arabidop | 0.658 | 0.103 | 0.419 | 2.3e-25 | |
| TAIR|locus:2094952 | 1416 | ABCG29 "ATP-binding cassette G | 0.619 | 0.100 | 0.411 | 2.7e-22 | |
| TAIR|locus:2044893 | 1453 | ABCG34 "ATP-binding cassette G | 0.645 | 0.102 | 0.398 | 1.6e-21 | |
| TAIR|locus:2019693 | 1454 | ABCG39 "ATP-binding cassette G | 0.844 | 0.134 | 0.345 | 3.8e-20 | |
| TAIR|locus:2196593 | 1423 | ABCG40 "ATP-binding cassette G | 0.645 | 0.104 | 0.384 | 3.4e-19 | |
| TAIR|locus:2039523 | 1420 | ABCG32 "ATP-binding cassette G | 0.640 | 0.104 | 0.324 | 9.4e-17 | |
| TAIR|locus:2045683 | 1426 | ABCG31 "ATP-binding cassette G | 0.645 | 0.104 | 0.348 | 1.8e-15 |
| TAIR|locus:2084081 ABCG37 "ATP-binding cassette G37" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 575 (207.5 bits), Expect = 1.7e-54, P = 1.7e-54
Identities = 116/206 (56%), Positives = 158/206 (76%)
Query: 1 MAQMIGTDEIESVRIELAEIGRSLKSSFRLQTXXXXXXXXXXXXXEDTDV-----ENALQ 55
MA M+G D+IES+R+ELAEIGRS++SSFR T D DV E ALQ
Sbjct: 1 MAHMVGADDIESLRVELAEIGRSIRSSFRRHTSSFRSSSSIYEVENDGDVNDHDAEYALQ 60
Query: 56 WAEIERLPTYDRLKTSLFDVNSNKDLVDNQGKQAINVTKLGALERHVFIEKLIKHIEHDN 115
WAEIERLPT R++++L D + ++ + + +G++ ++VTKLGA+ERH+ IEKLIKHIE+DN
Sbjct: 61 WAEIERLPTVKRMRSTLLD-DGDESMTE-KGRRVVDVTKLGAVERHLMIEKLIKHIENDN 118
Query: 116 LQLLRKIRKRMDKVGVKLPTIEVRYKNLWVEAKCEVVHGKPLPTLWNSFKGMISVLPKLS 175
L+LL+KIR+R+D+VG++LPTIEVRY++L V A+CEVV GK LPTLWN+ K ++S L KL+
Sbjct: 119 LKLLKKIRRRIDRVGMELPTIEVRYESLKVVAECEVVEGKALPTLWNTAKRVLSELVKLT 178
Query: 176 GYKSLEAKINILNRVSGILKPGSVNL 201
G K+ EAKINI+N V+GI+KPG + L
Sbjct: 179 GAKTHEAKINIINDVNGIIKPGRLTL 204
|
|
| TAIR|locus:2049867 ABCG33 "ATP-binding cassette G33" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2037703 ABCG35 "ATP-binding cassette G35" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2025931 PEN3 "PENETRATION 3" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2094952 ABCG29 "ATP-binding cassette G29" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2044893 ABCG34 "ATP-binding cassette G34" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2019693 ABCG39 "ATP-binding cassette G39" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2196593 ABCG40 "ATP-binding cassette G40" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2039523 ABCG32 "ATP-binding cassette G32" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2045683 ABCG31 "ATP-binding cassette G31" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| GSVIVG00022529001 | SubName- Full=Chromosome chr14 scaffold_27, whole genome shotgun sequence; (864 aa) | |||||||
(Vitis vinifera) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 231 | |||
| PLN03140 | 1470 | PLN03140, PLN03140, ABC transporter G family membe | 5e-38 | |
| TIGR00956 | 1394 | TIGR00956, 3a01205, Pleiotropic Drug Resistance (P | 0.001 |
| >gnl|CDD|215599 PLN03140, PLN03140, ABC transporter G family member; Provisional | Back alignment and domain information |
|---|
Score = 140 bits (354), Expect = 5e-38
Identities = 75/191 (39%), Positives = 109/191 (57%), Gaps = 16/191 (8%)
Query: 20 IGRSLKSSFRLQTSSFRSSSAISSRREDT--DVENALQWAEIERLPTYDRLKTSLFDVNS 77
I RS+ S R F S + S RR + + E AL+WA IE+LPTY RL+TS+
Sbjct: 12 ISRSVSRSSRNMEDVF-SGGSQSRRRTSSVDEDEEALKWAAIEKLPTYSRLRTSIM---- 66
Query: 78 NKDLVDN--QGKQAIN----VTKLGALERHVFIEKLIKHIEHDNLQLLRKIRKRMDKVGV 131
K V+N G Q ++ VTKL +R FI+ + K E DN + L+K R R+D+VG+
Sbjct: 67 -KSFVENDVYGNQLLHKEVDVTKLDGNDRQKFIDMVFKVAEEDNEKFLKKFRNRIDRVGI 125
Query: 132 KLPTIEVRYKNLWVEAKCEVVHGKPLPTLWNSFKGMISVLPKLSGYK-SLEAKINILNRV 190
KLPT+EVR+++L VEA C + + LPTL N+ + + + G + + K+ IL
Sbjct: 126 KLPTVEVRFEHLTVEADCY-IGSRALPTLPNAARNIAESALGMLGINLAKKTKLTILKDA 184
Query: 191 SGILKPGSVNL 201
SGI+KP + L
Sbjct: 185 SGIIKPSRMTL 195
|
Length = 1470 |
| >gnl|CDD|233208 TIGR00956, 3a01205, Pleiotropic Drug Resistance (PDR) Family protein | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 231 | |||
| PLN03140 | 1470 | ABC transporter G family member; Provisional | 100.0 | |
| KOG0065 | 1391 | consensus Pleiotropic drug resistance proteins (PD | 99.96 | |
| TIGR00956 | 1394 | 3a01205 Pleiotropic Drug Resistance (PDR) Family p | 99.68 | |
| KOG0061 | 613 | consensus Transporter, ABC superfamily (Breast can | 98.99 | |
| PF14510 | 85 | ABC_trans_N: ABC-transporter extracellular N-termi | 98.91 | |
| PLN03211 | 659 | ABC transporter G-25; Provisional | 98.86 | |
| COG4559 | 259 | ABC-type hemin transport system, ATPase component | 98.79 | |
| PLN03140 | 1470 | ABC transporter G family member; Provisional | 98.78 | |
| TIGR00955 | 617 | 3a01204 The Eye Pigment Precursor Transporter (EPP | 98.77 | |
| COG1131 | 293 | CcmA ABC-type multidrug transport system, ATPase c | 98.64 | |
| cd03267 | 236 | ABC_NatA_like Similar in sequence to NatA, this is | 98.62 | |
| TIGR00956 | 1394 | 3a01205 Pleiotropic Drug Resistance (PDR) Family p | 98.59 | |
| PRK14265 | 274 | phosphate ABC transporter ATP-binding protein; Pro | 98.59 | |
| cd03263 | 220 | ABC_subfamily_A The ABCA subfamily mediates the tr | 98.58 | |
| cd03255 | 218 | ABC_MJ0796_Lo1CDE_FtsE This family is comprised of | 98.57 | |
| cd03213 | 194 | ABCG_EPDR ABCG transporters are involved in eye pi | 98.56 | |
| PRK10744 | 260 | pstB phosphate transporter ATP-binding protein; Pr | 98.56 | |
| PRK13632 | 271 | cbiO cobalt transporter ATP-binding subunit; Provi | 98.56 | |
| PRK14273 | 254 | phosphate ABC transporter ATP-binding protein; Pro | 98.56 | |
| PRK14237 | 267 | phosphate transporter ATP-binding protein; Provisi | 98.54 | |
| PRK14248 | 268 | phosphate ABC transporter ATP-binding protein; Pro | 98.54 | |
| PRK14259 | 269 | phosphate ABC transporter ATP-binding protein; Pro | 98.54 | |
| cd03225 | 211 | ABC_cobalt_CbiO_domain1 Domain I of the ABC compon | 98.53 | |
| cd03301 | 213 | ABC_MalK_N The N-terminal ATPase domain of the mal | 98.53 | |
| COG1136 | 226 | SalX ABC-type antimicrobial peptide transport syst | 98.53 | |
| cd03226 | 205 | ABC_cobalt_CbiO_domain2 Domain II of the ABC compo | 98.53 | |
| PRK14250 | 241 | phosphate ABC transporter ATP-binding protein; Pro | 98.52 | |
| TIGR02673 | 214 | FtsE cell division ATP-binding protein FtsE. This | 98.52 | |
| COG1121 | 254 | ZnuC ABC-type Mn/Zn transport systems, ATPase comp | 98.52 | |
| cd03257 | 228 | ABC_NikE_OppD_transporters The ABC transporter sub | 98.52 | |
| cd03234 | 226 | ABCG_White The White subfamily represents ABC tran | 98.52 | |
| TIGR00960 | 216 | 3a0501s02 Type II (General) Secretory Pathway (IIS | 98.52 | |
| cd03292 | 214 | ABC_FtsE_transporter FtsE is a hydrophilic nucleot | 98.52 | |
| TIGR01978 | 243 | sufC FeS assembly ATPase SufC. SufC is part of the | 98.51 | |
| cd03247 | 178 | ABCC_cytochrome_bd The CYD subfamily implicated in | 98.51 | |
| cd03261 | 235 | ABC_Org_Solvent_Resistant ABC (ATP-binding cassett | 98.51 | |
| cd03233 | 202 | ABC_PDR_domain1 The pleiotropic drug resistance (P | 98.51 | |
| TIGR02211 | 221 | LolD_lipo_ex lipoprotein releasing system, ATP-bin | 98.51 | |
| cd03265 | 220 | ABC_DrrA DrrA is the ATP-binding protein component | 98.51 | |
| cd03232 | 192 | ABC_PDR_domain2 The pleiotropic drug resistance-li | 98.51 | |
| COG1120 | 258 | FepC ABC-type cobalamin/Fe3+-siderophores transpor | 98.51 | |
| cd03293 | 220 | ABC_NrtD_SsuB_transporters NrtD and SsuB are the A | 98.51 | |
| PRK14255 | 252 | phosphate ABC transporter ATP-binding protein; Pro | 98.51 | |
| cd03262 | 213 | ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP- | 98.51 | |
| cd03259 | 213 | ABC_Carb_Solutes_like ABC Carbohydrate and Solute | 98.5 | |
| cd03260 | 227 | ABC_PstB_phosphate_transporter Phosphate uptake is | 98.5 | |
| KOG0065 | 1391 | consensus Pleiotropic drug resistance proteins (PD | 98.5 | |
| cd03224 | 222 | ABC_TM1139_LivF_branched LivF (TM1139) is part of | 98.5 | |
| cd03250 | 204 | ABCC_MRP_domain1 Domain 1 of the ABC subfamily C. | 98.5 | |
| cd03269 | 210 | ABC_putative_ATPase This subfamily is involved in | 98.49 | |
| PRK14261 | 253 | phosphate ABC transporter ATP-binding protein; Pro | 98.49 | |
| PRK11629 | 233 | lolD lipoprotein transporter ATP-binding subunit; | 98.49 | |
| TIGR03873 | 256 | F420-0_ABC_ATP proposed F420-0 ABC transporter, AT | 98.49 | |
| TIGR03410 | 230 | urea_trans_UrtE urea ABC transporter, ATP-binding | 98.49 | |
| TIGR02324 | 224 | CP_lyasePhnL phosphonate C-P lyase system protein | 98.48 | |
| cd03218 | 232 | ABC_YhbG The ABC transporters belonging to the Yhb | 98.48 | |
| PRK14242 | 253 | phosphate transporter ATP-binding protein; Provisi | 98.48 | |
| PRK14235 | 267 | phosphate transporter ATP-binding protein; Provisi | 98.48 | |
| PRK10908 | 222 | cell division protein FtsE; Provisional | 98.48 | |
| TIGR02315 | 243 | ABC_phnC phosphonate ABC transporter, ATP-binding | 98.48 | |
| cd03296 | 239 | ABC_CysA_sulfate_importer Part of the ABC transpor | 98.48 | |
| cd03228 | 171 | ABCC_MRP_Like The MRP (Mutidrug Resistance Protein | 98.47 | |
| cd03258 | 233 | ABC_MetN_methionine_transporter MetN (also known a | 98.47 | |
| cd03216 | 163 | ABC_Carb_Monos_I This family represents the domain | 98.47 | |
| cd03219 | 236 | ABC_Mj1267_LivG_branched The Mj1267/LivG ABC trans | 98.47 | |
| PRK13546 | 264 | teichoic acids export protein ATP-binding subunit; | 98.47 | |
| cd03256 | 241 | ABC_PhnC_transporter ABC-type phosphate/phosphonat | 98.47 | |
| PRK11701 | 258 | phnK phosphonate C-P lyase system protein PhnK; Pr | 98.47 | |
| PRK11248 | 255 | tauB taurine transporter ATP-binding subunit; Prov | 98.47 | |
| PRK11264 | 250 | putative amino-acid ABC transporter ATP-binding pr | 98.46 | |
| cd03268 | 208 | ABC_BcrA_bacitracin_resist The BcrA subfamily repr | 98.46 | |
| PRK13538 | 204 | cytochrome c biogenesis protein CcmA; Provisional | 98.46 | |
| COG1126 | 240 | GlnQ ABC-type polar amino acid transport system, A | 98.46 | |
| cd03249 | 238 | ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) | 98.46 | |
| TIGR03411 | 242 | urea_trans_UrtD urea ABC transporter, ATP-binding | 98.46 | |
| cd03215 | 182 | ABC_Carb_Monos_II This family represents domain II | 98.46 | |
| PRK10247 | 225 | putative ABC transporter ATP-binding protein YbbL; | 98.46 | |
| PRK13540 | 200 | cytochrome c biogenesis protein CcmA; Provisional | 98.46 | |
| cd03295 | 242 | ABC_OpuCA_Osmoprotection OpuCA is a the ATP bindin | 98.46 | |
| cd03291 | 282 | ABCC_CFTR1 The CFTR subfamily domain 1. The cystic | 98.45 | |
| PRK14267 | 253 | phosphate ABC transporter ATP-binding protein; Pro | 98.45 | |
| cd03244 | 221 | ABCC_MRP_domain2 Domain 2 of the ABC subfamily C. | 98.45 | |
| cd03230 | 173 | ABC_DR_subfamily_A This family of ATP-binding prot | 98.45 | |
| TIGR03005 | 252 | ectoine_ehuA ectoine/hydroxyectoine ABC transporte | 98.45 | |
| PRK14241 | 258 | phosphate transporter ATP-binding protein; Provisi | 98.45 | |
| cd03254 | 229 | ABCC_Glucan_exporter_like Glucan exporter ATP-bind | 98.45 | |
| PRK11614 | 237 | livF leucine/isoleucine/valine transporter ATP-bin | 98.45 | |
| PRK14256 | 252 | phosphate ABC transporter ATP-binding protein; Pro | 98.45 | |
| TIGR03864 | 236 | PQQ_ABC_ATP ABC transporter, ATP-binding subunit, | 98.45 | |
| PRK14245 | 250 | phosphate ABC transporter ATP-binding protein; Pro | 98.44 | |
| PRK14275 | 286 | phosphate ABC transporter ATP-binding protein; Pro | 98.44 | |
| cd03220 | 224 | ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transpo | 98.44 | |
| PRK14240 | 250 | phosphate transporter ATP-binding protein; Provisi | 98.44 | |
| PRK13649 | 280 | cbiO cobalt transporter ATP-binding subunit; Provi | 98.44 | |
| PRK10584 | 228 | putative ABC transporter ATP-binding protein YbbA; | 98.44 | |
| TIGR02769 | 265 | nickel_nikE nickel import ATP-binding protein NikE | 98.44 | |
| PRK14274 | 259 | phosphate ABC transporter ATP-binding protein; Pro | 98.44 | |
| PRK09493 | 240 | glnQ glutamine ABC transporter ATP-binding protein | 98.43 | |
| cd03223 | 166 | ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cass | 98.43 | |
| COG3638 | 258 | ABC-type phosphate/phosphonate transport system, A | 98.43 | |
| PRK13539 | 207 | cytochrome c biogenesis protein CcmA; Provisional | 98.43 | |
| cd03290 | 218 | ABCC_SUR1_N The SUR domain 1. The sulfonylurea rec | 98.43 | |
| cd03221 | 144 | ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is | 98.43 | |
| TIGR01189 | 198 | ccmA heme ABC exporter, ATP-binding protein CcmA. | 98.43 | |
| cd03253 | 236 | ABCC_ATM1_transporter ATM1 is an ABC transporter t | 98.43 | |
| cd03229 | 178 | ABC_Class3 This class is comprised of all BPD (Bin | 98.42 | |
| PRK10895 | 241 | lipopolysaccharide ABC transporter ATP-binding pro | 98.42 | |
| PRK09580 | 248 | sufC cysteine desulfurase ATPase component; Review | 98.42 | |
| PRK11300 | 255 | livG leucine/isoleucine/valine transporter ATP-bin | 98.42 | |
| cd03266 | 218 | ABC_NatA_sodium_exporter NatA is the ATPase compon | 98.42 | |
| TIGR02323 | 253 | CP_lyasePhnK phosphonate C-P lyase system protein | 98.42 | |
| PRK11124 | 242 | artP arginine transporter ATP-binding subunit; Pro | 98.42 | |
| PRK14247 | 250 | phosphate ABC transporter ATP-binding protein; Pro | 98.42 | |
| PRK14253 | 249 | phosphate ABC transporter ATP-binding protein; Pro | 98.41 | |
| COG0410 | 237 | LivF ABC-type branched-chain amino acid transport | 98.41 | |
| PRK14270 | 251 | phosphate ABC transporter ATP-binding protein; Pro | 98.41 | |
| PRK13645 | 289 | cbiO cobalt transporter ATP-binding subunit; Provi | 98.41 | |
| PRK13648 | 269 | cbiO cobalt transporter ATP-binding subunit; Provi | 98.41 | |
| PRK14262 | 250 | phosphate ABC transporter ATP-binding protein; Pro | 98.41 | |
| PRK15056 | 272 | manganese/iron transporter ATP-binding protein; Pr | 98.41 | |
| cd03289 | 275 | ABCC_CFTR2 The CFTR subfamily domain 2. The cystic | 98.41 | |
| cd03217 | 200 | ABC_FeS_Assembly ABC-type transport system involve | 98.41 | |
| cd03246 | 173 | ABCC_Protease_Secretion This family represents the | 98.41 | |
| PRK14239 | 252 | phosphate transporter ATP-binding protein; Provisi | 98.41 | |
| COG2884 | 223 | FtsE Predicted ATPase involved in cell division [C | 98.4 | |
| PRK14244 | 251 | phosphate ABC transporter ATP-binding protein; Pro | 98.4 | |
| TIGR02982 | 220 | heterocyst_DevA ABC exporter ATP-binding subunit, | 98.4 | |
| PRK13646 | 286 | cbiO cobalt transporter ATP-binding subunit; Provi | 98.4 | |
| PRK11831 | 269 | putative ABC transporter ATP-binding protein YrbF; | 98.4 | |
| PRK14260 | 259 | phosphate ABC transporter ATP-binding protein; Pro | 98.4 | |
| cd03251 | 234 | ABCC_MsbA MsbA is an essential ABC transporter, cl | 98.4 | |
| PRK14268 | 258 | phosphate ABC transporter ATP-binding protein; Pro | 98.4 | |
| TIGR03740 | 223 | galliderm_ABC gallidermin-class lantibiotic protec | 98.4 | |
| cd03245 | 220 | ABCC_bacteriocin_exporters ABC-type bacteriocin ex | 98.4 | |
| PRK14269 | 246 | phosphate ABC transporter ATP-binding protein; Pro | 98.4 | |
| PRK11247 | 257 | ssuB aliphatic sulfonates transport ATP-binding su | 98.4 | |
| PRK10575 | 265 | iron-hydroxamate transporter ATP-binding subunit; | 98.4 | |
| PRK14272 | 252 | phosphate ABC transporter ATP-binding protein; Pro | 98.39 | |
| PRK13547 | 272 | hmuV hemin importer ATP-binding subunit; Provision | 98.39 | |
| cd03294 | 269 | ABC_Pro_Gly_Bertaine This family comprises the gly | 98.39 | |
| PRK13650 | 279 | cbiO cobalt transporter ATP-binding subunit; Provi | 98.39 | |
| cd03248 | 226 | ABCC_TAP TAP, the Transporter Associated with Anti | 98.39 | |
| CHL00131 | 252 | ycf16 sulfate ABC transporter protein; Validated | 98.39 | |
| PRK13641 | 287 | cbiO cobalt transporter ATP-binding subunit; Provi | 98.39 | |
| cd03252 | 237 | ABCC_Hemolysin The ABC-transporter hemolysin B is | 98.38 | |
| TIGR01288 | 303 | nodI ATP-binding ABC transporter family nodulation | 98.38 | |
| PRK14251 | 251 | phosphate ABC transporter ATP-binding protein; Pro | 98.38 | |
| PRK15112 | 267 | antimicrobial peptide ABC system ATP-binding prote | 98.38 | |
| cd03288 | 257 | ABCC_SUR2 The SUR domain 2. The sulfonylurea recep | 98.38 | |
| PRK13638 | 271 | cbiO cobalt transporter ATP-binding subunit; Provi | 98.38 | |
| PRK10418 | 254 | nikD nickel transporter ATP-binding protein NikD; | 98.38 | |
| cd03369 | 207 | ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-ty | 98.37 | |
| PRK13548 | 258 | hmuV hemin importer ATP-binding subunit; Provision | 98.37 | |
| PRK11231 | 255 | fecE iron-dicitrate transporter ATP-binding subuni | 98.37 | |
| TIGR00972 | 247 | 3a0107s01c2 phosphate ABC transporter, ATP-binding | 98.37 | |
| PRK09544 | 251 | znuC high-affinity zinc transporter ATPase; Review | 98.37 | |
| PRK14266 | 250 | phosphate ABC transporter ATP-binding protein; Pro | 98.37 | |
| PRK14271 | 276 | phosphate ABC transporter ATP-binding protein; Pro | 98.37 | |
| PRK13644 | 274 | cbiO cobalt transporter ATP-binding subunit; Provi | 98.37 | |
| COG4619 | 223 | ABC-type uncharacterized transport system, ATPase | 98.37 | |
| PRK13634 | 290 | cbiO cobalt transporter ATP-binding subunit; Provi | 98.36 | |
| PRK13543 | 214 | cytochrome c biogenesis protein CcmA; Provisional | 98.36 | |
| PRK13639 | 275 | cbiO cobalt transporter ATP-binding subunit; Provi | 98.36 | |
| PRK09984 | 262 | phosphonate/organophosphate ester transporter subu | 98.36 | |
| COG1134 | 249 | TagH ABC-type polysaccharide/polyol phosphate tran | 98.36 | |
| PRK11022 | 326 | dppD dipeptide transporter ATP-binding subunit; Pr | 98.36 | |
| PRK14263 | 261 | phosphate ABC transporter ATP-binding protein; Pro | 98.36 | |
| COG3842 | 352 | PotA ABC-type spermidine/putrescine transport syst | 98.35 | |
| PRK14236 | 272 | phosphate transporter ATP-binding protein; Provisi | 98.35 | |
| PRK15093 | 330 | antimicrobial peptide ABC transporter ATP-binding | 98.35 | |
| PRK13637 | 287 | cbiO cobalt transporter ATP-binding subunit; Provi | 98.35 | |
| TIGR00968 | 237 | 3a0106s01 sulfate ABC transporter, ATP-binding pro | 98.35 | |
| cd03300 | 232 | ABC_PotA_N PotA is an ABC-type transporter and the | 98.35 | |
| PRK14249 | 251 | phosphate ABC transporter ATP-binding protein; Pro | 98.35 | |
| cd03231 | 201 | ABC_CcmA_heme_exporter CcmA, the ATP-binding compo | 98.35 | |
| PRK13537 | 306 | nodulation ABC transporter NodI; Provisional | 98.35 | |
| PRK10419 | 268 | nikE nickel transporter ATP-binding protein NikE; | 98.35 | |
| PRK10253 | 265 | iron-enterobactin transporter ATP-binding protein; | 98.35 | |
| PRK14246 | 257 | phosphate ABC transporter ATP-binding protein; Pro | 98.34 | |
| PRK13635 | 279 | cbiO cobalt transporter ATP-binding subunit; Provi | 98.34 | |
| PRK14238 | 271 | phosphate transporter ATP-binding protein; Provisi | 98.33 | |
| PRK14243 | 264 | phosphate transporter ATP-binding protein; Provisi | 98.33 | |
| COG0396 | 251 | sufC Cysteine desulfurase activator ATPase [Posttr | 98.33 | |
| PRK13647 | 274 | cbiO cobalt transporter ATP-binding subunit; Provi | 98.33 | |
| TIGR03522 | 301 | GldA_ABC_ATP gliding motility-associated ABC trans | 98.33 | |
| PRK14252 | 265 | phosphate ABC transporter ATP-binding protein; Pro | 98.32 | |
| PRK13633 | 280 | cobalt transporter ATP-binding subunit; Provisiona | 98.32 | |
| COG1117 | 253 | PstB ABC-type phosphate transport system, ATPase c | 98.31 | |
| cd00267 | 157 | ABC_ATPase ABC (ATP-binding cassette) transporter | 98.31 | |
| PRK11153 | 343 | metN DL-methionine transporter ATP-binding subunit | 98.31 | |
| PRK14254 | 285 | phosphate ABC transporter ATP-binding protein; Pro | 98.31 | |
| PRK09473 | 330 | oppD oligopeptide transporter ATP-binding componen | 98.3 | |
| COG1116 | 248 | TauB ABC-type nitrate/sulfonate/bicarbonate transp | 98.3 | |
| cd03236 | 255 | ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 o | 98.3 | |
| PRK13643 | 288 | cbiO cobalt transporter ATP-binding subunit; Provi | 98.3 | |
| PRK14258 | 261 | phosphate ABC transporter ATP-binding protein; Pro | 98.29 | |
| PRK13636 | 283 | cbiO cobalt transporter ATP-binding subunit; Provi | 98.29 | |
| PRK10619 | 257 | histidine/lysine/arginine/ornithine transporter su | 98.29 | |
| PRK13652 | 277 | cbiO cobalt transporter ATP-binding subunit; Provi | 98.28 | |
| PRK11650 | 356 | ugpC glycerol-3-phosphate transporter ATP-binding | 98.28 | |
| PRK14264 | 305 | phosphate ABC transporter ATP-binding protein; Pro | 98.27 | |
| TIGR03265 | 353 | PhnT2 putative 2-aminoethylphosphonate ABC transpo | 98.27 | |
| PRK13651 | 305 | cobalt transporter ATP-binding subunit; Provisiona | 98.27 | |
| cd00820 | 107 | PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPC | 98.27 | |
| PRK13631 | 320 | cbiO cobalt transporter ATP-binding subunit; Provi | 98.26 | |
| PRK13640 | 282 | cbiO cobalt transporter ATP-binding subunit; Provi | 98.25 | |
| PRK13642 | 277 | cbiO cobalt transporter ATP-binding subunit; Provi | 98.25 | |
| PRK13541 | 195 | cytochrome c biogenesis protein CcmA; Provisional | 98.24 | |
| PRK11000 | 369 | maltose/maltodextrin transporter ATP-binding prote | 98.24 | |
| PRK09452 | 375 | potA putrescine/spermidine ABC transporter ATPase | 98.24 | |
| PRK09536 | 402 | btuD corrinoid ABC transporter ATPase; Reviewed | 98.24 | |
| TIGR02314 | 343 | ABC_MetN D-methionine ABC transporter, ATP-binding | 98.22 | |
| TIGR03258 | 362 | PhnT 2-aminoethylphosphonate ABC transport system, | 98.21 | |
| PRK11432 | 351 | fbpC ferric transporter ATP-binding subunit; Provi | 98.21 | |
| PRK14257 | 329 | phosphate ABC transporter ATP-binding protein; Pro | 98.21 | |
| PRK10851 | 353 | sulfate/thiosulfate transporter subunit; Provision | 98.2 | |
| PRK09700 | 510 | D-allose transporter ATP-binding protein; Provisio | 98.2 | |
| PRK10938 | 490 | putative molybdenum transport ATP-binding protein | 98.19 | |
| PRK13549 | 506 | xylose transporter ATP-binding subunit; Provisiona | 98.19 | |
| PRK13536 | 340 | nodulation factor exporter subunit NodI; Provision | 98.19 | |
| PRK11607 | 377 | potG putrescine transporter ATP-binding subunit; P | 98.17 | |
| COG1122 | 235 | CbiO ABC-type cobalt transport system, ATPase comp | 98.16 | |
| PRK15439 | 510 | autoinducer 2 ABC transporter ATP-binding protein | 98.16 | |
| PRK10762 | 501 | D-ribose transporter ATP binding protein; Provisio | 98.16 | |
| PRK10636 | 638 | putative ABC transporter ATP-binding protein; Prov | 98.16 | |
| TIGR03269 | 520 | met_CoM_red_A2 methyl coenzyme M reductase system, | 98.15 | |
| PRK15079 | 331 | oligopeptide ABC transporter ATP-binding protein O | 98.15 | |
| PRK11176 | 582 | lipid transporter ATP-binding/permease protein; Pr | 98.15 | |
| PRK11308 | 327 | dppF dipeptide transporter ATP-binding subunit; Pr | 98.15 | |
| PRK11160 | 574 | cysteine/glutathione ABC transporter membrane/ATP- | 98.15 | |
| PRK11819 | 556 | putative ABC transporter ATP-binding protein; Revi | 98.15 | |
| TIGR02633 | 500 | xylG D-xylose ABC transporter, ATP-binding protein | 98.14 | |
| PRK15134 | 529 | microcin C ABC transporter ATP-binding protein Yej | 98.14 | |
| TIGR02857 | 529 | CydD thiol reductant ABC exporter, CydD subunit. U | 98.14 | |
| PRK11288 | 501 | araG L-arabinose transporter ATP-binding protein; | 98.14 | |
| TIGR03719 | 552 | ABC_ABC_ChvD ATP-binding cassette protein, ChvD fa | 98.13 | |
| PRK15064 | 530 | ABC transporter ATP-binding protein; Provisional | 98.13 | |
| KOG0057 | 591 | consensus Mitochondrial Fe/S cluster exporter, ABC | 98.13 | |
| PRK10938 | 490 | putative molybdenum transport ATP-binding protein | 98.12 | |
| COG3839 | 338 | MalK ABC-type sugar transport systems, ATPase comp | 98.12 | |
| TIGR02633 | 500 | xylG D-xylose ABC transporter, ATP-binding protein | 98.12 | |
| TIGR03415 | 382 | ABC_choXWV_ATP choline ABC transporter, ATP-bindin | 98.12 | |
| COG1118 | 345 | CysA ABC-type sulfate/molybdate transport systems, | 98.12 | |
| PRK15134 | 529 | microcin C ABC transporter ATP-binding protein Yej | 98.12 | |
