Citrus Sinensis ID: 037525


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180--
VIILVGSSASAVDICRDLAGVAKEVHLVSRSVADGTYEKQPGFDNMWLHSMIESAHDNGAVVFRNGHTVHADVILHCTGYKYHFPFLETNGIVTMDDNRVGPLYKHVFPPVLAPWLSFVGLPWKVIPFPLCEYQSKWIAGVLSGQIVLPSQEEMMEDTKAFYSTLEASGTPKRYTHNMGDYQ
cEEEEcccccHHHHHHHHHHHccEEEEEEEEcccccccccccccccEEEccEEEEEcccEEEEEcccEEEccEEEEccccccccccccccccEEcccccccccccccccccccccEEEEcccccccccHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHcccccccEEcccccc
cEEEEEccccHHHHHHHHHHHHHHHHHHcccccccccccccccccEEEcccEEEEccccEEEEEcccEEEEEEEEEEcccEEEccccccccEEEEEcccccccHHccccccccccEEEEEcccccccHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHcccccccEccccccc
VIILVGSSASAVDICRDLAGVAKEVHLVSRsvadgtyekqpgfdnmWLHSMIESAHDNGAVVFRNGHTVHADVILHctgykyhfpfletngivtmddnrvgplykhvfppvlapwlsfvglpwkvipfplceyqskWIAGVLsgqivlpsqeemMEDTKAFYSTleasgtpkrythnmgdyq
viilvgssasavDICRDLAGVAKEVHlvsrsvadgtyeKQPGFDNMWLHSMIESAHDNGAVVFRNGHTVHADVILHCTGYKYHFPFLETNGIVTMDDNRVGPLYKHVFPPVLAPWLSFVGLPWKVIPFPLCEYQSKWIAGVLSGQIVLPSQEEMMEDTKAFYStleasgtpkrythnmgdyq
VIILVGSSASAVDICRDLAGVAKEVHLVSRSVADGTYEKQPGFDNMWLHSMIESAHDNGAVVFRNGHTVHADVILHCTGYKYHFPFLETNGIVTMDDNRVGPLYKHVFPPVLAPWLSFVGLPWKVIPFPLCEYQSKWIAGVLSGQIVLPSQEEMMEDTKAFYSTLEASGTPKRYTHNMGDYQ
*IILVGSSASAVDICRDLAGVAKEVHLVSRSVADGTYEKQPGFDNMWLHSMIESAHDNGAVVFRNGHTVHADVILHCTGYKYHFPFLETNGIVTMDDNRVGPLYKHVFPPVLAPWLSFVGLPWKVIPFPLCEYQSKWIAGVLSGQIVLP*********************************
VIILVGSSASAVDICRDLAGVAKEVHLVSRSVADGTYEKQPGFDNMWLHSMIESAHDNGAVVFRNGHTVHADVILHCTGYKYHFPFLETNGIVTMDDNRVGPLYKHVFPPVLAPWLSFVGLPWKVIPFPLCEYQSKWIAGVLSGQIVLPSQEEMMEDTKAFYSTLEASGTPKRYTHNMG*Y*
VIILVGSSASAVDICRDLAGVAKEVHLVSRSVADGTYEKQPGFDNMWLHSMIESAHDNGAVVFRNGHTVHADVILHCTGYKYHFPFLETNGIVTMDDNRVGPLYKHVFPPVLAPWLSFVGLPWKVIPFPLCEYQSKWIAGVLSGQIVLPSQEEMMEDTKAFYSTLEASGTPKRYTHNMGDYQ
VIILVGSSASAVDICRDLAGVAKEVHLVSRSVADGTYEKQPGFDNMWLHSMIESAHDNGAVVFRNGHTVHADVILHCTGYKYHFPFLETNGIVTMDDNRVGPLYKHVFPPVLAPWLSFVGLPWKVIPFPLCEYQSKWIAGVLSGQIVLPSQEEMMEDTKAFYSTLEASGTPKRYTH******
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
VIILVGSSASAVDICRDLAGVAKEVHLVSRSVADGTYEKQPGFDNMWLHSMIESAHDNGAVVFRNGHTVHADVILHCTGYKYHFPFLETNGIVTMDDNRVGPLYKHVFPPVLAPWLSFVGLPWKVIPFPLCEYQSKWIAGVLSGQIVLPSQEEMMEDTKAFYSTLEASGTPKRYTHNMGDYQ
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query182 2.2.26 [Sep-21-2011]
Q9FWW9465 Flavin-containing monooxy yes no 0.989 0.387 0.694 2e-74
Q9SXD5450 Flavin-containing monooxy no no 1.0 0.404 0.664 6e-73
Q9C8U0450 Flavin-containing monooxy no no 1.0 0.404 0.664 1e-72
Q94BV5452 Flavin-containing monooxy no no 1.0 0.402 0.681 2e-72
A8MRX0459 Flavin-containing monooxy no no 1.0 0.396 0.609 1e-65
Q9SXD9464 Flavin-containing monooxy no no 0.917 0.359 0.678 1e-65
Q93Y23461 Flavin-containing monooxy no no 1.0 0.394 0.573 6e-60
Q9C8T8448 Putative flavin-containin no no 0.879 0.357 0.605 6e-58
Q9SS04459 Flavin-containing monooxy no no 0.983 0.389 0.561 1e-57
Q9SXE1462 Flavin-containing monooxy no no 1.0 0.393 0.551 3e-56
>sp|Q9FWW9|GSXL2_ARATH Flavin-containing monooxygenase FMO GS-OX-like 2 OS=Arabidopsis thaliana GN=At1g12200 PE=2 SV=1 Back     alignment and function desciption
 Score =  277 bits (709), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 125/180 (69%), Positives = 152/180 (84%)