| COG4181 | 228 | Predicted ABC-type transport system involved in ly | 98.11 | |
| TIGR03797 | 686 | NHPM_micro_ABC2 NHPM bacteriocin system ABC transp | 98.11 | |
| COG1127 | 263 | Ttg2A ABC-type transport system involved in resist | 98.11 | |
| cd03222 | 177 | ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibi | 98.1 | |
| TIGR03269 | 520 | met_CoM_red_A2 methyl coenzyme M reductase system, | 98.09 | |
| PRK13549 | 506 | xylose transporter ATP-binding subunit; Provisiona | 98.09 | |
| PRK15064 | 530 | ABC transporter ATP-binding protein; Provisional | 98.08 | |
| TIGR02868 | 529 | CydC thiol reductant ABC exporter, CydC subunit. T | 98.08 | |
| COG1132 | 567 | MdlB ABC-type multidrug transport system, ATPase a | 98.08 | |
| PRK11147 | 635 | ABC transporter ATPase component; Reviewed | 98.07 | |
| COG4525 | 259 | TauB ABC-type taurine transport system, ATPase com | 98.07 | |
| PRK10636 | 638 | putative ABC transporter ATP-binding protein; Prov | 98.07 | |
| PRK09700 | 510 | D-allose transporter ATP-binding protein; Provisio | 98.06 | |
| TIGR03719 | 552 | ABC_ABC_ChvD ATP-binding cassette protein, ChvD fa | 98.06 | |
| TIGR01194 | 555 | cyc_pep_trnsptr cyclic peptide transporter. This m | 98.05 | |
| PRK10070 | 400 | glycine betaine transporter ATP-binding subunit; P | 98.05 | |
| PRK11819 | 556 | putative ABC transporter ATP-binding protein; Revi | 98.04 | |
| COG1125 | 309 | OpuBA ABC-type proline/glycine betaine transport s | 98.03 | |
| COG1124 | 252 | DppF ABC-type dipeptide/oligopeptide/nickel transp | 98.02 | |
| PRK10762 | 501 | D-ribose transporter ATP binding protein; Provisio | 98.02 | |
| PRK11147 | 635 | ABC transporter ATPase component; Reviewed | 98.01 | |
| TIGR03375 | 694 | type_I_sec_LssB type I secretion system ATPase, Ls | 98.01 | |
| PRK13545 | 549 | tagH teichoic acids export protein ATP-binding sub | 98.01 | |
| PRK11288 | 501 | araG L-arabinose transporter ATP-binding protein; | 98.0 | |
| PRK11174 | 588 | cysteine/glutathione ABC transporter membrane/ATP- | 98.0 | |
| TIGR02204 | 576 | MsbA_rel ABC transporter, permease/ATP-binding pro | 98.0 | |
| PRK10261 | 623 | glutathione transporter ATP-binding protein; Provi | 98.0 | |
| PRK10261 | 623 | glutathione transporter ATP-binding protein; Provi | 97.99 | |
| COG2274 | 709 | SunT ABC-type bacteriocin/lantibiotic exporters, c | 97.99 | |
| COG4555 | 245 | NatA ABC-type Na+ transport system, ATPase compone | 97.99 | |
| PRK10982 | 491 | galactose/methyl galaxtoside transporter ATP-bindi | 97.98 | |
| PRK10522 | 547 | multidrug transporter membrane component/ATP-bindi | 97.97 | |
| PLN03073 | 718 | ABC transporter F family; Provisional | 97.97 | |
| TIGR00958 | 711 | 3a01208 Conjugate Transporter-2 (CT2) Family prote | 97.96 | |
| TIGR01193 | 708 | bacteriocin_ABC ABC-type bacteriocin transporter. | 97.95 | |
| TIGR03796 | 710 | NHPM_micro_ABC1 NHPM bacteriocin system ABC transp | 97.94 | |
| PRK15439 | 510 | autoinducer 2 ABC transporter ATP-binding protein | 97.94 | |
| COG0411 | 250 | LivG ABC-type branched-chain amino acid transport | 97.93 | |
| PRK10789 | 569 | putative multidrug transporter membrane\ATP-bindin | 97.93 | |
| TIGR01842 | 544 | type_I_sec_PrtD type I secretion system ABC transp | 97.93 | |
| PRK13657 | 588 | cyclic beta-1,2-glucan ABC transporter; Provisiona | 97.93 | |
| COG4618 | 580 | ArpD ABC-type protease/lipase transport system, AT | 97.92 | |
| TIGR02203 | 571 | MsbA_lipidA lipid A export permease/ATP-binding pr | 97.92 | |
| PRK10790 | 592 | putative multidrug transporter membrane\ATP-bindin | 97.91 | |
| KOG0056 | 790 | consensus Heavy metal exporter HMT1, ABC superfami | 97.91 | |
| TIGR01271 | 1490 | CFTR_protein cystic fibrosis transmembrane conduct | 97.9 | |
| PLN03073 | 718 | ABC transporter F family; Provisional | 97.89 | |
| TIGR00954 | 659 | 3a01203 Peroxysomal Fatty Acyl CoA Transporter (FA | 97.85 | |
| KOG0058 | 716 | consensus Peptide exporter, ABC superfamily [Intra | 97.85 | |
| TIGR00957 | 1522 | MRP_assoc_pro multi drug resistance-associated pro | 97.84 | |
| PTZ00243 | 1560 | ABC transporter; Provisional | 97.83 | |
| PRK10535 | 648 | macrolide transporter ATP-binding /permease protei | 97.83 | |
| PLN03232 | 1495 | ABC transporter C family member; Provisional | 97.83 | |
| PRK13409 | 590 | putative ATPase RIL; Provisional | 97.82 | |
| PRK13409 | 590 | putative ATPase RIL; Provisional | 97.81 | |
| COG4778 | 235 | PhnL ABC-type phosphonate transport system, ATPase | 97.81 | |
| TIGR01192 | 585 | chvA glucan exporter ATP-binding protein. This mod | 97.81 | |
| PLN03130 | 1622 | ABC transporter C family member; Provisional | 97.8 | |
| TIGR01846 | 694 | type_I_sec_HlyB type I secretion system ABC transp | 97.79 | |
| COG4133 | 209 | CcmA ABC-type transport system involved in cytochr | 97.77 | |
| cd03282 | 204 | ABC_MSH4_euk MutS4 homolog in eukaryotes. The MutS | 97.77 | |
| COG4988 | 559 | CydD ABC-type transport system involved in cytochr | 97.76 | |
| COG4987 | 573 | CydC ABC-type transport system involved in cytochr | 97.76 | |
| COG4586 | 325 | ABC-type uncharacterized transport system, ATPase | 97.75 | |
| COG2401 | 593 | ABC-type ATPase fused to a predicted acetyltransfe | 97.71 | |
| COG4178 | 604 | ABC-type uncharacterized transport system, permeas | 97.7 | |
| PF13555 | 62 | AAA_29: P-loop containing region of AAA domain | 97.68 | |
| TIGR03238 | 504 | dnd_assoc_3 dnd system-associated protein 3. cereu | 97.68 | |
| COG1119 | 257 | ModF ABC-type molybdenum transport system, ATPase | 97.67 | |
| COG1135 | 339 | AbcC ABC-type metal ion transport system, ATPase c | 97.66 | |
| TIGR01271 | 1490 | CFTR_protein cystic fibrosis transmembrane conduct | 97.65 | |
| COG4674 | 249 | Uncharacterized ABC-type transport system, ATPase | 97.65 | |
| COG1123 | 539 | ATPase components of various ABC-type transport sy | 97.64 | |
| PTZ00265 | 1466 | multidrug resistance protein (mdr1); Provisional | 97.64 | |
| COG4152 | 300 | ABC-type uncharacterized transport system, ATPase | 97.62 | |
| KOG0054 | 1381 | consensus Multidrug resistance-associated protein/ | 97.6 | |
| cd03280 | 200 | ABC_MutS2 MutS2 homologs in bacteria and eukaryote | 97.59 | |
| COG1129 | 500 | MglA ABC-type sugar transport system, ATPase compo | 97.57 | |
| PTZ00243 | 1560 | ABC transporter; Provisional | 97.56 | |
| COG0488 | 530 | Uup ATPase components of ABC transporters with dup | 97.56 | |
| PLN03232 | 1495 | ABC transporter C family member; Provisional | 97.55 | |
| cd03287 | 222 | ABC_MSH3_euk MutS3 homolog in eukaryotes. The MutS | 97.55 | |
| TIGR00957 | 1522 | MRP_assoc_pro multi drug resistance-associated pro | 97.52 | |
| cd03243 | 202 | ABC_MutS_homologs The MutS protein initiates DNA m | 97.5 | |
| cd03284 | 216 | ABC_MutS1 MutS1 homolog in eukaryotes. The MutS pr | 97.48 | |
| COG1123 | 539 | ATPase components of various ABC-type transport sy | 97.48 | |
| PTZ00265 | 1466 | multidrug resistance protein (mdr1); Provisional | 97.47 | |
| PLN03130 | 1622 | ABC transporter C family member; Provisional | 97.46 | |
| TIGR01257 | 2272 | rim_protein retinal-specific rim ABC transporter. | 97.44 | |
| COG0488 | 530 | Uup ATPase components of ABC transporters with dup | 97.42 | |
| COG4161 | 242 | ArtP ABC-type arginine transport system, ATPase co | 97.41 | |
| TIGR01257 | 2272 | rim_protein retinal-specific rim ABC transporter. | 97.41 | |
| COG4107 | 258 | PhnK ABC-type phosphonate transport system, ATPase | 97.4 | |
| COG1137 | 243 | YhbG ABC-type (unclassified) transport system, ATP | 97.38 | |
| COG0444 | 316 | DppD ABC-type dipeptide/oligopeptide/nickel transp | 97.37 | |
| COG4136 | 213 | ABC-type uncharacterized transport system, ATPase | 97.37 | |
| COG3845 | 501 | ABC-type uncharacterized transport systems, ATPase | 97.29 | |
| cd03285 | 222 | ABC_MSH2_euk MutS2 homolog in eukaryotes. The MutS | 97.28 | |
| KOG0055 | 1228 | consensus Multidrug/pheromone exporter, ABC superf | 97.25 | |
| COG4604 | 252 | CeuD ABC-type enterochelin transport system, ATPas | 97.24 | |
| COG4598 | 256 | HisP ABC-type histidine transport system, ATPase c | 97.22 | |
| cd01122 | 271 | GP4d_helicase GP4d_helicase is a homohexameric 5'- | 97.15 | |
| TIGR00750 | 300 | lao LAO/AO transport system ATPase. Mutations have | 97.14 | |
| cd03286 | 218 | ABC_MSH6_euk MutS6 homolog in eukaryotes. The MutS | 97.08 | |
| COG4608 | 268 | AppF ABC-type oligopeptide transport system, ATPas | 97.06 | |
| PF13481 | 193 | AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C. | 97.0 | |
| COG5265 | 497 | ATM1 ABC-type transport system involved in Fe-S cl | 96.97 | |
| cd03279 | 213 | ABC_sbcCD SbcCD and other Mre11/Rad50 (MR) complex | 96.96 | |
| TIGR02788 | 308 | VirB11 P-type DNA transfer ATPase VirB11. The VirB | 96.9 | |
| cd00009 | 151 | AAA The AAA+ (ATPases Associated with a wide varie | 96.9 | |
| TIGR03015 | 269 | pepcterm_ATPase putative secretion ATPase, PEP-CTE | 96.88 | |
| KOG0054 | 1381 | consensus Multidrug resistance-associated protein/ | 96.82 | |
| TIGR02524 | 358 | dot_icm_DotB Dot/Icm secretion system ATPase DotB. | 96.81 | |
| PF13245 | 76 | AAA_19: Part of AAA domain | 96.78 | |
| COG1101 | 263 | PhnK ABC-type uncharacterized transport system, AT | 96.74 | |
| PRK14722 | 374 | flhF flagellar biosynthesis regulator FlhF; Provis | 96.73 | |
| COG4175 | 386 | ProV ABC-type proline/glycine betaine transport sy | 96.73 | |
| PRK05973 | 237 | replicative DNA helicase; Provisional | 96.72 | |
| TIGR00150 | 133 | HI0065_YjeE ATPase, YjeE family. Members of this f | 96.66 | |
| cd03281 | 213 | ABC_MSH5_euk MutS5 homolog in eukaryotes. The MutS | 96.66 | |
| PRK09183 | 259 | transposase/IS protein; Provisional | 96.62 | |
| TIGR01420 | 343 | pilT_fam pilus retraction protein PilT. This model | 96.61 | |
| KOG0927 | 614 | consensus Predicted transporter (ABC superfamily) | 96.58 | |
| TIGR00630 | 924 | uvra excinuclease ABC, A subunit. This family is b | 96.56 | |
| KOG2355 | 291 | consensus Predicted ABC-type transport, ATPase com | 96.54 | |
| PRK09270 | 229 | nucleoside triphosphate hydrolase domain-containin | 96.49 | |
| PRK13851 | 344 | type IV secretion system protein VirB11; Provision | 96.46 | |
| TIGR02239 | 316 | recomb_RAD51 DNA repair protein RAD51. This eukary | 96.43 | |
| COG3854 | 308 | SpoIIIAA ncharacterized protein conserved in bacte | 96.42 | |
| smart00763 | 361 | AAA_PrkA PrkA AAA domain. This is a family of PrkA | 96.37 | |
| TIGR00767 | 415 | rho transcription termination factor Rho. Members | 96.37 | |
| PF00437 | 270 | T2SE: Type II/IV secretion system protein; InterPr | 96.36 | |
| cd02019 | 69 | NK Nucleoside/nucleotide kinase (NK) is a protein | 96.32 | |
| PRK10416 | 318 | signal recognition particle-docking protein FtsY; | 96.31 | |
| TIGR00665 | 434 | DnaB replicative DNA helicase. This model describe | 96.3 | |
| TIGR01069 | 771 | mutS2 MutS2 family protein. Function of MutS2 is u | 96.3 | |
| PLN02796 | 347 | D-glycerate 3-kinase | 96.28 | |
| PRK10463 | 290 | hydrogenase nickel incorporation protein HypB; Pro | 96.26 | |
| cd03227 | 162 | ABC_Class2 ABC-type Class 2 contains systems invol | 96.25 | |
| PRK06002 | 450 | fliI flagellum-specific ATP synthase; Validated | 96.24 | |
| PRK15494 | 339 | era GTPase Era; Provisional | 96.22 | |
| cd01878 | 204 | HflX HflX subfamily. A distinct conserved domain w | 96.2 | |
| TIGR00602 | 637 | rad24 checkpoint protein rad24. This family is bas | 96.19 | |
| PRK08149 | 428 | ATP synthase SpaL; Validated | 96.17 | |
| TIGR02782 | 299 | TrbB_P P-type conjugative transfer ATPase TrbB. Th | 96.16 | |
| PRK00098 | 298 | GTPase RsgA; Reviewed | 96.14 | |
| PRK00349 | 943 | uvrA excinuclease ABC subunit A; Reviewed | 96.12 | |
| cd01136 | 326 | ATPase_flagellum-secretory_path_III Flagellum-spec | 96.11 | |
| PF03193 | 161 | DUF258: Protein of unknown function, DUF258; Inter | 96.1 | |
| cd01129 | 264 | PulE-GspE PulE/GspE The type II secretory pathway | 96.08 | |
| PLN02200 | 234 | adenylate kinase family protein | 96.07 | |
| KOG0055 | 1228 | consensus Multidrug/pheromone exporter, ABC superf | 96.06 | |
| PRK13894 | 319 | conjugal transfer ATPase TrbB; Provisional | 96.04 | |
| TIGR02858 | 270 | spore_III_AA stage III sporulation protein AA. Mem | 95.99 | |
| PRK07196 | 434 | fliI flagellum-specific ATP synthase; Validated | 95.99 | |
| PRK00635 | 1809 | excinuclease ABC subunit A; Provisional | 95.97 | |
| KOG2373 | 514 | consensus Predicted mitochondrial DNA helicase twi | 95.97 | |
| PRK07721 | 438 | fliI flagellum-specific ATP synthase; Validated | 95.96 | |
| TIGR01526 | 325 | nadR_NMN_Atrans nicotinamide-nucleotide adenylyltr | 95.95 | |
| cd01858 | 157 | NGP_1 NGP-1. Autoantigen NGP-1 (Nucleolar G-protei | 95.94 | |
| KOG0060 | 659 | consensus Long-chain acyl-CoA transporter, ABC sup | 95.92 | |
| PRK13900 | 332 | type IV secretion system ATPase VirB11; Provisiona | 95.92 | |
| cd01882 | 225 | BMS1 Bms1. Bms1 is an essential, evolutionarily co | 95.91 | |
| cd01121 | 372 | Sms Sms (bacterial radA) DNA repair protein. This | 95.91 | |
| PTZ00035 | 337 | Rad51 protein; Provisional | 95.89 | |
| TIGR03600 | 421 | phage_DnaB phage replicative helicase, DnaB family | 95.89 | |
| cd01854 | 287 | YjeQ_engC YjeQ/EngC. YjeQ (YloQ in Bacillus subtil | 95.87 | |
| TIGR00554 | 290 | panK_bact pantothenate kinase, bacterial type. Sho | 95.85 | |
| PRK01889 | 356 | GTPase RsgA; Reviewed | 95.84 | |
| TIGR03878 | 259 | thermo_KaiC_2 KaiC domain protein, AF_0795 family. | 95.77 | |
| TIGR00416 | 454 | sms DNA repair protein RadA. The gene protuct code | 95.75 | |
| TIGR02525 | 372 | plasmid_TraJ plasmid transfer ATPase TraJ. Members | 95.75 | |
| PRK14721 | 420 | flhF flagellar biosynthesis regulator FlhF; Provis | 95.73 | |
| COG4167 | 267 | SapF ABC-type antimicrobial peptide transport syst | 95.73 | |
| PRK13833 | 323 | conjugal transfer protein TrbB; Provisional | 95.69 | |
| PF00488 | 235 | MutS_V: MutS domain V C-terminus.; InterPro: IPR00 | 95.68 | |
| COG4615 | 546 | PvdE ABC-type siderophore export system, fused ATP | 95.67 | |
| PF01580 | 205 | FtsK_SpoIIIE: FtsK/SpoIIIE family; InterPro: IPR00 | 95.67 | |
| PRK06995 | 484 | flhF flagellar biosynthesis regulator FlhF; Valida | 95.64 | |
| KOG0059 | 885 | consensus Lipid exporter ABCA1 and related protein | 95.62 | |
| PTZ00454 | 398 | 26S protease regulatory subunit 6B-like protein; P | 95.61 | |
| PRK09862 | 506 | putative ATP-dependent protease; Provisional | 95.6 | |
| PRK14723 | 767 | flhF flagellar biosynthesis regulator FlhF; Provis | 95.59 | |
| PRK06731 | 270 | flhF flagellar biosynthesis regulator FlhF; Valida | 95.57 | |
| PRK09165 | 497 | replicative DNA helicase; Provisional | 95.56 | |
| PRK08972 | 444 | fliI flagellum-specific ATP synthase; Validated | 95.55 | |
| TIGR02546 | 422 | III_secr_ATP type III secretion apparatus H+-trans | 95.55 | |
| PRK09099 | 441 | type III secretion system ATPase; Provisional | 95.53 | |
| PRK09435 | 332 | membrane ATPase/protein kinase; Provisional | 95.5 | |
| PRK07004 | 460 | replicative DNA helicase; Provisional | 95.43 | |
| PRK07594 | 433 | type III secretion system ATPase SsaN; Validated | 95.42 | |
| PRK05595 | 444 | replicative DNA helicase; Provisional | 95.42 | |
| TIGR02236 | 310 | recomb_radA DNA repair and recombination protein R | 95.42 | |
| TIGR00368 | 499 | Mg chelatase-related protein. The N-terminal end m | 95.4 | |
| PRK08760 | 476 | replicative DNA helicase; Provisional | 95.39 | |
| cd01853 | 249 | Toc34_like Toc34-like (Translocon at the Outer-env | 95.37 | |
| KOG0062 | 582 | consensus ATPase component of ABC transporters wit | 95.37 | |
| TIGR02012 | 321 | tigrfam_recA protein RecA. This model describes or | 95.35 | |
| PRK11823 | 446 | DNA repair protein RadA; Provisional | 95.32 | |
| PRK05636 | 505 | replicative DNA helicase; Provisional | 95.31 | |
| PHA02542 | 473 | 41 41 helicase; Provisional | 95.31 | |
| TIGR03420 | 226 | DnaA_homol_Hda DnaA regulatory inactivator Hda. Me | 95.31 | |
| PRK05688 | 451 | fliI flagellum-specific ATP synthase; Validated | 95.3 | |
| PF03215 | 519 | Rad17: Rad17 cell cycle checkpoint protein | 95.3 | |
| PRK00635 | 1809 | excinuclease ABC subunit A; Provisional | 95.27 | |
| TIGR03496 | 411 | FliI_clade1 flagellar protein export ATPase FliI. | 95.25 | |
| PRK08506 | 472 | replicative DNA helicase; Provisional | 95.24 | |
| TIGR01026 | 440 | fliI_yscN ATPase FliI/YscN family. This family of | 95.23 | |
| cd01849 | 155 | YlqF_related_GTPase YlqF-related GTPases. These pr | 95.23 | |
| PRK05748 | 448 | replicative DNA helicase; Provisional | 95.23 | |
| PRK06936 | 439 | type III secretion system ATPase; Provisional | 95.22 | |
| PLN02165 | 334 | adenylate isopentenyltransferase | 95.21 | |
| cd00983 | 325 | recA RecA is a bacterial enzyme which has roles in | 95.2 | |
| PRK13477 | 512 | bifunctional pantoate ligase/cytidylate kinase; Pr | 95.16 | |
| TIGR00157 | 245 | ribosome small subunit-dependent GTPase A. The Aqu | 95.14 | |
| cd01855 | 190 | YqeH YqeH. YqeH is an essential GTP-binding protei | 95.14 | |
| PRK08472 | 434 | fliI flagellum-specific ATP synthase; Validated | 95.14 | |
| PLN03186 | 342 | DNA repair protein RAD51 homolog; Provisional | 95.13 | |
| PRK06321 | 472 | replicative DNA helicase; Provisional | 95.12 | |
| PRK08006 | 471 | replicative DNA helicase; Provisional | 95.12 | |
| TIGR03497 | 413 | FliI_clade2 flagellar protein export ATPase FliI. | 95.1 | |
| PRK13764 | 602 | ATPase; Provisional | 95.08 | |
| COG4172 | 534 | ABC-type uncharacterized transport system, duplica | 95.07 | |
| TIGR01242 | 364 | 26Sp45 26S proteasome subunit P45 family. Many pro | 95.03 | |
| KOG0064 | 728 | consensus Peroxisomal long-chain acyl-CoA transpor | 95.02 | |
| TIGR02238 | 313 | recomb_DMC1 meiotic recombinase Dmc1. This model d | 94.99 | |
| TIGR02881 | 261 | spore_V_K stage V sporulation protein K. Members o | 94.97 | |
| cd01857 | 141 | HSR1_MMR1 HSR1/MMR1. Human HSR1, is localized to t | 94.95 | |
| TIGR02533 | 486 | type_II_gspE general secretory pathway protein E. | 94.85 | |
| TIGR01243 | 733 | CDC48 AAA family ATPase, CDC48 subfamily. This sub | 94.84 | |
| PRK06904 | 472 | replicative DNA helicase; Validated | 94.84 | |
| PRK15455 | 644 | PrkA family serine protein kinase; Provisional | 94.82 | |
| PLN03187 | 344 | meiotic recombination protein DMC1 homolog; Provis | 94.81 | |
| PRK12288 | 347 | GTPase RsgA; Reviewed | 94.8 | |
| PRK04301 | 317 | radA DNA repair and recombination protein RadA; Va | 94.8 | |
| KOG1970 | 634 | consensus Checkpoint RAD17-RFC complex, RAD17/RAD2 | 94.78 | |
| PLN02674 | 244 | adenylate kinase | 94.69 | |
| PTZ00361 | 438 | 26 proteosome regulatory subunit 4-like protein; P | 94.69 | |
| PHA02562 | 562 | 46 endonuclease subunit; Provisional | 94.68 | |
| PRK08154 | 309 | anaerobic benzoate catabolism transcriptional regu | 94.65 | |
| PF08298 | 358 | AAA_PrkA: PrkA AAA domain; InterPro: IPR013153 Thi | 94.64 | |
| PRK12289 | 352 | GTPase RsgA; Reviewed | 94.63 | |
| PRK08903 | 227 | DnaA regulatory inactivator Hda; Validated | 94.61 | |
| TIGR02655 | 484 | circ_KaiC circadian clock protein KaiC. Members of | 94.59 | |
| PRK09302 | 509 | circadian clock protein KaiC; Reviewed | 94.59 | |
| TIGR03185 | 650 | DNA_S_dndD DNA sulfur modification protein DndD. T | 94.53 | |
| COG4172 | 534 | ABC-type uncharacterized transport system, duplica | 94.51 | |
| TIGR03498 | 418 | FliI_clade3 flagellar protein export ATPase FliI. | 94.43 | |
| PF02367 | 123 | UPF0079: Uncharacterised P-loop hydrolase UPF0079; | 94.42 | |
| PRK08840 | 464 | replicative DNA helicase; Provisional | 94.4 | |
| PRK12726 | 407 | flagellar biosynthesis regulator FlhF; Provisional | 94.37 | |
| TIGR03499 | 282 | FlhF flagellar biosynthetic protein FlhF. | 94.36 | |
| PRK13873 | 811 | conjugal transfer ATPase TrbE; Provisional | 94.35 | |
| PRK04863 | 1486 | mukB cell division protein MukB; Provisional | 94.34 | |
| PRK06820 | 440 | type III secretion system ATPase; Validated | 94.26 | |
| COG1855 | 604 | ATPase (PilT family) [General function prediction | 94.23 |
| >PLN03140 ABC transporter G family member; Provisional | Back alignment and domain information |
|---|
Probab=100.00 E-value=1.3e-38 Score=336.08 Aligned_cols=197 Identities=36% Similarity=0.523 Sum_probs=159.4
Q ss_pred hhhhccccccccCCcc--cccccccC-CC----CCcchHHhhHHHHHhhCCchhhhhcccccccCCCccccc-cCccccc
Q 037424 20 IGRSLKSSFRLQTSSF--RSSSAISS-RR----EDTDVENALQWAEIERLPTYDRLKTSLFDVNSNKDLVDN-QGKQAIN 91 (231)
Q Consensus 20 ~~~~~~~~~~~~~~~~--~~~~~~~~-~~----~~~~dee~l~waaierLPt~~r~r~~~l~~~~~~~g~~~-~~~~~vd 91 (231)
+.|+++++. +.++| +++|++.+ ++ ..+||||+|+|||+||||||+|+|++++.....++|.+. ....++|
T Consensus 8 ~~~~~~~~~--~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 85 (1470)
T PLN03140 8 MRRSISRSV--SRSSRNMEDVFSGGSQSRRRTSSVDEDEEALKWAAIEKLPTYSRLRTSIMKSFVENDVYGNQLLHKEVD 85 (1470)
T ss_pred HHHHHHHHh--hhhhhhhhhhhhccchhccccccccCChHhhhhHHhhhCCchhhhhhhhhhcccccccccccccccccc
Confidence 445544333 23356 78885532 21 256889999999999999999999999954210122110 0011499
Q ss_pred ccCCChhhhhHHHHHHHhhcccCHHHHHHHHHHhhhhcCCCCCeeEEEEEeEEEEEeeeeccCCCCCCchhhhhhhhhhc
Q 037424 92 VTKLGALERHVFIEKLIKHIEHDNLQLLRKIRKRMDKVGVKLPTIEVRYKNLWVEAKCEVVHGKPLPTLWNSFKGMISVL 171 (231)
Q Consensus 92 v~~L~~~~~~~l~~~l~~~~~~D~~~~L~~lr~r~drvGi~lp~ieVrfenLsV~a~~~~vg~~~lPTL~n~~~~~~~~l 171 (231)
+.+|+.++++.+++++++++++|+++|++++++|.+++|+++|++||+|+||+|+|++ +++++++||++|.+.+.++.+
T Consensus 86 ~~~~~~~~~~~~~~~~~~~~~~d~~~~~~~~~~~~~~~~~~~~~~~v~~~~l~v~~~~-~~~~~~~~t~~~~~~~~~~~~ 164 (1470)
T PLN03140 86 VTKLDGNDRQKFIDMVFKVAEEDNEKFLKKFRNRIDRVGIKLPTVEVRFEHLTVEADC-YIGSRALPTLPNAARNIAESA 164 (1470)
T ss_pred cccCChHHHHHHHHhhhcccchhHHHHHHHHHhhhccccCCCCCCeeEEeCCEEEEEe-cCCcccCCcHHHHHHHHHHHH
Confidence 9999999999999999999999999999999999999999999999999999999998 899999999999999988866
Q ss_pred ccccCC-CCccccccccccceeEEeCCeEEEEecCCCCCchhHHHHHHH
Q 037424 172 PKLSGY-KSLEAKINILNRVSGILKPGSVNLADCLTFLHPLDVFQVLFL 219 (231)
Q Consensus 172 ~~~~~~-~~kk~~~~IL~dVSGiiKPGeMTLVLGrPGSGcSTlLK~L~~ 219 (231)
...++. .+++.+++||+||||.|+||||++||||||||||||||+|+=
T Consensus 165 ~~~~~~~~~k~~~~~IL~~vs~~i~~Ge~~~llGpnGSGKSTLLk~LaG 213 (1470)
T PLN03140 165 LGMLGINLAKKTKLTILKDASGIIKPSRMTLLLGPPSSGKTTLLLALAG 213 (1470)
T ss_pred HHHhccccCCCccceeccCCeEEEeCCeEEEEEcCCCCCHHHHHHHHhC
Confidence 554443 344567889999999999999999999999999999999873
|
|
| >KOG0065 consensus Pleiotropic drug resistance proteins (PDR1-15), ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] | Back alignment and domain information |
|---|
| >TIGR00956 3a01205 Pleiotropic Drug Resistance (PDR) Family protein | Back alignment and domain information |
|---|
| >KOG0061 consensus Transporter, ABC superfamily (Breast cancer resistance protein) [Secondary metabolites biosynthesis, transport and catabolism] | Back alignment and domain information |
|---|
| >PF14510 ABC_trans_N: ABC-transporter extracellular N-terminal | Back alignment and domain information |
|---|
| >PLN03211 ABC transporter G-25; Provisional | Back alignment and domain information |
|---|
| >COG4559 ABC-type hemin transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PLN03140 ABC transporter G family member; Provisional | Back alignment and domain information |
|---|
| >TIGR00955 3a01204 The Eye Pigment Precursor Transporter (EPP) Family protein | Back alignment and domain information |
|---|
| >COG1131 CcmA ABC-type multidrug transport system, ATPase component [Defense mechanisms] | Back alignment and domain information |
|---|
| >cd03267 ABC_NatA_like Similar in sequence to NatA, this is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled to proton or K+ uptake | Back alignment and domain information |
|---|
| >TIGR00956 3a01205 Pleiotropic Drug Resistance (PDR) Family protein | Back alignment and domain information |
|---|
| >PRK14265 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03263 ABC_subfamily_A The ABCA subfamily mediates the transport of a variety of lipid compounds | Back alignment and domain information |
|---|
| >cd03255 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE) | Back alignment and domain information |
|---|
| >cd03213 ABCG_EPDR ABCG transporters are involved in eye pigment (EP) precursor transport, regulation of lipid-trafficking mechanisms, and pleiotropic drug resistance (DR) | Back alignment and domain information |
|---|
| >PRK10744 pstB phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK13632 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK14273 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14237 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14248 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14259 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03225 ABC_cobalt_CbiO_domain1 Domain I of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota | Back alignment and domain information |
|---|
| >cd03301 ABC_MalK_N The N-terminal ATPase domain of the maltose transporter, MalK | Back alignment and domain information |
|---|
| >COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] | Back alignment and domain information |
|---|
| >cd03226 ABC_cobalt_CbiO_domain2 Domain II of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota | Back alignment and domain information |
|---|
| >PRK14250 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02673 FtsE cell division ATP-binding protein FtsE | Back alignment and domain information |
|---|
| >COG1121 ZnuC ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >cd03257 ABC_NikE_OppD_transporters The ABC transporter subfamily specific for the transport of dipeptides, oligopeptides (OppD), and nickel (NikDE) | Back alignment and domain information |
|---|
| >cd03234 ABCG_White The White subfamily represents ABC transporters homologous to the Drosophila white gene, which acts as a dimeric importer for eye pigment precursors | Back alignment and domain information |
|---|
| >TIGR00960 3a0501s02 Type II (General) Secretory Pathway (IISP) Family protein | Back alignment and domain information |
|---|
| >cd03292 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-binding protein that binds FtsX to form a heterodimeric ATP-binding cassette (ABC)-type transporter that associates with the bacterial inner membrane | Back alignment and domain information |
|---|
| >TIGR01978 sufC FeS assembly ATPase SufC | Back alignment and domain information |
|---|
| >cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis | Back alignment and domain information |
|---|
| >cd03261 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) transport system involved in resistant to organic solvents; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules | Back alignment and domain information |
|---|
| >cd03233 ABC_PDR_domain1 The pleiotropic drug resistance (PDR) family of ATP-binding cassette (ABC) transporters | Back alignment and domain information |
|---|
| >TIGR02211 LolD_lipo_ex lipoprotein releasing system, ATP-binding protein | Back alignment and domain information |
|---|
| >cd03265 ABC_DrrA DrrA is the ATP-binding protein component of a bacterial exporter complex that confers resistance to the antibiotics daunorubicin and doxorubicin | Back alignment and domain information |
|---|
| >cd03232 ABC_PDR_domain2 The pleiotropic drug resistance-like (PDR) family of ATP-binding cassette (ABC) transporters | Back alignment and domain information |
|---|
| >COG1120 FepC ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] | Back alignment and domain information |
|---|
| >cd03293 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-binding subunits of the bacterial ABC-type nitrate and sulfonate transport systems, respectively | Back alignment and domain information |
|---|
| >PRK14255 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03262 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-binding components of the bacterial periplasmic histidine and glutamine permeases, repectively | Back alignment and domain information |
|---|
| >cd03259 ABC_Carb_Solutes_like ABC Carbohydrate and Solute Transporters-like subgroup | Back alignment and domain information |
|---|
| >cd03260 ABC_PstB_phosphate_transporter Phosphate uptake is of fundamental importance in the cell physiology of bacteria because phosphate is required as a nutrient | Back alignment and domain information |
|---|
| >KOG0065 consensus Pleiotropic drug resistance proteins (PDR1-15), ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] | Back alignment and domain information |
|---|
| >cd03224 ABC_TM1139_LivF_branched LivF (TM1139) is part of the LIV-I bacterial ABC-type two-component transport system that imports neutral, branched-chain amino acids | Back alignment and domain information |
|---|
| >cd03250 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C | Back alignment and domain information |
|---|
| >cd03269 ABC_putative_ATPase This subfamily is involved in drug resistance, nodulation, lipid transport, and bacteriocin and lantibiotic immunity | Back alignment and domain information |
|---|
| >PRK14261 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK11629 lolD lipoprotein transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR03873 F420-0_ABC_ATP proposed F420-0 ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >TIGR03410 urea_trans_UrtE urea ABC transporter, ATP-binding protein UrtE | Back alignment and domain information |
|---|
| >TIGR02324 CP_lyasePhnL phosphonate C-P lyase system protein PhnL | Back alignment and domain information |
|---|
| >cd03218 ABC_YhbG The ABC transporters belonging to the YhbG family are similar to members of the Mj1267_LivG family, which is involved in the transport of branched-chain amino acids | Back alignment and domain information |
|---|
| >PRK14242 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14235 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK10908 cell division protein FtsE; Provisional | Back alignment and domain information |
|---|
| >TIGR02315 ABC_phnC phosphonate ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >cd03296 ABC_CysA_sulfate_importer Part of the ABC transporter complex cysAWTP involved in sulfate import | Back alignment and domain information |
|---|
| >cd03228 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export | Back alignment and domain information |
|---|
| >cd03258 ABC_MetN_methionine_transporter MetN (also known as YusC) is an ABC-type transporter encoded by metN of the metNPQ operon in Bacillus subtilis that is involved in methionine transport | Back alignment and domain information |
|---|
| >cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos) | Back alignment and domain information |
|---|
| >cd03219 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC transporter subfamily is involved in the transport of the hydrophobic amino acids leucine, isoleucine and valine | Back alignment and domain information |
|---|
| >PRK13546 teichoic acids export protein ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03256 ABC_PhnC_transporter ABC-type phosphate/phosphonate transport system | Back alignment and domain information |
|---|
| >PRK11701 phnK phosphonate C-P lyase system protein PhnK; Provisional | Back alignment and domain information |
|---|
| >PRK11248 tauB taurine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK11264 putative amino-acid ABC transporter ATP-binding protein YecC; Provisional | Back alignment and domain information |
|---|
| >cd03268 ABC_BcrA_bacitracin_resist The BcrA subfamily represents ABC transporters involved in peptide antibiotic resistance | Back alignment and domain information |
|---|
| >PRK13538 cytochrome c biogenesis protein CcmA; Provisional | Back alignment and domain information |
|---|
| >COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >cd03249 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) is a mitochondrial ATP-binding cassette protein involved in iron homeostasis and one of four ABC transporters expressed in the mitochondrial inner membrane, the other three being MDL1(ABC7), MDL2, and ATM1 | Back alignment and domain information |
|---|
| >TIGR03411 urea_trans_UrtD urea ABC transporter, ATP-binding protein UrtD | Back alignment and domain information |
|---|
| >cd03215 ABC_Carb_Monos_II This family represents domain II of the carbohydrate uptake proteins that transport only monosaccharides (Monos) | Back alignment and domain information |
|---|
| >PRK10247 putative ABC transporter ATP-binding protein YbbL; Provisional | Back alignment and domain information |
|---|
| >PRK13540 cytochrome c biogenesis protein CcmA; Provisional | Back alignment and domain information |
|---|
| >cd03295 ABC_OpuCA_Osmoprotection OpuCA is a the ATP binding component of a bacterial solute transporter that serves a protective role to cells growing in a hyperosmolar environment | Back alignment and domain information |
|---|
| >cd03291 ABCC_CFTR1 The CFTR subfamily domain 1 | Back alignment and domain information |
|---|
| >PRK14267 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03244 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C | Back alignment and domain information |
|---|
| >cd03230 ABC_DR_subfamily_A This family of ATP-binding proteins belongs to a multisubunit transporter involved in drug resistance (BcrA and DrrA), nodulation, lipid transport, and lantibiotic immunity | Back alignment and domain information |
|---|
| >TIGR03005 ectoine_ehuA ectoine/hydroxyectoine ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >PRK14241 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03254 ABCC_Glucan_exporter_like Glucan exporter ATP-binding protein | Back alignment and domain information |
|---|
| >PRK11614 livF leucine/isoleucine/valine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK14256 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03864 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system | Back alignment and domain information |
|---|
| >PRK14245 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14275 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03220 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transporter subfamily is involved in extracellular polysaccharide export | Back alignment and domain information |
|---|
| >PRK14240 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK13649 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK10584 putative ABC transporter ATP-binding protein YbbA; Provisional | Back alignment and domain information |
|---|
| >TIGR02769 nickel_nikE nickel import ATP-binding protein NikE | Back alignment and domain information |
|---|
| >PRK14274 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK09493 glnQ glutamine ABC transporter ATP-binding protein; Reviewed | Back alignment and domain information |
|---|
| >cd03223 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette transporter (Pat) is involved in the import of very long-chain fatty acids (VLCFA) into the peroxisome | Back alignment and domain information |
|---|
| >COG3638 ABC-type phosphate/phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK13539 cytochrome c biogenesis protein CcmA; Provisional | Back alignment and domain information |
|---|
| >cd03290 ABCC_SUR1_N The SUR domain 1 | Back alignment and domain information |
|---|
| >cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth | Back alignment and domain information |
|---|
| >TIGR01189 ccmA heme ABC exporter, ATP-binding protein CcmA | Back alignment and domain information |
|---|
| >cd03253 ABCC_ATM1_transporter ATM1 is an ABC transporter that is expressed in the mitochondria | Back alignment and domain information |
|---|
| >cd03229 ABC_Class3 This class is comprised of all BPD (Binding Protein Dependent) systems that are largely represented in archaea and eubacteria and are primarily involved in scavenging solutes from the environment | Back alignment and domain information |
|---|
| >PRK10895 lipopolysaccharide ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK09580 sufC cysteine desulfurase ATPase component; Reviewed | Back alignment and domain information |
|---|
| >PRK11300 livG leucine/isoleucine/valine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03266 ABC_NatA_sodium_exporter NatA is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled proton or K+ uptake | Back alignment and domain information |
|---|
| >TIGR02323 CP_lyasePhnK phosphonate C-P lyase system protein PhnK | Back alignment and domain information |
|---|
| >PRK11124 artP arginine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK14247 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14253 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >COG0410 LivF ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK14270 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK13645 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK13648 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK14262 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK15056 manganese/iron transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03289 ABCC_CFTR2 The CFTR subfamily domain 2 | Back alignment and domain information |
|---|
| >cd03217 ABC_FeS_Assembly ABC-type transport system involved in Fe-S cluster assembly, ATPase component | Back alignment and domain information |
|---|
| >cd03246 ABCC_Protease_Secretion This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain | Back alignment and domain information |
|---|
| >PRK14239 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >COG2884 FtsE Predicted ATPase involved in cell division [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PRK14244 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02982 heterocyst_DevA ABC exporter ATP-binding subunit, DevA family | Back alignment and domain information |
|---|
| >PRK13646 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK11831 putative ABC transporter ATP-binding protein YrbF; Provisional | Back alignment and domain information |
|---|
| >PRK14260 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03251 ABCC_MsbA MsbA is an essential ABC transporter, closely related to eukaryotic MDR proteins | Back alignment and domain information |
|---|
| >PRK14268 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03740 galliderm_ABC gallidermin-class lantibiotic protection ABC transporter, ATP-binding subunit | Back alignment and domain information |
|---|
| >cd03245 ABCC_bacteriocin_exporters ABC-type bacteriocin exporters | Back alignment and domain information |
|---|
| >PRK14269 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK11247 ssuB aliphatic sulfonates transport ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK10575 iron-hydroxamate transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK14272 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK13547 hmuV hemin importer ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03294 ABC_Pro_Gly_Bertaine This family comprises the glycine betaine/L-proline ATP binding subunit in bacteria and its equivalents in archaea | Back alignment and domain information |
|---|
| >PRK13650 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03248 ABCC_TAP TAP, the Transporter Associated with Antigen Processing; TAP is essential for peptide delivery from the cytosol into the lumen of the endoplasmic reticulum (ER), where these peptides are loaded on major histocompatibility complex (MHC) I molecules | Back alignment and domain information |
|---|
| >CHL00131 ycf16 sulfate ABC transporter protein; Validated | Back alignment and domain information |
|---|
| >PRK13641 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03252 ABCC_Hemolysin The ABC-transporter hemolysin B is a central component of the secretion machinery that translocates the toxin, hemolysin A, in a Sec-independent fashion across both membranes of E | Back alignment and domain information |
|---|
| >TIGR01288 nodI ATP-binding ABC transporter family nodulation protein NodI | Back alignment and domain information |
|---|
| >PRK14251 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK15112 antimicrobial peptide ABC system ATP-binding protein SapF; Provisional | Back alignment and domain information |
|---|
| >cd03288 ABCC_SUR2 The SUR domain 2 | Back alignment and domain information |
|---|
| >PRK13638 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK10418 nikD nickel transporter ATP-binding protein NikD; Provisional | Back alignment and domain information |
|---|
| >cd03369 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-type transporter 1) | Back alignment and domain information |
|---|
| >PRK13548 hmuV hemin importer ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK11231 fecE iron-dicitrate transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR00972 3a0107s01c2 phosphate ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >PRK09544 znuC high-affinity zinc transporter ATPase; Reviewed | Back alignment and domain information |
|---|
| >PRK14266 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14271 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK13644 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >COG4619 ABC-type uncharacterized transport system, ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >PRK13634 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK13543 cytochrome c biogenesis protein CcmA; Provisional | Back alignment and domain information |
|---|
| >PRK13639 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK09984 phosphonate/organophosphate ester transporter subunit; Provisional | Back alignment and domain information |
|---|
| >COG1134 TagH ABC-type polysaccharide/polyol phosphate transport system, ATPase component [Carbohydrate transport and metabolism / Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >PRK11022 dppD dipeptide transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK14263 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >COG3842 PotA ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK14236 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK15093 antimicrobial peptide ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK13637 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR00968 3a0106s01 sulfate ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >cd03300 ABC_PotA_N PotA is an ABC-type transporter and the ATPase component of the spermidine/putrescine-preferential uptake system consisting of PotA, -B, -C, and -D | Back alignment and domain information |
|---|
| >PRK14249 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03231 ABC_CcmA_heme_exporter CcmA, the ATP-binding component of the bacterial CcmAB transporter | Back alignment and domain information |
|---|
| >PRK13537 nodulation ABC transporter NodI; Provisional | Back alignment and domain information |
|---|
| >PRK10419 nikE nickel transporter ATP-binding protein NikE; Provisional | Back alignment and domain information |
|---|
| >PRK10253 iron-enterobactin transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14246 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK13635 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK14238 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14243 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >COG0396 sufC Cysteine desulfurase activator ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK13647 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR03522 GldA_ABC_ATP gliding motility-associated ABC transporter ATP-binding subunit GldA | Back alignment and domain information |
|---|
| >PRK14252 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK13633 cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >COG1117 PstB ABC-type phosphate transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >cd00267 ABC_ATPase ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules | Back alignment and domain information |
|---|
| >PRK11153 metN DL-methionine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK14254 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK09473 oppD oligopeptide transporter ATP-binding component; Provisional | Back alignment and domain information |
|---|
| >COG1116 TauB ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >cd03236 ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 of RNase L inhibitor | Back alignment and domain information |
|---|
| >PRK13643 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK14258 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK13636 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK10619 histidine/lysine/arginine/ornithine transporter subunit; Provisional | Back alignment and domain information |
|---|
| >PRK13652 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK11650 ugpC glycerol-3-phosphate transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK14264 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03265 PhnT2 putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >PRK13651 cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd00820 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPCK), a critical gluconeogenic enzyme, catalyzes the first committed step in the diversion of tricarboxylic acid cycle intermediates toward gluconeogenesis | Back alignment and domain information |
|---|
| >PRK13631 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK13640 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK13642 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK13541 cytochrome c biogenesis protein CcmA; Provisional | Back alignment and domain information |
|---|
| >PRK11000 maltose/maltodextrin transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK09452 potA putrescine/spermidine ABC transporter ATPase protein; Reviewed | Back alignment and domain information |
|---|
| >PRK09536 btuD corrinoid ABC transporter ATPase; Reviewed | Back alignment and domain information |
|---|
| >TIGR02314 ABC_MetN D-methionine ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >TIGR03258 PhnT 2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT | Back alignment and domain information |
|---|
| >PRK11432 fbpC ferric transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK14257 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK10851 sulfate/thiosulfate transporter subunit; Provisional | Back alignment and domain information |
|---|
| >PRK09700 D-allose transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK10938 putative molybdenum transport ATP-binding protein ModF; Provisional | Back alignment and domain information |
|---|
| >PRK13549 xylose transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK13536 nodulation factor exporter subunit NodI; Provisional | Back alignment and domain information |
|---|
| >PRK11607 potG putrescine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >COG1122 CbiO ABC-type cobalt transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK15439 autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional | Back alignment and domain information |
|---|
| >PRK10762 D-ribose transporter ATP binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK10636 putative ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03269 met_CoM_red_A2 methyl coenzyme M reductase system, component A2 | Back alignment and domain information |
|---|
| >PRK15079 oligopeptide ABC transporter ATP-binding protein OppF; Provisional | Back alignment and domain information |
|---|
| >PRK11176 lipid transporter ATP-binding/permease protein; Provisional | Back alignment and domain information |
|---|
| >PRK11308 dppF dipeptide transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK11160 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed | Back alignment and domain information |
|---|
| >PRK11819 putative ABC transporter ATP-binding protein; Reviewed | Back alignment and domain information |
|---|
| >TIGR02633 xylG D-xylose ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >PRK15134 microcin C ABC transporter ATP-binding protein YejF; Provisional | Back alignment and domain information |
|---|
| >TIGR02857 CydD thiol reductant ABC exporter, CydD subunit | Back alignment and domain information |
|---|
| >PRK11288 araG L-arabinose transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03719 ABC_ABC_ChvD ATP-binding cassette protein, ChvD family | Back alignment and domain information |
|---|
| >PRK15064 ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >KOG0057 consensus Mitochondrial Fe/S cluster exporter, ABC superfamily [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PRK10938 putative molybdenum transport ATP-binding protein ModF; Provisional | Back alignment and domain information |
|---|
| >COG3839 MalK ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR02633 xylG D-xylose ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >TIGR03415 ABC_choXWV_ATP choline ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >COG1118 CysA ABC-type sulfate/molybdate transport systems, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK15134 microcin C ABC transporter ATP-binding protein YejF; Provisional | Back alignment and domain information |
|---|
| >COG4181 Predicted ABC-type transport system involved in lysophospholipase L1 biosynthesis, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >TIGR03797 NHPM_micro_ABC2 NHPM bacteriocin system ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >COG1127 Ttg2A ABC-type transport system involved in resistance to organic solvents, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids | Back alignment and domain information |
|---|
| >TIGR03269 met_CoM_red_A2 methyl coenzyme M reductase system, component A2 | Back alignment and domain information |
|---|
| >PRK13549 xylose transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK15064 ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02868 CydC thiol reductant ABC exporter, CydC subunit | Back alignment and domain information |
|---|
| >COG1132 MdlB ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms] | Back alignment and domain information |
|---|
| >PRK11147 ABC transporter ATPase component; Reviewed | Back alignment and domain information |
|---|
| >COG4525 TauB ABC-type taurine transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK10636 putative ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK09700 D-allose transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03719 ABC_ABC_ChvD ATP-binding cassette protein, ChvD family | Back alignment and domain information |
|---|
| >TIGR01194 cyc_pep_trnsptr cyclic peptide transporter | Back alignment and domain information |
|---|
| >PRK10070 glycine betaine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK11819 putative ABC transporter ATP-binding protein; Reviewed | Back alignment and domain information |
|---|
| >COG1125 OpuBA ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >COG1124 DppF ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK10762 D-ribose transporter ATP binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK11147 ABC transporter ATPase component; Reviewed | Back alignment and domain information |
|---|
| >TIGR03375 type_I_sec_LssB type I secretion system ATPase, LssB family | Back alignment and domain information |
|---|
| >PRK13545 tagH teichoic acids export protein ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK11288 araG L-arabinose transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK11174 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed | Back alignment and domain information |
|---|
| >TIGR02204 MsbA_rel ABC transporter, permease/ATP-binding protein | Back alignment and domain information |
|---|
| >PRK10261 glutathione transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK10261 glutathione transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >COG2274 SunT ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms] | Back alignment and domain information |
|---|
| >COG4555 NatA ABC-type Na+ transport system, ATPase component [Energy production and conversion / Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK10982 galactose/methyl galaxtoside transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK10522 multidrug transporter membrane component/ATP-binding component; Provisional | Back alignment and domain information |
|---|
| >PLN03073 ABC transporter F family; Provisional | Back alignment and domain information |
|---|
| >TIGR00958 3a01208 Conjugate Transporter-2 (CT2) Family protein | Back alignment and domain information |
|---|
| >TIGR01193 bacteriocin_ABC ABC-type bacteriocin transporter | Back alignment and domain information |
|---|
| >TIGR03796 NHPM_micro_ABC1 NHPM bacteriocin system ABC transporter, peptidase/ATP-binding protein | Back alignment and domain information |
|---|
| >PRK15439 autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional | Back alignment and domain information |
|---|
| >COG0411 LivG ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK10789 putative multidrug transporter membrane\ATP-binding components; Provisional | Back alignment and domain information |
|---|
| >TIGR01842 type_I_sec_PrtD type I secretion system ABC transporter, PrtD family | Back alignment and domain information |
|---|
| >PRK13657 cyclic beta-1,2-glucan ABC transporter; Provisional | Back alignment and domain information |
|---|
| >COG4618 ArpD ABC-type protease/lipase transport system, ATPase and permease components [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR02203 MsbA_lipidA lipid A export permease/ATP-binding protein MsbA | Back alignment and domain information |
|---|
| >PRK10790 putative multidrug transporter membrane\ATP-binding components; Provisional | Back alignment and domain information |
|---|
| >KOG0056 consensus Heavy metal exporter HMT1, ABC superfamily [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR01271 CFTR_protein cystic fibrosis transmembrane conductor regulator (CFTR) | Back alignment and domain information |
|---|
| >PLN03073 ABC transporter F family; Provisional | Back alignment and domain information |
|---|
| >TIGR00954 3a01203 Peroxysomal Fatty Acyl CoA Transporter (FAT) Family protei | Back alignment and domain information |
|---|
| >KOG0058 consensus Peptide exporter, ABC superfamily [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >TIGR00957 MRP_assoc_pro multi drug resistance-associated protein (MRP) | Back alignment and domain information |
|---|
| >PTZ00243 ABC transporter; Provisional | Back alignment and domain information |
|---|
| >PRK10535 macrolide transporter ATP-binding /permease protein; Provisional | Back alignment and domain information |
|---|
| >PLN03232 ABC transporter C family member; Provisional | Back alignment and domain information |
|---|
| >PRK13409 putative ATPase RIL; Provisional | Back alignment and domain information |
|---|
| >PRK13409 putative ATPase RIL; Provisional | Back alignment and domain information |
|---|
| >COG4778 PhnL ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR01192 chvA glucan exporter ATP-binding protein | Back alignment and domain information |
|---|
| >PLN03130 ABC transporter C family member; Provisional | Back alignment and domain information |
|---|
| >TIGR01846 type_I_sec_HlyB type I secretion system ABC transporter, HlyB family | Back alignment and domain information |
|---|
| >COG4133 CcmA ABC-type transport system involved in cytochrome c biogenesis, ATPase component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd03282 ABC_MSH4_euk MutS4 homolog in eukaryotes | Back alignment and domain information |
|---|
| >COG4988 CydD ABC-type transport system involved in cytochrome bd biosynthesis, ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG4987 CydC ABC-type transport system involved in cytochrome bd biosynthesis, fused ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG4586 ABC-type uncharacterized transport system, ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >COG2401 ABC-type ATPase fused to a predicted acetyltransferase domain [General function prediction only] | Back alignment and domain information |
|---|
| >COG4178 ABC-type uncharacterized transport system, permease and ATPase components [General function prediction only] | Back alignment and domain information |
|---|
| >PF13555 AAA_29: P-loop containing region of AAA domain | Back alignment and domain information |
|---|
| >TIGR03238 dnd_assoc_3 dnd system-associated protein 3 | Back alignment and domain information |
|---|
| >COG1119 ModF ABC-type molybdenum transport system, ATPase component/photorepair protein PhrA [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >COG1135 AbcC ABC-type metal ion transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR01271 CFTR_protein cystic fibrosis transmembrane conductor regulator (CFTR) | Back alignment and domain information |
|---|
| >COG4674 Uncharacterized ABC-type transport system, ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >COG1123 ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] | Back alignment and domain information |
|---|
| >PTZ00265 multidrug resistance protein (mdr1); Provisional | Back alignment and domain information |
|---|
| >COG4152 ABC-type uncharacterized transport system, ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0054 consensus Multidrug resistance-associated protein/mitoxantrone resistance protein, ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] | Back alignment and domain information |
|---|
| >cd03280 ABC_MutS2 MutS2 homologs in bacteria and eukaryotes | Back alignment and domain information |
|---|
| >COG1129 MglA ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PTZ00243 ABC transporter; Provisional | Back alignment and domain information |
|---|
| >COG0488 Uup ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] | Back alignment and domain information |
|---|
| >PLN03232 ABC transporter C family member; Provisional | Back alignment and domain information |
|---|
| >cd03287 ABC_MSH3_euk MutS3 homolog in eukaryotes | Back alignment and domain information |
|---|
| >TIGR00957 MRP_assoc_pro multi drug resistance-associated protein (MRP) | Back alignment and domain information |
|---|
| >cd03243 ABC_MutS_homologs The MutS protein initiates DNA mismatch repair by recognizing mispaired and unpaired bases embedded in duplex DNA and activating endo- and exonucleases to remove the mismatch | Back alignment and domain information |
|---|
| >cd03284 ABC_MutS1 MutS1 homolog in eukaryotes | Back alignment and domain information |
|---|
| >COG1123 ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] | Back alignment and domain information |
|---|
| >PTZ00265 multidrug resistance protein (mdr1); Provisional | Back alignment and domain information |
|---|
| >PLN03130 ABC transporter C family member; Provisional | Back alignment and domain information |
|---|
| >TIGR01257 rim_protein retinal-specific rim ABC transporter | Back alignment and domain information |
|---|
| >COG0488 Uup ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] | Back alignment and domain information |
|---|
| >COG4161 ArtP ABC-type arginine transport system, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR01257 rim_protein retinal-specific rim ABC transporter | Back alignment and domain information |
|---|
| >COG4107 PhnK ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >COG1137 YhbG ABC-type (unclassified) transport system, ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >COG0444 DppD ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >COG4136 ABC-type uncharacterized transport system, ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >COG3845 ABC-type uncharacterized transport systems, ATPase components [General function prediction only] | Back alignment and domain information |
|---|
| >cd03285 ABC_MSH2_euk MutS2 homolog in eukaryotes | Back alignment and domain information |
|---|
| >KOG0055 consensus Multidrug/pheromone exporter, ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] | Back alignment and domain information |
|---|
| >COG4604 CeuD ABC-type enterochelin transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >COG4598 HisP ABC-type histidine transport system, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >cd01122 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' helicases | Back alignment and domain information |
|---|
| >TIGR00750 lao LAO/AO transport system ATPase | Back alignment and domain information |
|---|
| >cd03286 ABC_MSH6_euk MutS6 homolog in eukaryotes | Back alignment and domain information |
|---|
| >COG4608 AppF ABC-type oligopeptide transport system, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PF13481 AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C | Back alignment and domain information |
|---|
| >COG5265 ATM1 ABC-type transport system involved in Fe-S cluster assembly, permease and ATPase components [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd03279 ABC_sbcCD SbcCD and other Mre11/Rad50 (MR) complexes are implicated in the metabolism of DNA ends | Back alignment and domain information |
|---|
| >TIGR02788 VirB11 P-type DNA transfer ATPase VirB11 | Back alignment and domain information |
|---|
| >cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold | Back alignment and domain information |
|---|
| >TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily | Back alignment and domain information |
|---|
| >KOG0054 consensus Multidrug resistance-associated protein/mitoxantrone resistance protein, ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] | Back alignment and domain information |
|---|
| >TIGR02524 dot_icm_DotB Dot/Icm secretion system ATPase DotB | Back alignment and domain information |
|---|
| >PF13245 AAA_19: Part of AAA domain | Back alignment and domain information |
|---|
| >COG1101 PhnK ABC-type uncharacterized transport system, ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >COG4175 ProV ABC-type proline/glycine betaine transport system, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK05973 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >TIGR00150 HI0065_YjeE ATPase, YjeE family | Back alignment and domain information |
|---|
| >cd03281 ABC_MSH5_euk MutS5 homolog in eukaryotes | Back alignment and domain information |
|---|
| >PRK09183 transposase/IS protein; Provisional | Back alignment and domain information |
|---|
| >TIGR01420 pilT_fam pilus retraction protein PilT | Back alignment and domain information |
|---|
| >KOG0927 consensus Predicted transporter (ABC superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR00630 uvra excinuclease ABC, A subunit | Back alignment and domain information |
|---|
| >KOG2355 consensus Predicted ABC-type transport, ATPase component/CCR4 associated factor [General function prediction only; Transcription] | Back alignment and domain information |
|---|
| >PRK09270 nucleoside triphosphate hydrolase domain-containing protein; Reviewed | Back alignment and domain information |
|---|
| >PRK13851 type IV secretion system protein VirB11; Provisional | Back alignment and domain information |
|---|
| >TIGR02239 recomb_RAD51 DNA repair protein RAD51 | Back alignment and domain information |
|---|
| >COG3854 SpoIIIAA ncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >smart00763 AAA_PrkA PrkA AAA domain | Back alignment and domain information |
|---|
| >TIGR00767 rho transcription termination factor Rho | Back alignment and domain information |
|---|
| >PF00437 T2SE: Type II/IV secretion system protein; InterPro: IPR001482 A number of bacterial proteins, some of which are involved in a general secretion pathway (GSP) for the export of proteins (also called the type II pathway) belong to this group [, ] | Back alignment and domain information |
|---|
| >cd02019 NK Nucleoside/nucleotide kinase (NK) is a protein superfamily consisting of multiple families of enzymes that share structural similarity and are functionally related to the catalysis of the reversible phosphate group transfer from nucleoside triphosphates to nucleosides/nucleotides, nucleoside monophosphates, or sugars | Back alignment and domain information |
|---|
| >PRK10416 signal recognition particle-docking protein FtsY; Provisional | Back alignment and domain information |
|---|
| >TIGR00665 DnaB replicative DNA helicase | Back alignment and domain information |
|---|
| >TIGR01069 mutS2 MutS2 family protein | Back alignment and domain information |
|---|
| >PLN02796 D-glycerate 3-kinase | Back alignment and domain information |
|---|
| >PRK10463 hydrogenase nickel incorporation protein HypB; Provisional | Back alignment and domain information |
|---|
| >cd03227 ABC_Class2 ABC-type Class 2 contains systems involved in cellular processes other than transport | Back alignment and domain information |
|---|
| >PRK06002 fliI flagellum-specific ATP synthase; Validated | Back alignment and domain information |
|---|
| >PRK15494 era GTPase Era; Provisional | Back alignment and domain information |
|---|
| >cd01878 HflX HflX subfamily | Back alignment and domain information |
|---|
| >TIGR00602 rad24 checkpoint protein rad24 | Back alignment and domain information |
|---|
| >PRK08149 ATP synthase SpaL; Validated | Back alignment and domain information |
|---|
| >TIGR02782 TrbB_P P-type conjugative transfer ATPase TrbB | Back alignment and domain information |
|---|
| >PRK00098 GTPase RsgA; Reviewed | Back alignment and domain information |
|---|
| >PRK00349 uvrA excinuclease ABC subunit A; Reviewed | Back alignment and domain information |
|---|
| >cd01136 ATPase_flagellum-secretory_path_III Flagellum-specific ATPase/type III secretory pathway virulence-related protein | Back alignment and domain information |
|---|
| >PF03193 DUF258: Protein of unknown function, DUF258; InterPro: IPR004881 This entry contains Escherichia coli (strain K12) RsgA, which may play a role in 30S ribosomal subunit biogenesis | Back alignment and domain information |
|---|
| >cd01129 PulE-GspE PulE/GspE The type II secretory pathway is the main terminal branch of the general secretory pathway (GSP) | Back alignment and domain information |
|---|
| >PLN02200 adenylate kinase family protein | Back alignment and domain information |
|---|
| >KOG0055 consensus Multidrug/pheromone exporter, ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] | Back alignment and domain information |
|---|
| >PRK13894 conjugal transfer ATPase TrbB; Provisional | Back alignment and domain information |
|---|
| >TIGR02858 spore_III_AA stage III sporulation protein AA | Back alignment and domain information |
|---|
| >PRK07196 fliI flagellum-specific ATP synthase; Validated | Back alignment and domain information |
|---|
| >PRK00635 excinuclease ABC subunit A; Provisional | Back alignment and domain information |
|---|
| >KOG2373 consensus Predicted mitochondrial DNA helicase twinkle [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PRK07721 fliI flagellum-specific ATP synthase; Validated | Back alignment and domain information |
|---|
| >TIGR01526 nadR_NMN_Atrans nicotinamide-nucleotide adenylyltransferase, NadR type | Back alignment and domain information |
|---|
| >cd01858 NGP_1 NGP-1 | Back alignment and domain information |
|---|
| >KOG0060 consensus Long-chain acyl-CoA transporter, ABC superfamily (involved in peroxisome organization and biogenesis) [Lipid transport and metabolism; General function prediction only] | Back alignment and domain information |
|---|
| >PRK13900 type IV secretion system ATPase VirB11; Provisional | Back alignment and domain information |
|---|
| >cd01882 BMS1 Bms1 | Back alignment and domain information |
|---|
| >cd01121 Sms Sms (bacterial radA) DNA repair protein | Back alignment and domain information |
|---|
| >PTZ00035 Rad51 protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03600 phage_DnaB phage replicative helicase, DnaB family, HK022 subfamily | Back alignment and domain information |
|---|
| >cd01854 YjeQ_engC YjeQ/EngC | Back alignment and domain information |
|---|
| >TIGR00554 panK_bact pantothenate kinase, bacterial type | Back alignment and domain information |
|---|
| >PRK01889 GTPase RsgA; Reviewed | Back alignment and domain information |
|---|
| >TIGR03878 thermo_KaiC_2 KaiC domain protein, AF_0795 family | Back alignment and domain information |
|---|
| >TIGR00416 sms DNA repair protein RadA | Back alignment and domain information |
|---|
| >TIGR02525 plasmid_TraJ plasmid transfer ATPase TraJ | Back alignment and domain information |
|---|
| >PRK14721 flhF flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >COG4167 SapF ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] | Back alignment and domain information |
|---|
| >PRK13833 conjugal transfer protein TrbB; Provisional | Back alignment and domain information |
|---|
| >PF00488 MutS_V: MutS domain V C-terminus | Back alignment and domain information |
|---|
| >COG4615 PvdE ABC-type siderophore export system, fused ATPase and permease components [Secondary metabolites biosynthesis, transport, and catabolism / Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PF01580 FtsK_SpoIIIE: FtsK/SpoIIIE family; InterPro: IPR002543 The FtsK/SpoIIIE domain is found extensively in a wide variety of proteins from prokaryotes and plasmids [] some of which contain up to three copies | Back alignment and domain information |
|---|
| >PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated | Back alignment and domain information |
|---|
| >KOG0059 consensus Lipid exporter ABCA1 and related proteins, ABC superfamily [Lipid transport and metabolism; General function prediction only] | Back alignment and domain information |
|---|
| >PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional | Back alignment and domain information |
|---|
| >PRK09862 putative ATP-dependent protease; Provisional | Back alignment and domain information |
|---|
| >PRK14723 flhF flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PRK06731 flhF flagellar biosynthesis regulator FlhF; Validated | Back alignment and domain information |
|---|
| >PRK09165 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >PRK08972 fliI flagellum-specific ATP synthase; Validated | Back alignment and domain information |
|---|
| >TIGR02546 III_secr_ATP type III secretion apparatus H+-transporting two-sector ATPase | Back alignment and domain information |
|---|
| >PRK09099 type III secretion system ATPase; Provisional | Back alignment and domain information |
|---|
| >PRK09435 membrane ATPase/protein kinase; Provisional | Back alignment and domain information |
|---|
| >PRK07004 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >PRK07594 type III secretion system ATPase SsaN; Validated | Back alignment and domain information |
|---|
| >PRK05595 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >TIGR02236 recomb_radA DNA repair and recombination protein RadA | Back alignment and domain information |
|---|
| >TIGR00368 Mg chelatase-related protein | Back alignment and domain information |
|---|
| >PRK08760 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >cd01853 Toc34_like Toc34-like (Translocon at the Outer-envelope membrane of Chloroplasts) | Back alignment and domain information |
|---|
| >KOG0062 consensus ATPase component of ABC transporters with duplicated ATPase domains/Translation elongation factor EF-3b [Amino acid transport and metabolism; Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >TIGR02012 tigrfam_recA protein RecA | Back alignment and domain information |
|---|
| >PRK11823 DNA repair protein RadA; Provisional | Back alignment and domain information |
|---|
| >PRK05636 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >PHA02542 41 41 helicase; Provisional | Back alignment and domain information |
|---|
| >TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda | Back alignment and domain information |
|---|
| >PRK05688 fliI flagellum-specific ATP synthase; Validated | Back alignment and domain information |
|---|
| >PF03215 Rad17: Rad17 cell cycle checkpoint protein | Back alignment and domain information |
|---|
| >PRK00635 excinuclease ABC subunit A; Provisional | Back alignment and domain information |
|---|
| >TIGR03496 FliI_clade1 flagellar protein export ATPase FliI | Back alignment and domain information |
|---|
| >PRK08506 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >TIGR01026 fliI_yscN ATPase FliI/YscN family | Back alignment and domain information |
|---|
| >cd01849 YlqF_related_GTPase YlqF-related GTPases | Back alignment and domain information |
|---|
| >PRK05748 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >PRK06936 type III secretion system ATPase; Provisional | Back alignment and domain information |
|---|
| >PLN02165 adenylate isopentenyltransferase | Back alignment and domain information |
|---|
| >cd00983 recA RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response | Back alignment and domain information |
|---|
| >PRK13477 bifunctional pantoate ligase/cytidylate kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR00157 ribosome small subunit-dependent GTPase A | Back alignment and domain information |
|---|
| >cd01855 YqeH YqeH | Back alignment and domain information |
|---|
| >PRK08472 fliI flagellum-specific ATP synthase; Validated | Back alignment and domain information |
|---|
| >PLN03186 DNA repair protein RAD51 homolog; Provisional | Back alignment and domain information |
|---|
| >PRK06321 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >PRK08006 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >TIGR03497 FliI_clade2 flagellar protein export ATPase FliI | Back alignment and domain information |
|---|
| >PRK13764 ATPase; Provisional | Back alignment and domain information |
|---|
| >COG4172 ABC-type uncharacterized transport system, duplicated ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR01242 26Sp45 26S proteasome subunit P45 family | Back alignment and domain information |
|---|
| >KOG0064 consensus Peroxisomal long-chain acyl-CoA transporter, ABC superfamily [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR02238 recomb_DMC1 meiotic recombinase Dmc1 | Back alignment and domain information |
|---|
| >TIGR02881 spore_V_K stage V sporulation protein K | Back alignment and domain information |
|---|
| >cd01857 HSR1_MMR1 HSR1/MMR1 | Back alignment and domain information |
|---|
| >TIGR02533 type_II_gspE general secretory pathway protein E | Back alignment and domain information |
|---|
| >TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily | Back alignment and domain information |
|---|
| >PRK06904 replicative DNA helicase; Validated | Back alignment and domain information |
|---|
| >PRK15455 PrkA family serine protein kinase; Provisional | Back alignment and domain information |
|---|
| >PLN03187 meiotic recombination protein DMC1 homolog; Provisional | Back alignment and domain information |
|---|
| >PRK12288 GTPase RsgA; Reviewed | Back alignment and domain information |
|---|
| >PRK04301 radA DNA repair and recombination protein RadA; Validated | Back alignment and domain information |
|---|
| >KOG1970 consensus Checkpoint RAD17-RFC complex, RAD17/RAD24 component [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PLN02674 adenylate kinase | Back alignment and domain information |
|---|
| >PTZ00361 26 proteosome regulatory subunit 4-like protein; Provisional | Back alignment and domain information |
|---|
| >PHA02562 46 endonuclease subunit; Provisional | Back alignment and domain information |
|---|
| >PRK08154 anaerobic benzoate catabolism transcriptional regulator; Reviewed | Back alignment and domain information |
|---|
| >PF08298 AAA_PrkA: PrkA AAA domain; InterPro: IPR013153 This is entry is found at the N terminus of PrkA proteins - bacterial and archaeal serine kinases approximately 630 residues in length | Back alignment and domain information |
|---|
| >PRK12289 GTPase RsgA; Reviewed | Back alignment and domain information |
|---|
| >PRK08903 DnaA regulatory inactivator Hda; Validated | Back alignment and domain information |
|---|
| >TIGR02655 circ_KaiC circadian clock protein KaiC | Back alignment and domain information |
|---|
| >PRK09302 circadian clock protein KaiC; Reviewed | Back alignment and domain information |
|---|
| >TIGR03185 DNA_S_dndD DNA sulfur modification protein DndD | Back alignment and domain information |
|---|
| >COG4172 ABC-type uncharacterized transport system, duplicated ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR03498 FliI_clade3 flagellar protein export ATPase FliI | Back alignment and domain information |
|---|
| >PF02367 UPF0079: Uncharacterised P-loop hydrolase UPF0079; InterPro: IPR003442 This group consists of bacterial proteins, which contain a P-loop | Back alignment and domain information |
|---|
| >PRK08840 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >PRK12726 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >TIGR03499 FlhF flagellar biosynthetic protein FlhF | Back alignment and domain information |
|---|
| >PRK13873 conjugal transfer ATPase TrbE; Provisional | Back alignment and domain information |
|---|
| >PRK04863 mukB cell division protein MukB; Provisional | Back alignment and domain information |
|---|
| >PRK06820 type III secretion system ATPase; Validated | Back alignment and domain information |
|---|
| >COG1855 ATPase (PilT family) [General function prediction only] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 231 | |||
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 8e-05 |
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
Score = 42.1 bits (98), Expect = 8e-05
Identities = 39/235 (16%), Positives = 77/235 (32%), Gaps = 49/235 (20%)
Query: 24 LKSSFRLQT--SSFRSSSAISSR-REDTDVENALQWAEIERLPTYDRLKTSLFDVNSNKD 80
L S + + S + I R R D + ++ + RL Y +L+ +L ++ K+
Sbjct: 94 LMSPIKTEQRQPSMMTRMYIEQRDRLYNDNQVFAKY-NVSRLQPYLKLRQALLELRPAKN 152
Query: 81 LVDN----QGKQ--AINVTK----LGALERHVFIEKLIK-HIEHDNLQLLRKIRKRMDKV 129
++ + GK A++V ++ +F L + L++L+K+ ++D
Sbjct: 153 VLIDGVLGSGKTWVALDVCLSYKVQCKMDFKIFWLNLKNCNSPETVLEMLQKLLYQIDPN 212
Query: 130 GVKLPTIEVRYK---NLWVEAKCEVVHGKPLP------------TLWNSFKGMISVLPKL 174
K + ++ KP WN+F
Sbjct: 213 WTSRSDHSSNIKLRIHSIQAELRRLLKSKPYENCLLVLLNVQNAKAWNAF---------- 262
Query: 175 SGYKSLEAKINILNRVSGILKPGSVNLADCLTFLHPLDVF-----QVLFLLVLWC 224
+L KI + R + S ++ H + L L L C
Sbjct: 263 ----NLSCKILLTTRFKQVTDFLSAATTTHISLDHHSMTLTPDEVKSLLLKYLDC 313
|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 231 | |||
| 3tif_A | 235 | Uncharacterized ABC transporter ATP-binding prote; | 98.68 | |
| 4g1u_C | 266 | Hemin import ATP-binding protein HMUV; membrane tr | 98.59 | |
| 2zu0_C | 267 | Probable ATP-dependent transporter SUFC; iron-sulf | 98.57 | |
| 2pcj_A | 224 | ABC transporter, lipoprotein-releasing system ATP- | 98.55 | |
| 1mv5_A | 243 | LMRA, multidrug resistance ABC transporter ATP-bin | 98.52 | |
| 2cbz_A | 237 | Multidrug resistance-associated protein 1; ABC pro | 98.51 | |
| 2d2e_A | 250 | SUFC protein; ABC-ATPase, SUF protein, 310-helix, | 98.51 | |
| 2ff7_A | 247 | Alpha-hemolysin translocation ATP-binding protein | 98.51 | |
| 2pze_A | 229 | Cystic fibrosis transmembrane conductance regulat; | 98.5 | |
| 1ji0_A | 240 | ABC transporter; ATP binding protein, structural g | 98.5 | |
| 1g6h_A | 257 | High-affinity branched-chain amino acid transport | 98.5 | |
| 1b0u_A | 262 | Histidine permease; ABC transporter, transport pro | 98.49 | |
| 3tui_C | 366 | Methionine import ATP-binding protein METN; ABC-tr | 98.48 | |
| 1sgw_A | 214 | Putative ABC transporter; structural genomics, P p | 98.47 | |
| 2olj_A | 263 | Amino acid ABC transporter; ABC domain, ATPase, hy | 98.47 | |
| 1vpl_A | 256 | ABC transporter, ATP-binding protein; TM0544, stru | 98.47 | |
| 2ixe_A | 271 | Antigen peptide transporter 1; ABC ATPase, hydrola | 98.46 | |
| 3gfo_A | 275 | Cobalt import ATP-binding protein CBIO 1; structur | 98.46 | |
| 2ghi_A | 260 | Transport protein; multidrug resistance protein, M | 98.46 | |
| 2ihy_A | 279 | ABC transporter, ATP-binding protein; ATPase, ABC | 98.46 | |
| 2nq2_C | 253 | Hypothetical ABC transporter ATP-binding protein H | 98.45 | |
| 2yz2_A | 266 | Putative ABC transporter ATP-binding protein TM_0; | 98.45 | |
| 2qi9_C | 249 | Vitamin B12 import ATP-binding protein BTUD; inner | 98.45 | |
| 1z47_A | 355 | CYSA, putative ABC-transporter ATP-binding protein | 98.38 | |
| 3fvq_A | 359 | Fe(3+) IONS import ATP-binding protein FBPC; nucle | 98.38 | |
| 1cr0_A | 296 | DNA primase/helicase; RECA-type protein fold, tran | 98.36 | |
| 2yyz_A | 359 | Sugar ABC transporter, ATP-binding protein; sugar | 98.35 | |
| 2bbs_A | 290 | Cystic fibrosis transmembrane conductance regulato | 98.35 | |
| 1g29_1 | 372 | MALK, maltose transport protein MALK; ATPase, acti | 98.34 | |
| 3rlf_A | 381 | Maltose/maltodextrin import ATP-binding protein M; | 98.34 | |
| 2it1_A | 362 | 362AA long hypothetical maltose/maltodextrin trans | 98.33 | |
| 1v43_A | 372 | Sugar-binding transport ATP-binding protein; ATPas | 98.33 | |
| 3nh6_A | 306 | ATP-binding cassette SUB-family B member 6, mitoc; | 98.3 | |
| 1htw_A | 158 | HI0065; nucleotide-binding fold, structural genomi | 98.29 | |
| 3gd7_A | 390 | Fusion complex of cystic fibrosis transmembrane co | 98.29 | |
| 2pjz_A | 263 | Hypothetical protein ST1066; ATP binding protein, | 98.28 | |
| 1oxx_K | 353 | GLCV, glucose, ABC transporter, ATP binding protei | 98.27 | |
| 3d31_A | 348 | Sulfate/molybdate ABC transporter, ATP-binding pro | 98.26 | |
| 2ehv_A | 251 | Hypothetical protein PH0186; KAIC, RECA ATPase, un | 98.22 | |
| 2v9p_A | 305 | Replication protein E1; AAA+ molecular motor, DNA | 98.21 | |
| 3lnc_A | 231 | Guanylate kinase, GMP kinase; ALS collaborative cr | 98.12 | |
| 2yl4_A | 595 | ATP-binding cassette SUB-family B member 10, mitoc | 98.09 | |
| 3b60_A | 582 | Lipid A export ATP-binding/permease protein MSBA; | 98.08 | |
| 3b5x_A | 582 | Lipid A export ATP-binding/permease protein MSBA; | 98.08 | |
| 1tf7_A | 525 | KAIC; homohexamer, hexamer, circadian clock protei | 98.06 | |
| 3qf4_B | 598 | Uncharacterized ABC transporter ATP-binding prote | 98.03 | |
| 2iw3_A | 986 | Elongation factor 3A; acetylation, ATP-binding, pr | 98.01 | |
| 1yqt_A | 538 | RNAse L inhibitor; ATP-binding cassette, ribosome | 98.0 | |
| 4a82_A | 578 | Cystic fibrosis transmembrane conductance regulat; | 97.99 | |
| 3qf4_A | 587 | ABC transporter, ATP-binding protein; multidrug tr | 97.97 | |
| 3bk7_A | 607 | ABC transporter ATP-binding protein; ABC ATPase, i | 97.91 | |
| 2qm8_A | 337 | GTPase/ATPase; G protein, G3E, metallochaperone, c | 97.9 | |
| 3ux8_A | 670 | Excinuclease ABC, A subunit; UVRA, nucleotide exci | 97.88 | |
| 2qag_B | 427 | Septin-6, protein NEDD5; cell cycle, cell division | 97.88 | |
| 2gza_A | 361 | Type IV secretion system protein VIRB11; ATPase, h | 97.84 | |
| 2pt7_A | 330 | CAG-ALFA; ATPase, protein-protein complex, type IV | 97.82 | |
| 1tq4_A | 413 | IIGP1, interferon-inducible GTPase; interferon gam | 97.78 | |
| 3bk7_A | 607 | ABC transporter ATP-binding protein; ABC ATPase, i | 97.76 | |
| 2iw3_A | 986 | Elongation factor 3A; acetylation, ATP-binding, pr | 97.76 | |
| 4f4c_A | 1321 | Multidrug resistance protein PGP-1; ABC transporte | 97.75 | |
| 2ewv_A | 372 | Twitching motility protein PILT; pilus retraction | 97.75 | |
| 1svm_A | 377 | Large T antigen; AAA+ fold, viral protein; HET: AT | 97.72 | |
| 1yqt_A | 538 | RNAse L inhibitor; ATP-binding cassette, ribosome | 97.71 | |
| 3ux8_A | 670 | Excinuclease ABC, A subunit; UVRA, nucleotide exci | 97.7 | |
| 3ozx_A | 538 | RNAse L inhibitor; ATP binding cassette protein, h | 97.69 | |
| 3g5u_A | 1284 | MCG1178, multidrug resistance protein 1A; P-glycop | 97.67 | |
| 3euj_A | 483 | Chromosome partition protein MUKB, linker; MUKB, M | 97.67 | |
| 4f4c_A | 1321 | Multidrug resistance protein PGP-1; ABC transporte | 97.67 | |
| 4eun_A | 200 | Thermoresistant glucokinase; putative sugar kinase | 97.67 | |
| 1nlf_A | 279 | Regulatory protein REPA; replicative DNA helicase | 97.66 | |
| 1pzn_A | 349 | RAD51, DNA repair and recombination protein RAD51, | 97.66 | |
| 2x8a_A | 274 | Nuclear valosin-containing protein-like; nuclear p | 97.66 | |
| 1p9r_A | 418 | General secretion pathway protein E; bacterial typ | 97.63 | |
| 3thx_A | 934 | DNA mismatch repair protein MSH2; ABC family ATPas | 97.61 | |
| 4aby_A | 415 | DNA repair protein RECN; hydrolase, double strand | 97.6 | |
| 3g5u_A | 1284 | MCG1178, multidrug resistance protein 1A; P-glycop | 97.6 | |
| 3thx_B | 918 | DNA mismatch repair protein MSH3; ABC family ATPas | 97.59 | |
| 3nwj_A | 250 | ATSK2; P loop, shikimate, nucleoside monophosphate | 97.58 | |
| 3kta_A | 182 | Chromosome segregation protein SMC; structural mai | 97.56 | |
| 3j16_B | 608 | RLI1P; ribosome recycling, translation, eukarya, r | 97.56 | |
| 1sq5_A | 308 | Pantothenate kinase; P-loop, transferase; HET: PAU | 97.56 | |
| 1wb9_A | 800 | DNA mismatch repair protein MUTS; DNA-binding, ATP | 97.56 | |
| 1ixz_A | 254 | ATP-dependent metalloprotease FTSH; AAA domain fol | 97.55 | |
| 3jvv_A | 356 | Twitching mobility protein; hexameric P-loop ATPas | 97.55 | |
| 2kjq_A | 149 | DNAA-related protein; solution structure, NESG, st | 97.53 | |
| 2npi_A | 460 | Protein CLP1; CLP1-PCF11 complex, ATP binding, ter | 97.5 | |
| 3aez_A | 312 | Pantothenate kinase; transferase, homodimer, COA b | 97.5 | |
| 1iy2_A | 278 | ATP-dependent metalloprotease FTSH; AAA domain fol | 97.49 | |
| 2obl_A | 347 | ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O | 97.47 | |
| 3ec2_A | 180 | DNA replication protein DNAC; helicase loader, rep | 97.47 | |
| 3b9q_A | 302 | Chloroplast SRP receptor homolog, alpha subunit CP | 97.44 | |
| 3j16_B | 608 | RLI1P; ribosome recycling, translation, eukarya, r | 97.44 | |
| 2dpy_A | 438 | FLII, flagellum-specific ATP synthase; beta barrel | 97.43 | |
| 2bbw_A | 246 | Adenylate kinase 4, AK4; nucleotide kinase, nucleo | 97.43 | |
| 2oap_1 | 511 | GSPE-2, type II secretion system protein; hexameri | 97.42 | |
| 2r6a_A | 454 | DNAB helicase, replicative helicase; replication, | 97.37 | |
| 1lw7_A | 365 | Transcriptional regulator NADR; NMN, NMN adenylyl | 97.36 | |
| 1in4_A | 334 | RUVB, holliday junction DNA helicase RUVB; AAA+-cl | 97.35 | |
| 1ewq_A | 765 | DNA mismatch repair protein MUTS; multiple domains | 97.35 | |
| 1tf7_A | 525 | KAIC; homohexamer, hexamer, circadian clock protei | 97.33 | |
| 1pui_A | 210 | ENGB, probable GTP-binding protein ENGB; structura | 97.33 | |
| 2o8b_B | 1022 | DNA mismatch repair protein MSH6; DNA damage respo | 97.31 | |
| 3lda_A | 400 | DNA repair protein RAD51; DNA binding protein, ATP | 97.3 | |
| 2yhs_A | 503 | FTSY, cell division protein FTSY; cell cycle, prot | 97.29 | |
| 2o5v_A | 359 | DNA replication and repair protein RECF; ABC ATPas | 97.21 | |
| 4e22_A | 252 | Cytidylate kinase; P-loop, CMP/ATP binding, transf | 97.2 | |
| 3bh0_A | 315 | DNAB-like replicative helicase; ATPase, replicatio | 97.19 | |
| 2og2_A | 359 | Putative signal recognition particle receptor; nuc | 97.17 | |
| 2ygr_A | 993 | Uvrabc system protein A; hydrolase, nucleotide exc | 97.17 | |
| 3pih_A | 916 | Uvrabc system protein A; hydrolase, ABC ATPase, DN | 97.16 | |
| 2vf7_A | 842 | UVRA2, excinuclease ABC, subunit A.; DNA-binding p | 97.13 | |
| 2r6f_A | 972 | Excinuclease ABC subunit A; UVRA, nucleotide excis | 97.12 | |
| 3hr8_A | 356 | Protein RECA; alpha and beta proteins (A/B, A+B), | 97.07 | |
| 1rj9_A | 304 | FTSY, signal recognition protein; SRP-GTPase domai | 97.0 | |
| 2rcn_A | 358 | Probable GTPase ENGC; YJEQ, circularly permuted, G | 96.99 | |
| 3e70_C | 328 | DPA, signal recognition particle receptor; FTSY, S | 96.99 | |
| 1u0l_A | 301 | Probable GTPase ENGC; permutation, OB-fold, zinc-f | 96.98 | |
| 4a1f_A | 338 | DNAB helicase, replicative DNA helicase; hydrolase | 96.97 | |
| 2p5t_B | 253 | PEZT; postsegregational killing system, phosphoryl | 96.97 | |
| 1udx_A | 416 | The GTP-binding protein OBG; TGS domain, riken str | 96.96 | |
| 2yv5_A | 302 | YJEQ protein; hydrolase, GTPase, permutation, stru | 96.96 | |
| 1sxj_C | 340 | Activator 1 40 kDa subunit; clamp loader, processi | 96.95 | |
| 1t9h_A | 307 | YLOQ, probable GTPase ENGC; N-terminal beta-barrel | 96.93 | |
| 2p67_A | 341 | LAO/AO transport system kinase; ARGK, structural G | 96.91 | |
| 2qag_C | 418 | Septin-7; cell cycle, cell division, GTP-binding, | 96.91 | |
| 1f2t_A | 149 | RAD50 ABC-ATPase; DNA double-strand break repair, | 96.9 | |
| 2zr9_A | 349 | Protein RECA, recombinase A; recombination, RECA m | 96.87 | |
| 2q6t_A | 444 | DNAB replication FORK helicase; hydrolase; 2.90A { | 96.8 | |
| 2www_A | 349 | Methylmalonic aciduria type A protein, mitochondri | 96.79 | |
| 1lv7_A | 257 | FTSH; alpha/beta domain, four helix bundle, hydrol | 96.79 | |
| 3m6a_A | 543 | ATP-dependent protease LA 1; alpha, beta, ATP-bind | 96.79 | |
| 1v5w_A | 343 | DMC1, meiotic recombination protein DMC1/LIM15 hom | 96.77 | |
| 2dhr_A | 499 | FTSH; AAA+ protein, hexameric Zn metalloprotease, | 96.76 | |
| 2zts_A | 251 | Putative uncharacterized protein PH0186; KAIC like | 96.74 | |
| 1zu4_A | 320 | FTSY; GTPase, signal recognition particle, SRP, re | 96.73 | |
| 1w1w_A | 430 | Structural maintenance of chromosome 1; cohesin, c | 96.66 | |
| 3tqc_A | 321 | Pantothenate kinase; biosynthesis of cofactors, pr | 96.65 | |
| 2z43_A | 324 | DNA repair and recombination protein RADA; archaea | 96.64 | |
| 4eaq_A | 229 | DTMP kinase, thymidylate kinase; structural genomi | 96.63 | |
| 2i1q_A | 322 | DNA repair and recombination protein RADA; ATPase, | 96.59 | |
| 1gvn_B | 287 | Zeta; postsegregational killing system, plasmid; 1 | 96.58 | |
| 1oix_A | 191 | RAS-related protein RAB-11A; small G protein, intr | 96.58 | |
| 3k1j_A | 604 | LON protease, ATP-dependent protease LON; ATP-bind | 96.57 | |
| 3cf0_A | 301 | Transitional endoplasmic reticulum ATPase; AAA, P9 | 96.53 | |
| 3b9p_A | 297 | CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc | 96.48 | |
| 3cr8_A | 552 | Sulfate adenylyltranferase, adenylylsulfate kinase | 96.45 | |
| 3umf_A | 217 | Adenylate kinase; rossmann fold, transferase; 2.05 | 96.41 | |
| 3bos_A | 242 | Putative DNA replication factor; P-loop containing | 96.36 | |
| 3bgw_A | 444 | DNAB-like replicative helicase; ATPase, replicatio | 96.35 | |
| 1jbk_A | 195 | CLPB protein; beta barrel, chaperone; 1.80A {Esche | 96.32 | |
| 1vma_A | 306 | Cell division protein FTSY; TM0570, structural gen | 96.22 | |
| 3h4m_A | 285 | Proteasome-activating nucleotidase; ATPase, PAN, A | 96.22 | |
| 4ad8_A | 517 | DNA repair protein RECN; DNA binding protein, ATPa | 96.13 | |
| 2px0_A | 296 | Flagellar biosynthesis protein FLHF; SRP GTPase, f | 96.1 | |
| 1odf_A | 290 | YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser | 96.08 | |
| 2qby_A | 386 | CDC6 homolog 1, cell division control protein 6 ho | 96.06 | |
| 1xwi_A | 322 | SKD1 protein; VPS4B, AAA ATPase, protein transport | 96.04 | |
| 4fcw_A | 311 | Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 | 96.03 | |
| 1njg_A | 250 | DNA polymerase III subunit gamma; rossman-like fol | 96.01 | |
| 2qz4_A | 262 | Paraplegin; AAA+, SPG7, protease, ADP, structural | 96.01 | |
| 1qhl_A | 227 | Protein (cell division protein MUKB); SMC, chromos | 96.0 | |
| 3tlx_A | 243 | Adenylate kinase 2; structural genomics, structura | 95.99 | |
| 2ged_A | 193 | SR-beta, signal recognition particle receptor beta | 95.98 | |
| 1u94_A | 356 | RECA protein, recombinase A; homologous recombinat | 95.97 | |
| 3t15_A | 293 | Ribulose bisphosphate carboxylase/oxygenase activ | 95.91 | |
| 1sxj_E | 354 | Activator 1 40 kDa subunit; clamp loader, processi | 95.9 | |
| 2vhj_A | 331 | Ntpase P4, P4; non- hydrolysable ATP analogue, hyd | 95.9 | |
| 3lxx_A | 239 | GTPase IMAP family member 4; structural genomics c | 95.85 | |
| 1fnn_A | 389 | CDC6P, cell division control protein 6; ORC1, AAA | 95.78 | |
| 2p65_A | 187 | Hypothetical protein PF08_0063; CLPB, malaria, str | 95.78 | |
| 2ce7_A | 476 | Cell division protein FTSH; metalloprotease; HET: | 95.78 | |
| 2w58_A | 202 | DNAI, primosome component (helicase loader); ATP-b | 95.75 | |
| 1q57_A | 503 | DNA primase/helicase; dntpase, DNA replication, tr | 95.74 | |
| 2qag_A | 361 | Septin-2, protein NEDD5; cell cycle, cell division | 95.72 | |
| 4ag6_A | 392 | VIRB4 ATPase, type IV secretory pathway VIRB4 comp | 95.68 | |
| 1ypw_A | 806 | Transitional endoplasmic reticulum ATPase; AAA, P9 | 95.66 | |
| 1xp8_A | 366 | RECA protein, recombinase A; recombination, radior | 95.57 | |
| 1ls1_A | 295 | Signal recognition particle protein; FFH, SRP54, S | 95.51 | |
| 1l8q_A | 324 | Chromosomal replication initiator protein DNAA; AA | 95.5 | |
| 3uk6_A | 368 | RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding | 95.48 | |
| 3syl_A | 309 | Protein CBBX; photosynthesis, rubisco activase, AA | 95.47 | |
| 2v1u_A | 387 | Cell division control protein 6 homolog; DNA repli | 95.43 | |
| 2atv_A | 196 | RERG, RAS-like estrogen-regulated growth inhibitor | 95.41 | |
| 3t34_A | 360 | Dynamin-related protein 1A, linker, dynamin-relat | 95.4 | |
| 2p5s_A | 199 | RAS and EF-hand domain containing; G-protein, RAB, | 95.33 | |
| 3zvl_A | 416 | Bifunctional polynucleotide phosphatase/kinase; hy | 95.32 | |
| 3eie_A | 322 | Vacuolar protein sorting-associated protein 4; AAA | 95.31 | |
| 2chg_A | 226 | Replication factor C small subunit; DNA-binding pr | 95.24 | |
| 2il1_A | 192 | RAB12; G-protein, GDP, GTPase, predicted, structur | 95.19 | |
| 3szr_A | 608 | Interferon-induced GTP-binding protein MX1; interf | 95.15 | |
| 3llm_A | 235 | ATP-dependent RNA helicase A; alpha-beta-alpha, st | 95.09 | |
| 2wsm_A | 221 | Hydrogenase expression/formation protein (HYPB); m | 95.09 | |
| 2zan_A | 444 | Vacuolar protein sorting-associating protein 4B; S | 95.09 | |
| 2b6h_A | 192 | ADP-ribosylation factor 5; membrane trafficking, G | 95.06 | |
| 1d2n_A | 272 | N-ethylmaleimide-sensitive fusion protein; hexamer | 95.04 | |
| 2qp9_X | 355 | Vacuolar protein sorting-associated protein 4; ATP | 95.04 | |
| 2r62_A | 268 | Cell division protease FTSH homolog; ATPase domain | 95.03 | |
| 1gwn_A | 205 | RHO-related GTP-binding protein RHOE; GTPase, inac | 95.03 | |
| 2qby_B | 384 | CDC6 homolog 3, cell division control protein 6 ho | 95.02 | |
| 1mky_A | 439 | Probable GTP-binding protein ENGA; GTPase, DER, KH | 95.01 | |
| 3n70_A | 145 | Transport activator; sigma-54, ntpase, PSI, MCSG, | 94.98 | |
| 1zcb_A | 362 | G alpha I/13; GTP-binding, lipoprotein, membrane, | 94.97 | |
| 2j1l_A | 214 | RHO-related GTP-binding protein RHOD; GTPase, memb | 94.97 | |
| 2ew1_A | 201 | RAS-related protein RAB-30; G-protein, GTP analogu | 94.94 | |
| 2aka_B | 299 | Dynamin-1; fusion protein, GTPase domain, myosin, | 94.94 | |
| 1j8m_F | 297 | SRP54, signal recognition 54 kDa protein; signalin | 94.94 | |
| 2qu8_A | 228 | Putative nucleolar GTP-binding protein 1; GTPase, | 94.93 | |
| 1ofh_A | 310 | ATP-dependent HSL protease ATP-binding subunit HSL | 94.91 | |
| 3d8b_A | 357 | Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s | 94.87 | |
| 2ius_A | 512 | DNA translocase FTSK; nucleotide-binding, chromoso | 94.85 | |
| 2qtf_A | 364 | Protein HFLX, GTP-binding protein; beta-alpha-barr | 94.84 | |
| 2hup_A | 201 | RAS-related protein RAB-43; G-protein, GDP, struct | 94.83 | |
| 1sxj_D | 353 | Activator 1 41 kDa subunit; clamp loader, processi | 94.77 | |
| 4gzl_A | 204 | RAS-related C3 botulinum toxin substrate 1; rossma | 94.72 | |
| 2e87_A | 357 | Hypothetical protein PH1320; GTP-binding, GTPase, | 94.63 | |
| 1h65_A | 270 | Chloroplast outer envelope protein OEP34; GTPase, | 94.58 | |
| 2qmh_A | 205 | HPR kinase/phosphorylase; V267F mutation, ATP-bind | 94.55 | |
| 3ice_A | 422 | Transcription termination factor RHO; transcriptio | 94.52 | |
| 3kl4_A | 433 | SRP54, signal recognition 54 kDa protein; signal r | 94.49 | |
| 4b4t_K | 428 | 26S protease regulatory subunit 6B homolog; hydrol | 94.48 | |
| 4dhe_A | 223 | Probable GTP-binding protein ENGB; melioidosis, RA | 94.46 | |
| 1ypw_A | 806 | Transitional endoplasmic reticulum ATPase; AAA, P9 | 94.45 | |
| 3hws_A | 363 | ATP-dependent CLP protease ATP-binding subunit CL; | 94.34 | |
| 2hf9_A | 226 | Probable hydrogenase nickel incorporation protein | 94.31 | |
| 3q3j_B | 214 | RHO-related GTP-binding protein RHO6; RAS-binding | 94.3 | |
| 2f6r_A | 281 | COA synthase, bifunctional coenzyme A synthase; 18 | 94.3 | |
| 1hqc_A | 324 | RUVB; extended AAA-ATPase domain, complex with nuc | 94.29 | |
| 2z4s_A | 440 | Chromosomal replication initiator protein DNAA; AA | 94.23 | |
| 2qgz_A | 308 | Helicase loader, putative primosome component; str | 94.22 | |
| 3vkw_A | 446 | Replicase large subunit; alpha/beta domain, helica | 94.1 | |
| 3th5_A | 204 | RAS-related C3 botulinum toxin substrate 1; rossma | 93.1 | |
| 1g8p_A | 350 | Magnesium-chelatase 38 kDa subunit; parallel beta | 94.04 | |
| 2qen_A | 350 | Walker-type ATPase; unknown function; HET: ADP; 2. | 94.04 | |
| 1um8_A | 376 | ATP-dependent CLP protease ATP-binding subunit CL; | 94.02 | |
| 4b4t_L | 437 | 26S protease subunit RPT4; hydrolase, AAA-atpases, | 93.99 | |
| 3l0i_B | 199 | RAS-related protein RAB-1A; GEF-GDF-RAB complex, G | 93.98 | |
| 3def_A | 262 | T7I23.11 protein; chloroplast, TOC33, GTPase, hydr | 93.95 | |
| 4b4t_M | 434 | 26S protease regulatory subunit 6A; hydrolase, AAA | 93.92 | |
| 3pfi_A | 338 | Holliday junction ATP-dependent DNA helicase RUVB; | 93.88 | |
| 2g3y_A | 211 | GTP-binding protein GEM; small GTPase, GDP, inacti | 93.77 | |
| 3pvs_A | 447 | Replication-associated recombination protein A; ma | 93.72 | |
| 3cmw_A | 1706 | Protein RECA, recombinase A; homologous recombinat | 93.72 | |
| 2bjv_A | 265 | PSP operon transcriptional activator; AAA, transcr | 93.71 | |
| 2r44_A | 331 | Uncharacterized protein; putative ATPase, structur | 93.66 | |
| 3io5_A | 333 | Recombination and repair protein; storage dimer, i | 93.65 | |
| 2ffh_A | 425 | Protein (FFH); SRP54, signal recognition particle, | 93.61 | |
| 3vfd_A | 389 | Spastin; ATPase, microtubule severing, hydrolase; | 93.58 | |
| 4b4t_J | 405 | 26S protease regulatory subunit 8 homolog; hydrola | 93.58 | |
| 1jr3_A | 373 | DNA polymerase III subunit gamma; processivity, pr | 93.57 | |
| 3cnl_A | 262 | YLQF, putative uncharacterized protein; circular p | 93.56 | |
| 3upu_A | 459 | ATP-dependent DNA helicase DDA; RECA-like domain, | 93.54 | |
| 2c9o_A | 456 | RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP- | 93.44 | |
| 3p32_A | 355 | Probable GTPase RV1496/MT1543; structural genomics | 93.39 | |
| 3co5_A | 143 | Putative two-component system transcriptional RES | 93.38 | |
| 1w5s_A | 412 | Origin recognition complex subunit 2 ORC2; replica | 93.36 | |
| 3lv8_A | 236 | DTMP kinase, thymidylate kinase; structural genomi | 93.31 | |
| 1puj_A | 282 | YLQF, conserved hypothetical protein YLQF; structu | 93.28 | |
| 1sxj_A | 516 | Activator 1 95 kDa subunit; clamp loader, processi | 93.26 | |
| 2fna_A | 357 | Conserved hypothetical protein; structural genomic | 93.15 | |
| 1bif_A | 469 | 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; | 93.09 | |
| 1iqp_A | 327 | RFCS; clamp loader, extended AAA-ATPase domain, co | 93.0 | |
| 1e9r_A | 437 | Conjugal transfer protein TRWB; coupling protein, | 92.95 | |
| 3a8t_A | 339 | Adenylate isopentenyltransferase; rossmann fold pr | 92.93 | |
| 1tue_A | 212 | Replication protein E1; helicase, replication, E1E | 92.89 | |
| 4b4t_H | 467 | 26S protease regulatory subunit 7 homolog; hydrola | 92.88 | |
| 2qpt_A | 550 | EH domain-containing protein-2; protein-nucleotide | 92.74 | |
| 3cmu_A | 2050 | Protein RECA, recombinase A; homologous recombinat | 92.73 | |
| 2x2e_A | 353 | Dynamin-1; nitration, hydrolase, membrane fission, | 92.57 | |
| 3cmw_A | 1706 | Protein RECA, recombinase A; homologous recombinat | 92.56 | |
| 3cmu_A | 2050 | Protein RECA, recombinase A; homologous recombinat | 92.55 | |
| 3hu3_A | 489 | Transitional endoplasmic reticulum ATPase; VCP, tr | 92.45 | |
| 3e1s_A | 574 | Exodeoxyribonuclease V, subunit RECD; alpha and be | 92.44 | |
| 3geh_A | 462 | MNME, tRNA modification GTPase MNME; G protein, U3 | 92.44 | |
| 3ec1_A | 369 | YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase | 92.43 | |
| 2wkq_A | 332 | NPH1-1, RAS-related C3 botulinum toxin substrate 1 | 92.38 | |
| 2chq_A | 319 | Replication factor C small subunit; DNA-binding pr | 92.35 | |
| 1g41_A | 444 | Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dep | 92.28 | |
| 3h2y_A | 368 | GTPase family protein; GTP-binding protein YQEH, p | 92.22 | |
| 3cf2_A | 806 | TER ATPase, transitional endoplasmic reticulum ATP | 92.17 | |
| 4b4t_I | 437 | 26S protease regulatory subunit 4 homolog; hydrola | 92.14 | |
| 2vf7_A | 842 | UVRA2, excinuclease ABC, subunit A.; DNA-binding p | 91.97 | |
| 1sxj_B | 323 | Activator 1 37 kDa subunit; clamp loader, processi | 91.97 | |
| 3pxg_A | 468 | Negative regulator of genetic competence CLPC/MEC; | 91.93 | |
| 2v3c_C | 432 | SRP54, signal recognition 54 kDa protein; nucleoti | 91.83 | |
| 1lnz_A | 342 | SPO0B-associated GTP-binding protein; GTPase, OBG, | 91.73 | |
| 3u61_B | 324 | DNA polymerase accessory protein 44; AAA+, ATP hyd | 91.67 | |
| 2iut_A | 574 | DNA translocase FTSK; nucleotide-binding, chromoso | 91.66 | |
| 3o47_A | 329 | ADP-ribosylation factor GTPase-activating protein | 91.66 | |
| 3nbx_X | 500 | ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structu | 91.62 | |
| 1f5n_A | 592 | Interferon-induced guanylate-binding protein 1; GB | 91.5 | |
| 3dm5_A | 443 | SRP54, signal recognition 54 kDa protein; protein- | 91.5 | |
| 1cip_A | 353 | Protein (guanine nucleotide-binding protein alpha- | 91.48 | |
| 2axn_A | 520 | 6-phosphofructo-2-kinase/fructose-2,6- biphosphata | 91.45 | |
| 2j69_A | 695 | Bacterial dynamin-like protein; FZO, FZL, GTPase, | 91.36 | |
| 4b3f_X | 646 | DNA-binding protein smubp-2; hydrolase, helicase; | 91.33 | |
| 3gee_A | 476 | MNME, tRNA modification GTPase MNME; G protein, cy | 91.22 | |
| 3te6_A | 318 | Regulatory protein SIR3; heterochromatin, gene sil | 91.11 | |
| 3dpu_A | 535 | RAB family protein; roccor, G-domain, COR, GTP-bin | 91.0 | |
| 2gk6_A | 624 | Regulator of nonsense transcripts 1; UPF1, helicas | 90.89 | |
| 2hjg_A | 436 | GTP-binding protein ENGA; GTPase ENGA KH-domain, h | 90.85 | |
| 3lvq_E | 497 | ARF-GAP with SH3 domain, ANK repeat and PH domain | 90.71 | |
| 2j37_W | 504 | Signal recognition particle 54 kDa protein (SRP54) | 90.71 | |
| 1x6v_B | 630 | Bifunctional 3'-phosphoadenosine 5'- phosphosulfat | 90.34 | |
| 1xzp_A | 482 | Probable tRNA modification GTPase TRME; GTP-bindin | 90.34 | |
| 2ygr_A | 993 | Uvrabc system protein A; hydrolase, nucleotide exc | 90.29 | |
| 4a9a_A | 376 | Ribosome-interacting GTPase 1; DRG-DFRP complex, r | 90.24 | |
| 2r6f_A | 972 | Excinuclease ABC subunit A; UVRA, nucleotide excis | 90.18 | |
| 1ko7_A | 314 | HPR kinase/phosphatase; protein kinase, phosphotra | 89.84 | |
| 1u0j_A | 267 | DNA replication protein; AAA+ protein, P-loop atpa | 89.83 | |
| 1r6b_X | 758 | CLPA protein; AAA+, N-terminal domain, CLPS, cryst | 89.55 | |
| 1m8p_A | 573 | Sulfate adenylyltransferase; rossmann fold, phosph | 89.5 | |
| 1w36_D | 608 | RECD, exodeoxyribonuclease V alpha chain; recombin | 89.49 | |
| 1qvr_A | 854 | CLPB protein; coiled coil, AAA ATPase, chaperone; | 89.37 | |
| 2xau_A | 773 | PRE-mRNA-splicing factor ATP-dependent RNA helica; | 88.98 | |
| 2xzl_A | 802 | ATP-dependent helicase NAM7; hydrolase-RNA complex | 88.97 | |
| 3pxi_A | 758 | Negative regulator of genetic competence CLPC/MEC; | 88.93 | |
| 3q5d_A | 447 | Atlastin-1; G protein, GTPase, GDP/GTP binding, hy | 88.91 | |
| 1z6t_A | 591 | APAF-1, apoptotic protease activating factor 1; ca | 88.91 | |
| 2gks_A | 546 | Bifunctional SAT/APS kinase; transferase, sulfuryl | 88.9 | |
| 2wjy_A | 800 | Regulator of nonsense transcripts 1; nonsense medi | 88.51 | |
| 1r6b_X | 758 | CLPA protein; AAA+, N-terminal domain, CLPS, cryst | 88.4 | |
| 3f9v_A | 595 | Minichromosome maintenance protein MCM; replicativ | 88.38 | |
| 1azs_C | 402 | GS-alpha; complex (lyase/hydrolase), hydrolase, si | 88.13 | |
| 1qvr_A | 854 | CLPB protein; coiled coil, AAA ATPase, chaperone; | 87.28 | |
| 1sky_E | 473 | F1-ATPase, F1-ATP synthase; F1FO ATP synthase, alp | 87.15 | |
| 3pxi_A | 758 | Negative regulator of genetic competence CLPC/MEC; | 86.78 | |
| 2j9r_A | 214 | Thymidine kinase; TK1, DNK, lasso, transferase, AT | 86.7 | |
| 3e2i_A | 219 | Thymidine kinase; Zn-binding, ATP-binding, DNA syn | 86.44 | |
| 4akg_A | 2695 | Glutathione S-transferase class-MU 26 kDa isozyme | 85.93 | |
| 1g8f_A | 511 | Sulfate adenylyltransferase; alpha-beta protein, b | 85.24 | |
| 4dcu_A | 456 | GTP-binding protein ENGA; GTPase, GDP, protein bin | 84.78 | |
| 3izq_1 | 611 | HBS1P, elongation factor 1 alpha-like protein; NO- | 84.67 | |
| 1knx_A | 312 | Probable HPR(Ser) kinase/phosphatase; HPR kinase, | 84.16 | |
| 3cf2_A | 806 | TER ATPase, transitional endoplasmic reticulum ATP | 83.77 | |
| 3p26_A | 483 | Elongation factor 1 alpha-like protein; GTP/GDP bi | 83.48 | |
| 2xxa_A | 433 | Signal recognition particle protein; protein trans | 81.68 | |
| 3vkg_A | 3245 | Dynein heavy chain, cytoplasmic; AAA+ protein, mol | 81.0 |
| >3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* | Back alignment and structure |
|---|
Probab=98.68 E-value=1.8e-08 Score=86.74 Aligned_cols=36 Identities=14% Similarity=-0.020 Sum_probs=33.7
Q ss_pred ccccccceeEEeCCeEEEEecCCCCCchhHHHHHHH
Q 037424 184 INILNRVSGILKPGSVNLADCLTFLHPLDVFQVLFL 219 (231)
Q Consensus 184 ~~IL~dVSGiiKPGeMTLVLGrPGSGcSTlLK~L~~ 219 (231)
..||+|||-.|+||+++.|+||.|||||||||+|.-
T Consensus 18 ~~~L~~isl~i~~Ge~~~iiG~nGsGKSTLl~~l~G 53 (235)
T 3tif_A 18 IYALKNVNLNIKEGEFVSIMGPSGSGKSTMLNIIGC 53 (235)
T ss_dssp EEEEEEEEEEECTTCEEEEECSTTSSHHHHHHHHTT
T ss_pred eeeEEeeeEEEcCCCEEEEECCCCCcHHHHHHHHhc
Confidence 569999999999999999999999999999999863
|
| >4g1u_C Hemin import ATP-binding protein HMUV; membrane transporter, type II ABC importer, HMUT, plasma MEM transport protein-hydrolase complex; 3.01A {Yersinia pestis} | Back alignment and structure |
|---|
| >2zu0_C Probable ATP-dependent transporter SUFC; iron-sulfur cluster, ABC-ATPase, ATP-binding, cytoplasm, nucleotide-binding; HET: MES; 2.20A {Escherichia coli} PDB: 2d3w_A | Back alignment and structure |
|---|
| >2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A | Back alignment and structure |
|---|
| >1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} | Back alignment and structure |
|---|
| >2d2e_A SUFC protein; ABC-ATPase, SUF protein, 310-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics, binding; 1.70A {Thermus thermophilus} PDB: 2d2f_A* | Back alignment and structure |
|---|
| >2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* | Back alignment and structure |
|---|
| >2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A | Back alignment and structure |
|---|
| >1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A* | Back alignment and structure |
|---|
| >1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >3tui_C Methionine import ATP-binding protein METN; ABC-transporter, type I ABC type importer, methionine uptake transporter, membrane protein; HET: ADP; 2.90A {Escherichia coli} PDB: 3tuj_C 3tuz_C* 3dhw_C | Back alignment and structure |
|---|
| >1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J* | Back alignment and structure |
|---|
| >1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* | Back alignment and structure |
|---|
| >3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} | Back alignment and structure |
|---|
| >2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} | Back alignment and structure |
|---|
| >2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} | Back alignment and structure |
|---|
| >2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima} | Back alignment and structure |
|---|
| >2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C | Back alignment and structure |
|---|
| >1z47_A CYSA, putative ABC-transporter ATP-binding protein; alpha/beta motif, beta sandwich, ligand binding protein; 1.90A {Alicyclobacillus acidocaldarius} | Back alignment and structure |
|---|
| >3fvq_A Fe(3+) IONS import ATP-binding protein FBPC; nucleotide binding domain, ABC motor domain, ferric iron TRA ATP-binding, cell inner membrane; HET: ATP; 1.90A {Neisseria gonorrhoeae} | Back alignment and structure |
|---|
| >1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A* | Back alignment and structure |
|---|
| >2yyz_A Sugar ABC transporter, ATP-binding protein; sugar transport, alpha and beta proteins (A/B) TM0421, structural genomics, NPPSFA; 2.11A {Thermotoga maritima} | Back alignment and structure |
|---|
| >2bbs_A Cystic fibrosis transmembrane conductance regulator; ATP binding cassette, transport protein; HET: ATP; 2.05A {Homo sapiens} PDB: 2bbt_A* 1xmi_A* 1xmj_A* 2bbo_A* 3si7_A* 1r0w_A 1q3h_A 1r0x_A* 1r0y_A* 1r0z_A* 1r10_A* 1xf9_A* 1xfa_A* | Back alignment and structure |
|---|
| >1g29_1 MALK, maltose transport protein MALK; ATPase, active transport, maltose uptake and regulation, sugar binding protein; 1.90A {Thermococcus litoralis} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 2d62_A | Back alignment and structure |
|---|
| >3rlf_A Maltose/maltodextrin import ATP-binding protein M; integral membrane protein, ATPase, ABC transporter, membrane transmembrane; HET: UMQ MAL PGV ANP; 2.20A {Escherichia coli} PDB: 1q1e_A 1q12_A* 2awo_A* 3fh6_A 3puv_A* 3puw_A* 3pux_A* 3puy_A* 3puz_A* 3pv0_A* 2awn_A* 2r6g_A* 1q1b_A | Back alignment and structure |
|---|
| >2it1_A 362AA long hypothetical maltose/maltodextrin transport ATP-binding protein; structural genomics, NPPSFA; 1.94A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >1v43_A Sugar-binding transport ATP-binding protein; ATPase, active transport, sugar uptake and regulation, transport protein; 2.20A {Pyrococcus horikoshii} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 1vci_A* | Back alignment and structure |
|---|
| >3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A* | Back alignment and structure |
|---|
| >1htw_A HI0065; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; HET: ADP; 1.70A {Haemophilus influenzae} SCOP: c.37.1.18 PDB: 1fl9_A | Back alignment and structure |
|---|
| >3gd7_A Fusion complex of cystic fibrosis transmembrane conductance regulator, residues 1193-1427...; CFTR, ABC transporter, nucleotide binding domain, NBD; HET: B44; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >2pjz_A Hypothetical protein ST1066; ATP binding protein, structural genomics, NPPSFA; 1.90A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >1oxx_K GLCV, glucose, ABC transporter, ATP binding protein; ABC-ATPase, ATP-binding cassette, ATPase, transport protein; 1.45A {Sulfolobus solfataricus} SCOP: b.40.6.3 c.37.1.12 PDB: 1oxs_C 1oxt_A 1oxu_A* 1oxv_A* | Back alignment and structure |
|---|
| >3d31_A Sulfate/molybdate ABC transporter, ATP-binding protein; ATP-binding, nucleotide-binding, membrane, transmembrane, transport protein; 3.00A {Methanosarcina acetivorans} SCOP: b.40.6.3 c.37.1.12 | Back alignment and structure |
|---|
| >2v9p_A Replication protein E1; AAA+ molecular motor, DNA replication, DNA translocation, nucleotide-binding, DNA-binding; 3.00A {Bovine papillomavirus type 1} PDB: 2gxa_A* | Back alignment and structure |
|---|
| >3lnc_A Guanylate kinase, GMP kinase; ALS collaborative crystallography, emerald biostructures, ATP-binding, cytoplasm, nucleotide-binding; HET: 5GP; 1.95A {Anaplasma phagocytophilum} | Back alignment and structure |
|---|
| >3b60_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; HET: ANP; 3.70A {Salmonella typhimurium} SCOP: c.37.1.12 f.37.1.1 PDB: 3b5y_A* 3b5z_A* 3b5w_A | Back alignment and structure |
|---|
| >3b5x_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; 5.50A {Vibrio cholerae} | Back alignment and structure |
|---|
| >1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* | Back alignment and structure |
|---|
| >3qf4_B Uncharacterized ABC transporter ATP-binding prote TM_0288; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} | Back alignment and structure |
|---|
| >2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A | Back alignment and structure |
|---|
| >1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >4a82_A Cystic fibrosis transmembrane conductance regulat; CFTR, ION channel, transport protein, casse protein; 2.00A {Homo sapiens} PDB: 2onj_A* 2hyd_A | Back alignment and structure |
|---|
| >3qf4_A ABC transporter, ATP-binding protein; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} | Back alignment and structure |
|---|
| >3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* | Back alignment and structure |
|---|
| >2qm8_A GTPase/ATPase; G protein, G3E, metallochaperone, chaperone; HET: MSE; 1.70A {Methylobacterium extorquens} SCOP: c.37.1.10 PDB: 2qm7_A* | Back alignment and structure |
|---|
| >3ux8_A Excinuclease ABC, A subunit; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, DN binding protein; HET: ADP; 2.10A {Geobacillus} | Back alignment and structure |
|---|
| >2qag_B Septin-6, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2gza_A Type IV secretion system protein VIRB11; ATPase, hydrolase; 2.60A {Brucella suis} | Back alignment and structure |
|---|
| >2pt7_A CAG-ALFA; ATPase, protein-protein complex, type IV secretion, hydrolas binding complex; 2.40A {Helicobacter pylori} SCOP: c.37.1.11 PDB: 1nly_A* 1nlz_A 1opx_A* 1g6o_A | Back alignment and structure |
|---|
| >1tq4_A IIGP1, interferon-inducible GTPase; interferon gamma, dimer, immunology, signaling protein; HET: GDP; 1.95A {Mus musculus} SCOP: c.37.1.8 PDB: 1tqd_A* 1tq6_A* 1tpz_A* 1tq2_A* | Back alignment and structure |
|---|
| >3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* | Back alignment and structure |
|---|
| >2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A | Back alignment and structure |
|---|
| >4f4c_A Multidrug resistance protein PGP-1; ABC transporter, ATPase, multi-drug transporter, exporter, A binding, hydrolase,protein transport; HET: NDG NAG BMA MAN 0SA; 3.40A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A* | Back alignment and structure |
|---|
| >1svm_A Large T antigen; AAA+ fold, viral protein; HET: ATP; 1.94A {Simian virus 40} SCOP: c.37.1.20 PDB: 1svl_A* 1svo_A 1n25_A 2h1l_A | Back alignment and structure |
|---|
| >1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >3ux8_A Excinuclease ABC, A subunit; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, DN binding protein; HET: ADP; 2.10A {Geobacillus} | Back alignment and structure |
|---|
| >3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* | Back alignment and structure |
|---|
| >3euj_A Chromosome partition protein MUKB, linker; MUKB, MUKE, chromosome condensation, condensin, SMC, N subunit, ABC-type ATPase, WHD, ATP-binding; HET: AGS; 3.10A {Haemophilus ducreyi} PDB: 3euk_A* | Back alignment and structure |
|---|
| >4f4c_A Multidrug resistance protein PGP-1; ABC transporter, ATPase, multi-drug transporter, exporter, A binding, hydrolase,protein transport; HET: NDG NAG BMA MAN 0SA; 3.40A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} | Back alignment and structure |
|---|
| >1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A | Back alignment and structure |
|---|
| >1pzn_A RAD51, DNA repair and recombination protein RAD51, RADA; heptameric ring, heptamer, ring, oligomer, RAD51 polymerizat motif; HET: DNA; 2.85A {Pyrococcus furiosus} SCOP: a.60.4.1 c.37.1.11 | Back alignment and structure |
|---|
| >2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >1p9r_A General secretion pathway protein E; bacterial type II secretion system cytoplasmic protein - GSPE, putative ATPase/ ATP binding protein; 2.50A {Vibrio cholerae} SCOP: c.37.1.11 PDB: 1p9w_A* | Back alignment and structure |
|---|
| >3thx_A DNA mismatch repair protein MSH2; ABC family ATPase, mismatch recognition, mismatched unpaired DNA binding protein-DNA complex; HET: DNA ADP; 2.70A {Homo sapiens} PDB: 2o8c_A* 2o8d_A* 2o8f_A* 3thw_A* 2o8b_A* 3thy_A* 3thz_A* 2o8e_A* | Back alignment and structure |
|---|
| >4aby_A DNA repair protein RECN; hydrolase, double strand break repair, ATPase, nucleotide binding domain; HET: DNA; 3.00A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* | Back alignment and structure |
|---|
| >3thx_B DNA mismatch repair protein MSH3; ABC family ATPase, mismatch recognition, mismatched unpaired DNA binding protein-DNA complex; HET: DNA ADP; 2.70A {Homo sapiens} PDB: 3thw_B* 3thy_B* 3thz_B* | Back alignment and structure |
|---|
| >3nwj_A ATSK2; P loop, shikimate, nucleoside monophosphate kinase, shikimat ATP binding, chloroplast, transferase; 2.35A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3kta_A Chromosome segregation protein SMC; structural maintenance of chromosomes, ABC ATPase, CFTR adenylate kinase, AP5A, transferase; HET: AP5; 1.63A {Pyrococcus furiosus} PDB: 1xex_A* 1xew_X* | Back alignment and structure |
|---|
| >3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1sq5_A Pantothenate kinase; P-loop, transferase; HET: PAU ADP; 2.20A {Escherichia coli} SCOP: c.37.1.6 PDB: 1esm_A* 1esn_A* | Back alignment and structure |
|---|
| >1wb9_A DNA mismatch repair protein MUTS; DNA-binding, ATP-binding, DNA binding, DNA repair, mismatch recognition; HET: DNA ADP; 2.10A {Escherichia coli} SCOP: a.113.1.1 c.37.1.12 c.55.6.1 d.75.2.1 PDB: 1wbb_A* 1e3m_A* 1oh5_A* 1oh6_A* 1oh7_A* 1oh8_A* 1w7a_A* 2wtu_A* 1wbd_A* 1ng9_A* 3k0s_A* | Back alignment and structure |
|---|
| >1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* | Back alignment and structure |
|---|
| >3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* | Back alignment and structure |
|---|
| >2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} | Back alignment and structure |
|---|
| >2npi_A Protein CLP1; CLP1-PCF11 complex, ATP binding, ternary complex, transcript; HET: ATP; 2.95A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3aez_A Pantothenate kinase; transferase, homodimer, COA biosynthesis, nucleotide binding binding, cytoplasm, nucleotide-binding; HET: GDP PAZ; 2.20A {Mycobacterium tuberculosis} PDB: 2ges_A* 2geu_A* 2gev_A* 2zs7_A* 2zs8_A* 2zs9_A* 2zsa_A* 2zsb_A* 2zsd_A* 2zse_A* 2zsf_A* 2get_A* 3af0_A* 3af1_A* 3af2_A* 3af3_A* 3af4_A* 3avp_A* 3avo_A* 3avq_A* | Back alignment and structure |
|---|
| >1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >2obl_A ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O127} PDB: 2obm_A* | Back alignment and structure |
|---|
| >3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* | Back alignment and structure |
|---|
| >3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2dpy_A FLII, flagellum-specific ATP synthase; beta barrel, alpha-beta structure, hydrolase; HET: ADP; 2.40A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A | Back alignment and structure |
|---|
| >2oap_1 GSPE-2, type II secretion system protein; hexameric ATPase, hydrolase; HET: ANP; 2.95A {Archaeoglobus fulgidus} PDB: 2oaq_1 | Back alignment and structure |
|---|
| >2r6a_A DNAB helicase, replicative helicase; replication, DNAB; 2.90A {Geobacillus stearothermophilus} PDB: 2r6c_A 2r6d_A 2r6e_A 2vyf_A 2vye_A | Back alignment and structure |
|---|
| >1lw7_A Transcriptional regulator NADR; NMN, NMN adenylyl transferase, ribosylnicotinamide KINA transferase; HET: NAD; 2.90A {Haemophilus influenzae} SCOP: c.26.1.3 c.37.1.1 | Back alignment and structure |
|---|
| >1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* | Back alignment and structure |
|---|
| >1ewq_A DNA mismatch repair protein MUTS; multiple domains of protein, mostly mixed alpha-beta structures, one domain is entirely helical; HET: DNA; 2.20A {Thermus aquaticus} SCOP: a.113.1.1 c.37.1.12 c.55.6.1 d.75.2.1 PDB: 1nne_A* 1fw6_A* 1ewr_A* | Back alignment and structure |
|---|
| >1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* | Back alignment and structure |
|---|
| >1pui_A ENGB, probable GTP-binding protein ENGB; structural genomics, nysgxrc T16, GTPase, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2o8b_B DNA mismatch repair protein MSH6; DNA damage response, somatic hypermutat protein-DNA complex, DNA mispair, cancer; HET: DNA ADP; 2.75A {Homo sapiens} PDB: 2o8c_B* 2o8d_B* 2o8e_B* 2o8f_B* | Back alignment and structure |
|---|
| >3lda_A DNA repair protein RAD51; DNA binding protein, ATP-binding, DNA damage, DNA recombinat repair, nucleotide-binding; HET: DNA; 2.50A {Saccharomyces cerevisiae} PDB: 1szp_A* | Back alignment and structure |
|---|
| >2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A | Back alignment and structure |
|---|
| >2o5v_A DNA replication and repair protein RECF; ABC ATPase, walker A motif, P-loop, signature motif, replication/recombination complex; HET: DNA; 1.61A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >4e22_A Cytidylate kinase; P-loop, CMP/ATP binding, transferase; 2.32A {Yersinia pseudotuberculosis} | Back alignment and structure |
|---|
| >3bh0_A DNAB-like replicative helicase; ATPase, replication; 2.35A {Bacillus phage SPP1} | Back alignment and structure |
|---|
| >2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3pih_A Uvrabc system protein A; hydrolase, ABC ATPase, DNA repair, nucleotide excision repai hydrolase-DNA complex; HET: DNA; 2.90A {Thermotoga maritima} | Back alignment and structure |
|---|
| >2vf7_A UVRA2, excinuclease ABC, subunit A.; DNA-binding protein, nucleotide-binding, zinc-binding domain, SOS response, metal-binding; HET: ADP; 2.30A {Deinococcus radiodurans} PDB: 2vf8_A* | Back alignment and structure |
|---|
| >2r6f_A Excinuclease ABC subunit A; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, at cassette, DNA damage, DNA excision; HET: ADP; 3.20A {Geobacillus stearothermophilus} PDB: 3uwx_A | Back alignment and structure |
|---|
| >3hr8_A Protein RECA; alpha and beta proteins (A/B, A+B), ATP-binding, cytoplasm, damage, DNA recombination, DNA repair, DNA-binding; 1.95A {Thermotoga maritima} | Back alignment and structure |
|---|
| >1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D* | Back alignment and structure |
|---|
| >2rcn_A Probable GTPase ENGC; YJEQ, circularly permuted, GTP-binding, hydrolase, nucleotide-binding; HET: GDP; 2.25A {Salmonella typhimurium} PDB: 2ykr_W 4a2i_V | Back alignment and structure |
|---|
| >3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* | Back alignment and structure |
|---|
| >1u0l_A Probable GTPase ENGC; permutation, OB-fold, zinc-finger, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; HET: GDP; 2.80A {Thermotoga maritima} SCOP: b.40.4.5 c.37.1.8 | Back alignment and structure |
|---|
| >4a1f_A DNAB helicase, replicative DNA helicase; hydrolase, DNA replication, ATPase; HET: FLC; 2.50A {Helicobacter pylori} | Back alignment and structure |
|---|
| >2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >1udx_A The GTP-binding protein OBG; TGS domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.07A {Thermus thermophilus} SCOP: b.117.1.1 c.37.1.8 d.242.1.1 | Back alignment and structure |
|---|
| >2yv5_A YJEQ protein; hydrolase, GTPase, permutation, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GDP; 1.90A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >1t9h_A YLOQ, probable GTPase ENGC; N-terminal beta-barrel domain with oligonucleotide binding fold, central GTP binding domain; 1.60A {Bacillus subtilis} SCOP: b.40.4.5 c.37.1.8 | Back alignment and structure |
|---|
| >2p67_A LAO/AO transport system kinase; ARGK, structural GEN PSI-2, protein structure initiative, NEW YORK SGX research for structural genomics; 1.80A {Escherichia coli} SCOP: c.37.1.10 | Back alignment and structure |
|---|
| >2qag_C Septin-7; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1f2t_A RAD50 ABC-ATPase; DNA double-strand break repair, replication; 1.60A {Pyrococcus furiosus} SCOP: c.37.1.12 PDB: 1f2u_A* 1us8_A* | Back alignment and structure |
|---|
| >2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ... | Back alignment and structure |
|---|
| >2q6t_A DNAB replication FORK helicase; hydrolase; 2.90A {Thermus aquaticus} | Back alignment and structure |
|---|
| >2www_A Methylmalonic aciduria type A protein, mitochondrial; transport protein, nucleotide-binding; HET: GDP 2PE; 2.64A {Homo sapiens} | Back alignment and structure |
|---|
| >1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A | Back alignment and structure |
|---|
| >1v5w_A DMC1, meiotic recombination protein DMC1/LIM15 homolog; DNA-binding protein, ring protein, octamer, AAA ATPase; 3.20A {Homo sapiens} SCOP: c.37.1.11 PDB: 2zjb_A | Back alignment and structure |
|---|
| >2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2zts_A Putative uncharacterized protein PH0186; KAIC like protein, ATP-binding, nucleotide-binding, ATP- binding protein; HET: ADP; 2.07A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >1zu4_A FTSY; GTPase, signal recognition particle, SRP, receptor, protein transport; 1.95A {Mycoplasma mycoides} PDB: 1zu5_A | Back alignment and structure |
|---|
| >1w1w_A Structural maintenance of chromosome 1; cohesin, chromosome segregation, cell adhesion, kleisin, MIT cell cycle; HET: ATG; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >3tqc_A Pantothenate kinase; biosynthesis of cofactors, prosthetic groups, carriers, TRAN; HET: ADP; 2.30A {Coxiella burnetii} | Back alignment and structure |
|---|
| >2z43_A DNA repair and recombination protein RADA; archaea, filament, DNA binding, molecular SWI RECA, DMC1; HET: DNA; 1.93A {Sulfolobus solfataricus} PDB: 2bke_A* 2dfl_A* 2zub_A* 2zuc_A* 2zud_A* | Back alignment and structure |
|---|
| >4eaq_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, MTBI, transferase; HET: ATM; 1.85A {Staphylococcus aureus subsp} PDB: 4dwj_A* 4f4i_A | Back alignment and structure |
|---|
| >2i1q_A DNA repair and recombination protein RADA; ATPase, recombinase, ATP complex, calcium stimulation, RECA, DMC1; HET: DNA ANP; 1.90A {Methanococcus voltae} SCOP: a.60.4.1 c.37.1.11 PDB: 1xu4_A* 2b21_A* 2fpk_A* 2fpl_A* 2fpm_A* 1t4g_A* 3fyh_A* 2f1j_A* 2f1i_A* 2f1h_A* 3ntu_A* 3ewa_A* 3ew9_A* 3etl_A* 4dc9_A* 2gdj_A* | Back alignment and structure |
|---|
| >1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* | Back alignment and structure |
|---|
| >1oix_A RAS-related protein RAB-11A; small G protein, intracellular trafficking, GTP-binding, lipoprotein, prenylation, protein transport; HET: GDP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1oiw_A* 1oiv_A* 3rwo_B* 3rwm_B* | Back alignment and structure |
|---|
| >3k1j_A LON protease, ATP-dependent protease LON; ATP-binding, nucleotide-binding, Pro hydrolase; HET: ADP PE8; 2.00A {Thermococcus onnurineus} | Back alignment and structure |
|---|
| >3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} | Back alignment and structure |
|---|
| >3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >3cr8_A Sulfate adenylyltranferase, adenylylsulfate kinase; APS kinase, transferase, sulfate metabolism, nucleotide 2 kinase; 2.95A {Thiobacillus denitrificans} | Back alignment and structure |
|---|
| >3umf_A Adenylate kinase; rossmann fold, transferase; 2.05A {Schistosoma mansoni} | Back alignment and structure |
|---|
| >3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A | Back alignment and structure |
|---|
| >3bgw_A DNAB-like replicative helicase; ATPase, replication; 3.91A {Bacillus phage SPP1} | Back alignment and structure |
|---|
| >1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 | Back alignment and structure |
|---|
| >3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >4ad8_A DNA repair protein RECN; DNA binding protein, ATPase domain; HET: DNA; 4.00A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* | Back alignment and structure |
|---|
| >1odf_A YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser2 intergenic region; yeast protein, ATP binding protein; 2.25A {Saccharomyces cerevisiae} SCOP: c.37.1.6 | Back alignment and structure |
|---|
| >2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* | Back alignment and structure |
|---|
| >1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* | Back alignment and structure |
|---|
| >2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} | Back alignment and structure |
|---|
| >1qhl_A Protein (cell division protein MUKB); SMC, chromosome partitioning; 2.20A {Escherichia coli} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >3tlx_A Adenylate kinase 2; structural genomics, structural genomics consortium, SGC, RO fold, transferase, ATP binding, phosphorylation; HET: ADP ATP AMP; 2.75A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >2ged_A SR-beta, signal recognition particle receptor beta subunit; protein transport, G protein, proline isomerization, circular permutation; 2.20A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1u94_A RECA protein, recombinase A; homologous recombination, ATPase, DNA repair, DNA binding protein; 1.90A {Escherichia coli} SCOP: c.37.1.11 d.48.1.1 PDB: 1u98_A 1u99_A 1xms_A* 1xmv_A* 2rec_A 2reb_A 1n03_A* 1rea_A 1aa3_A | Back alignment and structure |
|---|
| >3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A | Back alignment and structure |
|---|
| >1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >2vhj_A Ntpase P4, P4; non- hydrolysable ATP analogue, hydrolase, virus dsRNA, molecular motor, packaging ATPase, hexameric helicase; HET: ADP; 1.80A {Pseudomonas phage PHI12} PDB: 2vhq_A* 1w44_A* 1w46_A* 1w47_A* 1w48_A* 1w49_A* 1w4a_A* 1w4b_A* 1w4c_A 2vht_A* 2vhu_A* 2vhc_A* | Back alignment and structure |
|---|
| >3lxx_A GTPase IMAP family member 4; structural genomics consortium, SGC, coiled coil, GTP- binding, nucleotide-binding, immune system; HET: GDP; 2.15A {Homo sapiens} | Back alignment and structure |
|---|
| >1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 | Back alignment and structure |
|---|
| >2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* | Back alignment and structure |
|---|
| >2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} | Back alignment and structure |
|---|
| >1q57_A DNA primase/helicase; dntpase, DNA replication, transferase; HET: DNA; 3.45A {Enterobacteria phage T7} SCOP: c.37.1.11 e.13.1.2 | Back alignment and structure |
|---|
| >2qag_A Septin-2, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >4ag6_A VIRB4 ATPase, type IV secretory pathway VIRB4 components-like P; hydrolase, type IV secretion, conjugation; 2.35A {Thermoanaerobacter pseudethanolicus} PDB: 4ag5_A | Back alignment and structure |
|---|
| >1xp8_A RECA protein, recombinase A; recombination, radioresistance, DNA-repair, ATPase, DNA-BIND protein, DNA binding protein; HET: AGS; 2.50A {Deinococcus radiodurans} SCOP: c.37.1.11 d.48.1.1 | Back alignment and structure |
|---|
| >1ls1_A Signal recognition particle protein; FFH, SRP54, SRP, GTPase, ultrahigh resolution, protein transport; 1.10A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 1jpn_B* 1jpj_A* 1ry1_U* 2j45_A* 1o87_A* 2c04_A* 2j46_A* 1rj9_B* 2c03_A* 2j7p_A* 1okk_A* 2cnw_A* 1ng1_A* 2xkv_A 3ng1_A 1ffh_A 2ng1_A* | Back alignment and structure |
|---|
| >1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* | Back alignment and structure |
|---|
| >3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* | Back alignment and structure |
|---|
| >3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* | Back alignment and structure |
|---|
| >2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >2atv_A RERG, RAS-like estrogen-regulated growth inhibitor; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >3t34_A Dynamin-related protein 1A, linker, dynamin-relat 1A; dynamin-like protein 1A, GTPase, membrane fission, motor Pro; HET: GDP; 2.40A {Arabidopsis thaliana} PDB: 3t35_A* | Back alignment and structure |
|---|
| >2p5s_A RAS and EF-hand domain containing; G-protein, RAB, GDP, structural genomics, SGC, structural genomics consortium, signaling protein; HET: GDP; 2.15A {Homo sapiens} | Back alignment and structure |
|---|
| >3zvl_A Bifunctional polynucleotide phosphatase/kinase; hydrolase-transferase complex, base excision repair, BER, non-homologous END-joining, NHEJ; 1.65A {Mus musculus} PDB: 3zvm_A* 3zvn_A* 1yj5_A 3u7e_B* 3u7f_B* 3u7h_B* 3u7g_A* | Back alignment and structure |
|---|
| >3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C | Back alignment and structure |
|---|
| >2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >2il1_A RAB12; G-protein, GDP, GTPase, predicted, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >3szr_A Interferon-induced GTP-binding protein MX1; interferon-induced antiviral GTPase, membrane associated, PR binding; 3.50A {Homo sapiens} PDB: 3zys_B | Back alignment and structure |
|---|
| >3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2wsm_A Hydrogenase expression/formation protein (HYPB); metal binding protein; 2.30A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A | Back alignment and structure |
|---|
| >2b6h_A ADP-ribosylation factor 5; membrane trafficking, GDP, structural genomics, structural G consortium, SGC, protein transport; HET: GDP; 1.76A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z6x_A* 3aq4_A* | Back alignment and structure |
|---|
| >1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* | Back alignment and structure |
|---|
| >2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* | Back alignment and structure |
|---|
| >2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* | Back alignment and structure |
|---|
| >1gwn_A RHO-related GTP-binding protein RHOE; GTPase, inactive GTPase, signal transduction; HET: GTP; 2.1A {Mus musculus} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >1mky_A Probable GTP-binding protein ENGA; GTPase, DER, KH-domain, tandem G-domains, ligand binding protein; HET: GDP; 1.90A {Thermotoga maritima} SCOP: c.37.1.8 c.37.1.8 d.52.5.1 | Back alignment and structure |
|---|
| >3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} | Back alignment and structure |
|---|
| >1zcb_A G alpha I/13; GTP-binding, lipoprotein, membrane, transducer, signaling PR; HET: GDP; 2.00A {Mus musculus} SCOP: a.66.1.1 c.37.1.8 PDB: 3ab3_A* 3cx8_A* 3cx7_A* 3cx6_A* 1zca_A* | Back alignment and structure |
|---|
| >2j1l_A RHO-related GTP-binding protein RHOD; GTPase, membrane, prenylation, hydrolase, nucleotide-binding, methylation, lipoprotein, endosome DYNA; HET: GDP; 2.5A {Homo sapiens} | Back alignment and structure |
|---|
| >2ew1_A RAS-related protein RAB-30; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2aka_B Dynamin-1; fusion protein, GTPase domain, myosin, contractIle protein; 1.90A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 3l43_A* | Back alignment and structure |
|---|
| >1j8m_F SRP54, signal recognition 54 kDa protein; signaling protein; 2.00A {Acidianus ambivalens} SCOP: a.24.13.1 c.37.1.10 PDB: 1j8y_F | Back alignment and structure |
|---|
| >2qu8_A Putative nucleolar GTP-binding protein 1; GTPase, malaria, structural genomics, structural genomics consortium, SGC, unknown function; HET: GDP; 2.01A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* | Back alignment and structure |
|---|
| >3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2ius_A DNA translocase FTSK; nucleotide-binding, chromosome partition, ATP-binding, DNA- binding, cell division, transmembrane, inner membrane; HET: DNA; 2.7A {Escherichia coli} PDB: 2j5p_A* | Back alignment and structure |
|---|
| >2qtf_A Protein HFLX, GTP-binding protein; beta-alpha-barrels, nucleotide-binding, nucleotide binding protein; 2.00A {Sulfolobus solfataricus P2} PDB: 2qth_A* 3kxi_A* 3kxl_A 3kxk_A | Back alignment and structure |
|---|
| >2hup_A RAS-related protein RAB-43; G-protein, GDP, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.05A {Homo sapiens} | Back alignment and structure |
|---|
| >1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >4gzl_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTP binding, membrane, hydrolase; HET: GNP; 2.00A {Homo sapiens} PDB: 3th5_A* 4gzm_A* | Back alignment and structure |
|---|
| >2e87_A Hypothetical protein PH1320; GTP-binding, GTPase, OBG, bundle, GDP, complex, structural G NPPSFA; HET: GDP; 2.35A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >1h65_A Chloroplast outer envelope protein OEP34; GTPase, translocon; HET: GDP; 2.0A {Pisum sativum} SCOP: c.37.1.8 PDB: 3bb1_A* | Back alignment and structure |
|---|
| >2qmh_A HPR kinase/phosphorylase; V267F mutation, ATP-binding, carbohydrate metabolism, magnesium, metal-binding, multifunctional enzyme; 2.60A {Lactobacillus casei} PDB: 1jb1_A 1kkl_A 1kkm_A* | Back alignment and structure |
|---|
| >3ice_A Transcription termination factor RHO; transcription, ATPase, hexamer, helicase, RNA, RECA, OB fold ATP-binding, hydrolase; HET: MSE ADP SPD; 2.80A {Escherichia coli k-12} PDB: 1pv4_A 1pvo_A* 1xpo_A* 1xpr_A* 1xpu_A* 2ht1_A | Back alignment and structure |
|---|
| >3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A | Back alignment and structure |
|---|
| >4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4dhe_A Probable GTP-binding protein ENGB; melioidosis, RAS-like GTPase, cell division, cell cycle, SEP GTP-binding; 2.20A {Burkholderia thailandensis} | Back alignment and structure |
|---|
| >3hws_A ATP-dependent CLP protease ATP-binding subunit CL; CLPXP, AAA+ molecular machine, hexamer, asymmetric,, ATP-BIN chaperone, metal-binding; HET: ADP; 3.25A {Escherichia coli} PDB: 3hte_A | Back alignment and structure |
|---|
| >2hf9_A Probable hydrogenase nickel incorporation protein HYPB; alpha and beta protein; HET: GSP; 1.90A {Methanocaldococcus jannaschii} PDB: 2hf8_A* | Back alignment and structure |
|---|
| >3q3j_B RHO-related GTP-binding protein RHO6; RAS-binding domain, plexin, small GTPase, structural genomic consortium, SGC; HET: GNP; 1.97A {Homo sapiens} PDB: 2rex_B* 2cls_A* | Back alignment and structure |
|---|
| >2f6r_A COA synthase, bifunctional coenzyme A synthase; 18044849, bifunctional coenzyme A synthase (COA synthase), S genomics; HET: ACO UNL; 1.70A {Mus musculus} | Back alignment and structure |
|---|
| >1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* | Back alignment and structure |
|---|
| >2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* | Back alignment and structure |
|---|
| >2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} | Back alignment and structure |
|---|
| >3vkw_A Replicase large subunit; alpha/beta domain, helicase, transferase; 1.90A {Tomato mosaic virus} | Back alignment and structure |
|---|
| >3th5_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTPase, GTP binding, protein binding, signali protein; HET: GNP; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >1g8p_A Magnesium-chelatase 38 kDa subunit; parallel beta sheet, P-loop, rossman fold, AAA+, photosynthesis, metal transport; 2.10A {Rhodobacter capsulatus} SCOP: c.37.1.20 PDB: 2x31_G | Back alignment and structure |
|---|
| >2qen_A Walker-type ATPase; unknown function; HET: ADP; 2.25A {Pyrococcus abyssi} | Back alignment and structure |
|---|
| >1um8_A ATP-dependent CLP protease ATP-binding subunit CL; CLPP binding loop, chaperone; HET: ADP; 2.60A {Helicobacter pylori} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3l0i_B RAS-related protein RAB-1A; GEF-GDF-RAB complex, GTP-binding, guanine-nucleotide exchang GDI-displacement factor; 2.85A {Homo sapiens} | Back alignment and structure |
|---|
| >3def_A T7I23.11 protein; chloroplast, TOC33, GTPase, hydrolase; HET: GDP; 1.96A {Arabidopsis thaliana} PDB: 3bb3_A* 3bb4_A* 2j3e_A* | Back alignment and structure |
|---|
| >4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} | Back alignment and structure |
|---|
| >2g3y_A GTP-binding protein GEM; small GTPase, GDP, inactive state, RGK family, structur genomics, structural genomics consortium, SGC, signaling PR; HET: GDP; 2.40A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} | Back alignment and structure |
|---|
| >3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* | Back alignment and structure |
|---|
| >2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* | Back alignment and structure |
|---|
| >2r44_A Uncharacterized protein; putative ATPase, structural genomics, joint center for struc genomics, JCSG; HET: MSE PG4; 2.00A {Cytophaga hutchinsonii atcc 33406} | Back alignment and structure |
|---|
| >3io5_A Recombination and repair protein; storage dimer, inactive conformation, RECA like core domain, binding, DNA damage, DNA recombination; 2.40A {Enterobacteria phage T4} | Back alignment and structure |
|---|
| >2ffh_A Protein (FFH); SRP54, signal recognition particle, GTPase, M domain, RNA-binding, signal sequence-binding, helix-turn-helix, protein targeting; 3.20A {Thermus aquaticus} SCOP: a.24.13.1 a.36.1.1 c.37.1.10 PDB: 2iy3_A | Back alignment and structure |
|---|
| >3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} | Back alignment and structure |
|---|
| >4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* | Back alignment and structure |
|---|
| >3cnl_A YLQF, putative uncharacterized protein; circular permutation, GNP, signaling protein; HET: GNP; 2.00A {Thermotoga maritima} PDB: 3cnn_A* 3cno_A* | Back alignment and structure |
|---|
| >3upu_A ATP-dependent DNA helicase DDA; RECA-like domain, SH3 domain, PIN-tower interface, coupling hydrolysis to DNA unwinding, ssDNA; 3.30A {Enterobacteria phage T4} | Back alignment and structure |
|---|
| >2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A* | Back alignment and structure |
|---|
| >3p32_A Probable GTPase RV1496/MT1543; structural genomics, seattle structural genomics center for infectious disease, ssgcid, MEAB, MMAA; HET: GDP PGE; 1.90A {Mycobacterium tuberculosis} PDB: 3md0_A* 4gt1_A* 3nxs_A* 3tk1_A* | Back alignment and structure |
|---|
| >3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} | Back alignment and structure |
|---|
| >1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* | Back alignment and structure |
|---|
| >3lv8_A DTMP kinase, thymidylate kinase; structural genomics, in diseases, center for structural genomics of infectious DISE ATP-binding; HET: ADP TMP TYD; 1.80A {Vibrio cholerae o1 biovar eltor} PDB: 3n2i_A* | Back alignment and structure |
|---|
| >1puj_A YLQF, conserved hypothetical protein YLQF; structural genomics, nysgxrc T18, GTPase, PSI, protein structure initiative; HET: GNP; 2.00A {Bacillus subtilis} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >2fna_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE ADP; 2.00A {Sulfolobus solfataricus} SCOP: a.4.5.11 c.37.1.20 | Back alignment and structure |
|---|
| >1bif_A 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; transferase (phospho), phosphatase, hydrolase (phosp glycolysis, bifunctional enzyme; HET: AGS; 2.00A {Rattus norvegicus} SCOP: c.37.1.7 c.60.1.4 PDB: 3bif_A* 2bif_A* 1k6m_A* 1c80_A* 1c7z_A* 1c81_A* 1tip_A* 1fbt_A | Back alignment and structure |
|---|
| >1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >1e9r_A Conjugal transfer protein TRWB; coupling protein, bacterial conjugation, F1-ATPase-like quaternary structure, ring helicases; 2.4A {Escherichia coli} SCOP: c.37.1.11 PDB: 1e9s_A 1gki_A* 1gl7_A* 1gl6_A* | Back alignment and structure |
|---|
| >3a8t_A Adenylate isopentenyltransferase; rossmann fold protein; HET: ATP; 2.37A {Humulus lupulus} | Back alignment and structure |
|---|
| >1tue_A Replication protein E1; helicase, replication, E1E2 complex, AAA+ protein; 2.10A {Human papillomavirus type 18} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >4b4t_H 26S protease regulatory subunit 7 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2qpt_A EH domain-containing protein-2; protein-nucleotide complex, membrane protein, endocytosis; HET: ANP; 3.10A {Mus musculus} | Back alignment and structure |
|---|
| >3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} | Back alignment and structure |
|---|
| >2x2e_A Dynamin-1; nitration, hydrolase, membrane fission, nucleotide-binding, endocytosis, motor protein; HET: GDP; 2.00A {Homo sapiens} PDB: 2x2f_A* 3zyc_A* 3zys_A | Back alignment and structure |
|---|
| >3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* | Back alignment and structure |
|---|
| >3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} | Back alignment and structure |
|---|
| >3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* | Back alignment and structure |
|---|
| >3e1s_A Exodeoxyribonuclease V, subunit RECD; alpha and beta protein, ATP-binding, nucleotide-binding, HYD; 2.20A {Deinococcus radiodurans} PDB: 3gp8_A 3gpl_A* | Back alignment and structure |
|---|
| >3geh_A MNME, tRNA modification GTPase MNME; G protein, U34, GTP-binding, HYDR magnesium, metal-binding, nucleotide-binding, potassium, TR processing; HET: GDP FON; 3.20A {Nostoc SP} | Back alignment and structure |
|---|
| >3ec1_A YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase, signaling protein; HET: GDP; 2.36A {Geobacillus stearothermophilus} | Back alignment and structure |
|---|
| >2wkq_A NPH1-1, RAS-related C3 botulinum toxin substrate 1; transferase, cell adhesion, nucleotide-binding, protein engineering, RAS superfamily LOV2; HET: GTP FMN; 1.60A {Avena sativa} PDB: 2wkr_A* 2wkp_A* | Back alignment and structure |
|---|
| >2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A | Back alignment and structure |
|---|
| >1g41_A Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dependent proteolysis, chaperone; HET: ADP; 2.30A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1g3i_A* 1im2_A* 1kyi_A* 1g4a_E* 1g4b_E 1yyf_A* 1do0_A* 1do2_A* 1e94_E* 1hqy_E* 1ht1_E* 1ht2_E* | Back alignment and structure |
|---|
| >3h2y_A GTPase family protein; GTP-binding protein YQEH, possibly involved in replication initiation, csgid, IDP90222; HET: DGI; 1.80A {Bacillus anthracis str} | Back alignment and structure |
|---|
| >3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* | Back alignment and structure |
|---|
| >4b4t_I 26S protease regulatory subunit 4 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2vf7_A UVRA2, excinuclease ABC, subunit A.; DNA-binding protein, nucleotide-binding, zinc-binding domain, SOS response, metal-binding; HET: ADP; 2.30A {Deinococcus radiodurans} PDB: 2vf8_A* | Back alignment and structure |
|---|
| >1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >3pxg_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 3.65A {Bacillus subtilis} | Back alignment and structure |
|---|
| >2v3c_C SRP54, signal recognition 54 kDa protein; nucleotide-binding, signal recognition particle, GTP-binding, RNA-binding; 2.50A {Methanocaldococcus jannaschii} PDB: 3ndb_B | Back alignment and structure |
|---|
| >1lnz_A SPO0B-associated GTP-binding protein; GTPase, OBG, stringent factor, stress response, sporulation, large G-protein, structural genomics, PSI; HET: G4P; 2.60A {Bacillus subtilis} SCOP: b.117.1.1 c.37.1.8 | Back alignment and structure |
|---|
| >3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* | Back alignment and structure |
|---|
| >2iut_A DNA translocase FTSK; nucleotide-binding, chromosome partition, ATP-binding, DNA- cell division, DNA translocation, KOPS, membrane; HET: DNA SAP; 2.25A {Pseudomonas aeruginosa} PDB: 2iuu_A* | Back alignment and structure |
|---|
| >3o47_A ADP-ribosylation factor GTPase-activating protein ribosylation factor 1; structural genomics consortium, GTPase activation; HET: GDP; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3nbx_X ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structure, rossman fold, hydro; HET: ADP; 2.91A {Escherichia coli} | Back alignment and structure |
|---|
| >1f5n_A Interferon-induced guanylate-binding protein 1; GBP, GTP hydrolysis, GDP, GMP, dynamin related, large GTPase family. GMPPNP, GPPNHP.; HET: GNP; 1.70A {Homo sapiens} SCOP: a.114.1.1 c.37.1.8 PDB: 1dg3_A* 2b8w_A* 2b92_A* 2bc9_A* 2d4h_A* | Back alignment and structure |
|---|
| >3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >1cip_A Protein (guanine nucleotide-binding protein alpha-1 subunit); GTPase, hydrolase; HET: GNP; 1.50A {Rattus norvegicus} SCOP: a.66.1.1 c.37.1.8 PDB: 1agr_A* 1bof_A* 1gdd_A* 1gfi_A* 1gia_A* 1gp2_A* 3ffa_A* 3ffb_A* 1gg2_A* 1git_A* 1svs_A* 1svk_A* 2zjz_A* 2zjy_A* 3ums_A* 2pz2_A* 2pz3_A* 1as0_A* 1as2_A* 1as3_A* ... | Back alignment and structure |
|---|
| >2axn_A 6-phosphofructo-2-kinase/fructose-2,6- biphosphatase 3 (6PF-2-K/FRU- 2,6-P2ASE brain/placenta-type...; bifunctional enzyme, EDTA complex; HET: F6P EDT ADP; 2.10A {Homo sapiens} PDB: 2dwo_A* 2dwp_A* 2i1v_B* 3qpu_A* 3qpv_A* 3qpw_A* | Back alignment and structure |
|---|
| >2j69_A Bacterial dynamin-like protein; FZO, FZL, GTPase, hydrolase; 3.0A {Nostoc punctiforme} PDB: 2j68_A 2w6d_A* | Back alignment and structure |
|---|
| >4b3f_X DNA-binding protein smubp-2; hydrolase, helicase; 2.50A {Homo sapiens} PDB: 4b3g_A | Back alignment and structure |
|---|
| >3gee_A MNME, tRNA modification GTPase MNME; G protein, cytoplasm, GTP- binding, hydrolase, magnesium, metal-binding, nucleotide- binding, potassium; HET: GDP FON; 2.95A {Chlorobium tepidum} PDB: 3gei_A* | Back alignment and structure |
|---|
| >3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3dpu_A RAB family protein; roccor, G-domain, COR, GTP-binding, nucleotide-binding, SIGN protein; 2.90A {Chlorobaculum tepidum} | Back alignment and structure |
|---|
| >2gk6_A Regulator of nonsense transcripts 1; UPF1, helicase, NMD, hydrolase; HET: ADP; 2.40A {Homo sapiens} PDB: 2gjk_A* 2gk7_A 2xzo_A* 2xzp_A | Back alignment and structure |
|---|
| >2hjg_A GTP-binding protein ENGA; GTPase ENGA KH-domain, hydrolase; HET: GDP; 2.50A {Bacillus subtilis} | Back alignment and structure |
|---|
| >2j37_W Signal recognition particle 54 kDa protein (SRP54); ribosome, SRP, translation/RNA; 8.00A {Canis SP} PDB: 1wgw_A | Back alignment and structure |
|---|
| >1x6v_B Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthethase 1; transferase, ATP sulfurylase, APS kinase, PAPS; HET: ADP; 1.75A {Homo sapiens} SCOP: b.122.1.3 c.26.1.5 c.37.1.4 PDB: 1xjq_B* 1xnj_B* 2qjf_A* 2ofx_A* 2ofw_A* | Back alignment and structure |
|---|
| >1xzp_A Probable tRNA modification GTPase TRME; GTP-binding, THF-binding, hydrolase; 2.30A {Thermotoga maritima} SCOP: a.24.25.1 c.37.1.8 d.250.1.2 PDB: 1xzq_A* 1xzp_B 1xzq_B* | Back alignment and structure |
|---|
| >4a9a_A Ribosome-interacting GTPase 1; DRG-DFRP complex, ribosome binding GTPase; 2.67A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2r6f_A Excinuclease ABC subunit A; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, at cassette, DNA damage, DNA excision; HET: ADP; 3.20A {Geobacillus stearothermophilus} PDB: 3uwx_A | Back alignment and structure |
|---|
| >1ko7_A HPR kinase/phosphatase; protein kinase, phosphotransfer, protein phosphatase, dual activity, product, substrate, transferase, hydrolase; 1.95A {Staphylococcus xylosus} SCOP: c.98.2.1 c.91.1.2 | Back alignment and structure |
|---|
| >1u0j_A DNA replication protein; AAA+ protein, P-loop atpases, helicase; HET: DNA ADP; 2.10A {Adeno-associated virus - 2} SCOP: c.37.1.20 PDB: 1s9h_A | Back alignment and structure |
|---|
| >1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* | Back alignment and structure |
|---|
| >1m8p_A Sulfate adenylyltransferase; rossmann fold, phosphosulfate binding, T-state; HET: PPS; 2.60A {Penicillium chrysogenum} SCOP: b.122.1.3 c.26.1.5 c.37.1.15 PDB: 1i2d_A* | Back alignment and structure |
|---|
| >1w36_D RECD, exodeoxyribonuclease V alpha chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 PDB: 3k70_D* | Back alignment and structure |
|---|
| >1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 | Back alignment and structure |
|---|
| >2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* | Back alignment and structure |
|---|
| >2xzl_A ATP-dependent helicase NAM7; hydrolase-RNA complex, NMD, RNA degradation, allosteric REGU; HET: ADP 1PE; 2.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} | Back alignment and structure |
|---|
| >3q5d_A Atlastin-1; G protein, GTPase, GDP/GTP binding, hydrolase; HET: GDP; 2.70A {Homo sapiens} PDB: 3q5e_A* 3qnu_A* 3qof_A* | Back alignment and structure |
|---|
| >1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} | Back alignment and structure |
|---|
| >2gks_A Bifunctional SAT/APS kinase; transferase, sulfurylase; HET: ADP; 2.31A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >2wjy_A Regulator of nonsense transcripts 1; nonsense mediated decay, zinc-finger, ATP-binding, metal-BIN UPF2, UPF1, helicase, hydrolase; 2.50A {Homo sapiens} PDB: 2wjv_A 2iyk_A | Back alignment and structure |
|---|
| >1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* | Back alignment and structure |
|---|
| >3f9v_A Minichromosome maintenance protein MCM; replicative helicase, DNA replication, MCM complex, AAA+ Pro ATP-binding, DNA-binding, helicase; 4.35A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >1azs_C GS-alpha; complex (lyase/hydrolase), hydrolase, signal transducing protein, cyclase, effector enzyme; HET: GSP FKP; 2.30A {Bos taurus} SCOP: a.66.1.1 c.37.1.8 PDB: 1azt_A* 3c14_C* 3c15_C* 3c16_C* 1cjt_C* 1cjk_C* 1cju_C* 1cjv_C* 1tl7_C* 1cs4_C* 1u0h_C* 2gvd_C* 2gvz_C* 3e8a_C* 3g82_C* 3maa_C* 1cul_C* 3sn6_A* | Back alignment and structure |
|---|
| >1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 | Back alignment and structure |
|---|
| >1sky_E F1-ATPase, F1-ATP synthase; F1FO ATP synthase, alpha3BETA3 SUBC F1-ATPase, hydrolase; 3.20A {Bacillus SP} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 | Back alignment and structure |
|---|
| >3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} | Back alignment and structure |
|---|
| >2j9r_A Thymidine kinase; TK1, DNK, lasso, transferase, ATP-binding, deoxyribonucleoside kinase, DNA synthesis, phosphate accept nucleotide-binding; HET: THM; 2.7A {Bacillus anthracis} PDB: 2ja1_A* | Back alignment and structure |
|---|
| >3e2i_A Thymidine kinase; Zn-binding, ATP-binding, DNA synthesis, nucleotide-B transferase; HET: MSE; 2.01A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >4akg_A Glutathione S-transferase class-MU 26 kDa isozyme heavy chain cytoplasmic; motor protein, AAA+ protein, ASCE protein, P-loop ntpase; HET: ATP ADP; 3.30A {Schistosoma japonicum} PDB: 4ai6_A* 4akh_A* 4aki_A* 3qmz_A | Back alignment and structure |
|---|
| >1g8f_A Sulfate adenylyltransferase; alpha-beta protein, beta-barrel, rossmann-fold, kinase fold; 1.95A {Saccharomyces cerevisiae} SCOP: b.122.1.3 c.26.1.5 c.37.1.15 PDB: 1g8g_A* 1g8h_A* 1j70_A 1jec_A 1jed_A* 1jee_A* | Back alignment and structure |
|---|
| >4dcu_A GTP-binding protein ENGA; GTPase, GDP, protein binding, hydrolase; HET: GDP; 2.00A {Bacillus subtilis} PDB: 4dct_A* 4dcs_A* 4dcv_A* 2hjg_A* | Back alignment and structure |
|---|
| >3izq_1 HBS1P, elongation factor 1 alpha-like protein; NO-GO mRNA decay, ribosomal protein,hydrolase; 9.50A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1knx_A Probable HPR(Ser) kinase/phosphatase; HPR kinase, HPR kinase/phosphatase, HPRK/P, P-loop, walker A BOX, catabolite repression; 2.50A {Mycoplasma pneumoniae} SCOP: c.98.2.1 c.91.1.2 | Back alignment and structure |
|---|
| >3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* | Back alignment and structure |
|---|
| >3p26_A Elongation factor 1 alpha-like protein; GTP/GDP binding domain, beta-barrel, translational GTPase, D structural genomics; 2.50A {Saccharomyces cerevisiae} PDB: 3p27_A* | Back alignment and structure |
|---|
| >2xxa_A Signal recognition particle protein; protein transport, RNA/RNA binding protein, hydrolase, gtpas; HET: GCP; 3.94A {Escherichia coli} PDB: 2j28_9 | Back alignment and structure |
|---|
| >3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
No hit with e-value below 0.005
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 231 | |||
| d2pmka1 | 241 | Haemolysin B ATP-binding protein {Escherichia coli | 98.66 | |
| d1l2ta_ | 230 | MJ0796 {Archaeon Methanococcus jannaschii [TaxId: | 98.62 | |
| d3dhwc1 | 240 | Methionine import ATP-binding protein MetN {Escher | 98.57 | |
| d3b60a1 | 253 | Multidrug resistance ABC transporter MsbA, C-termi | 98.57 | |
| d1sgwa_ | 200 | Putative ABC transporter PF0895 {Pyrococcus furios | 98.54 | |
| d2hyda1 | 255 | Putative multidrug export ATP-binding/permease pro | 98.48 | |
| d1mv5a_ | 242 | Multidrug resistance ABC transporter LmrA, C-termi | 98.48 | |
| d2awna2 | 232 | Maltose transport protein MalK, N-terminal domain | 98.48 | |
| d1vpla_ | 238 | Putative ABC transporter TM0544 {Thermotoga mariti | 98.47 | |
| d1r0wa_ | 281 | Cystic fibrosis transmembrane conductance regulato | 98.46 | |
| d1ji0a_ | 240 | Branched chain aminoacid ABC transporter {Thermoto | 98.45 | |
| d1jj7a_ | 251 | Peptide transporter Tap1, C-terminal ABC domain {H | 98.45 | |
| d1g2912 | 240 | Maltose transport protein MalK, N-terminal domain | 98.44 | |
| d1g6ha_ | 254 | MJ1267 {Archaeon Methanococcus jannaschii [TaxId: | 98.43 | |
| d1v43a3 | 239 | Hypothetical protein PH0022, N-terminal domain {Py | 98.39 | |
| d1oxxk2 | 242 | Glucose transport protein GlcV, N-terminal domain | 98.38 | |
| d1b0ua_ | 258 | ATP-binding subunit of the histidine permease {Sal | 98.35 | |
| d3d31a2 | 229 | Sulfate/molybdate ABC transporter, ATP-binding pro | 98.32 | |
| d2i1qa2 | 258 | DNA repair protein Rad51, catalytic domain {Archae | 97.21 | |
| d1cr2a_ | 277 | Gene 4 protein (g4p, DNA primase), helicase domain | 97.08 | |
| d1szpa2 | 251 | DNA repair protein Rad51, catalytic domain {Baker' | 97.02 | |
| d1pzna2 | 254 | DNA repair protein Rad51, catalytic domain {Archae | 96.95 | |
| d1gvnb_ | 273 | Plasmid maintenance system epsilon/zeta, toxin zet | 96.94 | |
| d1tf7a1 | 242 | Circadian clock protein KaiC {Synechococcus sp. st | 96.85 | |
| d1v5wa_ | 258 | Meiotic recombination protein DMC1/LIM15 homolog { | 96.65 | |
| g1xew.1 | 329 | Smc head domain {Pyrococcus furiosus [TaxId: 2261] | 96.65 | |
| d1nlfa_ | 274 | Hexameric replicative helicase repA {Escherichia c | 96.62 | |
| d1tf7a2 | 242 | Circadian clock protein KaiC {Synechococcus sp. st | 96.62 | |
| d1fnna2 | 276 | CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T | 96.32 | |
| d1iqpa2 | 231 | Replication factor C {Archaeon Pyrococcus furiosus | 96.26 | |
| d1sxja2 | 253 | Replication factor C1 {Baker's yeast (Saccharomyce | 96.23 | |
| d1h65a_ | 257 | Chloroplast protein translocon GTPase Toc34 {Garde | 96.17 | |
| d2fnaa2 | 283 | Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ | 96.12 | |
| d1ofha_ | 309 | HslU {Haemophilus influenzae [TaxId: 727]} | 96.04 | |
| d1d2na_ | 246 | Hexamerization domain of N-ethylmalemide-sensitive | 95.95 | |
| d1in4a2 | 238 | Holliday junction helicase RuvB {Thermotoga mariti | 95.9 | |
| d1w5sa2 | 287 | CDC6-like protein APE0152, N-terminal domain {Aero | 95.9 | |
| d1ixsb2 | 239 | Holliday junction helicase RuvB {Thermus thermophi | 95.86 | |
| d1u0la2 | 225 | Probable GTPase EngC (YjeQ), C-terminal domain {Th | 95.83 | |
| d1ixza_ | 247 | AAA domain of cell division protein FtsH {Thermus | 95.76 | |
| d1lv7a_ | 256 | AAA domain of cell division protein FtsH {Escheric | 95.74 | |
| d1g6oa_ | 323 | Hexameric traffic ATPase, HP0525 {Helicobacter pyl | 95.71 | |
| d1r7ra3 | 265 | Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu | 95.69 | |
| d1wb9a2 | 234 | DNA repair protein MutS, the C-terminal domain {Es | 95.64 | |
| d1sxjd2 | 237 | Replication factor C2 {Baker's yeast (Saccharomyce | 95.49 | |
| d1sxjc2 | 227 | Replication factor C3 {Baker's yeast (Saccharomyce | 95.42 | |
| d1e32a2 | 258 | Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu | 95.42 | |
| d1ewqa2 | 224 | DNA repair protein MutS, the C-terminal domain {Th | 95.42 | |
| d1sxjb2 | 224 | Replication factor C4 {Baker's yeast (Saccharomyce | 95.27 | |
| d2p67a1 | 327 | LAO/AO transport system kinase ArgK {Escherichia c | 95.04 | |
| d1sxje2 | 252 | Replication factor C5 {Baker's yeast (Saccharomyce | 94.94 | |
| d1g8pa_ | 333 | ATPase subunit of magnesium chelatase, BchI {Rhodo | 94.88 | |
| d1t9ha2 | 231 | Probable GTPase EngC (YjeQ), C-terminal domain {Ba | 94.55 | |
| d2qm8a1 | 323 | Metallochaperone MeaB {Methylobacterium extorquens | 94.51 | |
| d1tq4a_ | 400 | Interferon-inducible GTPase {Mouse (Mus musculus) | 94.5 | |
| d1u94a1 | 263 | RecA protein, ATPase-domain {Escherichia coli [Tax | 94.48 | |
| d1r6bx3 | 315 | ClpA, an Hsp100 chaperone, AAA+ modules {Escherich | 93.93 | |
| d1p9ra_ | 401 | Extracellular secretion NTPase EpsE {Vibrio choler | 93.6 | |
| d1g41a_ | 443 | HslU {Haemophilus influenzae [TaxId: 727]} | 93.13 | |
| d1svma_ | 362 | Papillomavirus large T antigen helicase domain {Si | 93.07 | |
| d1e9ra_ | 433 | Bacterial conjugative coupling protein TrwB {Esche | 93.03 | |
| d1w36d1 | 359 | Exodeoxyribonuclease V alpha chain (RecD) {Escheri | 92.89 | |
| d1w44a_ | 321 | NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} | 92.36 | |
| d1htwa_ | 158 | Hypothetical protein HI0065 {Haemophilus influenza | 92.33 | |
| d1sq5a_ | 308 | Pantothenate kinase PanK {Escherichia coli [TaxId: | 91.74 | |
| d1mo6a1 | 269 | RecA protein, ATPase-domain {Mycobacterium tubercu | 91.17 | |
| d1odfa_ | 286 | Hypothetical protein Ygr205W {Baker's yeast (Sacch | 90.51 | |
| d1l8qa2 | 213 | Chromosomal replication initiation factor DnaA {Aq | 89.75 | |
| d1xp8a1 | 268 | RecA protein, ATPase-domain {Deinococcus radiodura | 89.52 | |
| d1puja_ | 273 | Probable GTPase YlqF {Bacillus subtilis [TaxId: 14 | 89.46 | |
| d1qvra3 | 315 | ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 | 89.27 | |
| d1njfa_ | 239 | delta prime subunit of DNA polymerase III, N-domai | 89.2 | |
| d2a5yb3 | 277 | CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI | 88.86 | |
| d1f5na2 | 277 | Interferon-induced guanylate-binding protein 1 (GB | 88.63 | |
| d1r6bx2 | 268 | ClpA, an Hsp100 chaperone, AAA+ modules {Escherich | 88.62 | |
| d1jbka_ | 195 | ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} | 87.03 | |
| d1u0ja_ | 267 | Rep 40 protein helicase domain {Adeno-associated v | 84.91 | |
| d2akab1 | 299 | Dynamin G domain {Rat (Rattus norvegicus) [TaxId: | 84.47 | |
| d1xpua3 | 289 | Transcription termination factor Rho, ATPase domai | 81.54 | |
| d1qvra2 | 387 | ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 | 80.98 |
| >d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: ABC transporter ATPase domain-like domain: Haemolysin B ATP-binding protein species: Escherichia coli [TaxId: 562]
Probab=98.66 E-value=7.6e-09 Score=88.30 Aligned_cols=35 Identities=14% Similarity=-0.020 Sum_probs=33.0
Q ss_pred ccccccceeEEeCCeEEEEecCCCCCchhHHHHHH
Q 037424 184 INILNRVSGILKPGSVNLADCLTFLHPLDVFQVLF 218 (231)
Q Consensus 184 ~~IL~dVSGiiKPGeMTLVLGrPGSGcSTlLK~L~ 218 (231)
..||+|||-.|+||+.+.|+||+|||||||+|.|.
T Consensus 16 ~~vL~~isl~i~~Ge~vaIvG~sGsGKSTLl~ll~ 50 (241)
T d2pmka1 16 PVILDNINLSIKQGEVIGIVGRSGSGKSTLTKLIQ 50 (241)
T ss_dssp CEEEEEEEEEEETTCEEEEECSTTSSHHHHHHHHT
T ss_pred cceEeeeEEEEcCCCEEEEECCCCCCHHHHHHHHH
Confidence 45899999999999999999999999999999985
|
| >d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} | Back information, alignment and structure |
|---|
| >d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} | Back information, alignment and structure |
|---|
| >d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} | Back information, alignment and structure |
|---|
| >d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} | Back information, alignment and structure |
|---|
| >d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} | Back information, alignment and structure |
|---|
| >d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} | Back information, alignment and structure |
|---|
| >d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} | Back information, alignment and structure |
|---|
| >d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} | Back information, alignment and structure |
|---|
| >d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} | Back information, alignment and structure |
|---|
| >d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} | Back information, alignment and structure |
|---|
| >d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wb9a2 c.37.1.12 (A:567-800) DNA repair protein MutS, the C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ewqa2 c.37.1.12 (A:542-765) DNA repair protein MutS, the C-terminal domain {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} | Back information, alignment and structure |
|---|
| >d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} | Back information, alignment and structure |
|---|
| >d1tq4a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} | Back information, alignment and structure |
|---|
| >d1e9ra_ c.37.1.11 (A:) Bacterial conjugative coupling protein TrwB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} | Back information, alignment and structure |
|---|
| >d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} | Back information, alignment and structure |
|---|
| >d1puja_ c.37.1.8 (A:) Probable GTPase YlqF {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1f5na2 c.37.1.8 (A:7-283) Interferon-induced guanylate-binding protein 1 (GBP1), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1u0ja_ c.37.1.20 (A:) Rep 40 protein helicase domain {Adeno-associated virus 2, AAV2 [TaxId: 10804]} | Back information, alignment and structure |
|---|
| >d2akab1 c.37.1.8 (B:6-304) Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1xpua3 c.37.1.11 (A:129-417) Transcription termination factor Rho, ATPase domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|