Query: 1   VIILVGSSASAVDICRDLAGVAKEVHLVSRSVADGTYEKQPGFDNMWLHSMIESAHDNGA 60
           V+I++GSSAS VDICRD+A VAKEVH+ SRS +  TYEK  G++N+WLHS I+ A ++G+
Sbjct: 212 VVIVIGSSASGVDICRDIAQVAKEVHVSSRSTSPDTYEKLTGYENLWLHSTIQIAREDGS 271

Query: 61  VVFRNGHTVHADVILHCTGYKYHFPFLETNGIVTMDDNRVGPLYKHVFPPVLAPWLSFVG 120
           VVF NG T++AD I+HCTGYKY+FPFL+T G VT+DDNRVGPLYKHVFPP LAP LSF+G
Sbjct: 272 VVFENGKTIYADTIMHCTGYKYYFPFLDTKGEVTVDDNRVGPLYKHVFPPALAPSLSFIG 331

Query: 121 LPWKVIPFPLCEYQSKWIAGVLSGQIVLPSQEEMMEDTKAFYSTLEASGTPKRYTHNMGD 180
           LPW++ PFP+ E QSKW+A VLSG++ LPSQ+EMMEDTKAFY  LEASG PKRYTH M D
Sbjct: 332 LPWQITPFPMFELQSKWVAAVLSGRVSLPSQDEMMEDTKAFYDKLEASGIPKRYTHLMPD 391




Catalyzes the conversion of methylthioalkyl glucosinolates of any chain length into methylsulfinylalkyl glucosinolates.
Arabidopsis thaliana (taxid: 3702)
EC: 1EC: .EC: 8EC: .EC: -EC: .EC: -
>sp|Q9SXD5|GSXL3_ARATH Flavin-containing monooxygenase FMO GS-OX-like 3 OS=Arabidopsis thaliana GN=At1g62620 PE=2 SV=2 Back     alignment and function description
>sp|Q9C8U0|GSXL5_ARATH Flavin-containing monooxygenase FMO GS-OX-like 5 OS=Arabidopsis thaliana GN=At1g63370 PE=2 SV=2 Back     alignment and function description
>sp|Q94BV5|GSXL4_ARATH Flavin-containing monooxygenase FMO GS-OX-like 4 OS=Arabidopsis thaliana GN=At1g62600 PE=2 SV=1 Back     alignment and function description
>sp|A8MRX0|GSOX5_ARATH Flavin-containing monooxygenase FMO GS-OX5 OS=Arabidopsis thaliana GN=FMOGS-OX5 PE=2 SV=2 Back     alignment and function description
>sp|Q9SXD9|GSXL7_ARATH Flavin-containing monooxygenase FMO GS-OX-like 7 OS=Arabidopsis thaliana GN=At1g62580 PE=2 SV=2 Back     alignment and function description
>sp|Q93Y23|GSOX4_ARATH Flavin-containing monooxygenase FMO GS-OX4 OS=Arabidopsis thaliana GN=FMOGS-OX4 PE=2 SV=1 Back     alignment and function description
>sp|Q9C8T8|GSXLX_ARATH Putative flavin-containing monooxygenase FMO GS-OX-like 10 OS=Arabidopsis thaliana GN=At1g63340 PE=5 SV=3 Back     alignment and function description
>sp|Q9SS04|GSOX1_ARATH Flavin-containing monooxygenase FMO GS-OX1 OS=Arabidopsis thaliana GN=FMOGS-OX1 PE=2 SV=1 Back     alignment and function description
>sp|Q9SXE1|GSOX3_ARATH Flavin-containing monooxygenase FMO GS-OX3 OS=Arabidopsis thaliana GN=FMOGS-OX3 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query182
224125168 459 predicted protein [Populus trichocarpa] 1.0 0.396 0.774 3e-81
255577823 423 dimethylaniline monooxygenase, putative 0.978 0.420 0.764 6e-79
255577829 510 dimethylaniline monooxygenase, putative 1.0 0.356 0.730 2e-78
255638856257 unknown [Glycine max] 1.0 0.708 0.725 3e-74
356540456 448 PREDICTED: flavin-containing monooxygena 1.0 0.406 0.725 4e-74
356540458 460 PREDICTED: flavin-containing monooxygena 1.0 0.395 0.725 6e-74
224125164 452 predicted protein [Populus trichocarpa] 0.989 0.398 0.7 6e-73
255577827 374 dimethylaniline monooxygenase, putative 0.978 0.475 0.730 7e-73
169647195 361 hypothetical protein AP5_G04.1 [Arabidop 0.989 0.498 0.705 7e-73
357481971 471 Flavin-containing monooxygenase FMO GS-O 0.983 0.380 0.715 1e-72
>gi|224125168|ref|XP_002329910.1| predicted protein [Populus trichocarpa] gi|222871147|gb|EEF08278.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  305 bits (782), Expect = 3e-81,   Method: Compositional matrix adjust.
 Identities = 141/182 (77%), Positives = 159/182 (87%)

Query: 1   VIILVGSSASAVDICRDLAGVAKEVHLVSRSVADGTYEKQPGFDNMWLHSMIESAHDNGA 60
           V IL+GSSAS+ DI R++AGVAKEVH+ SRSVAD TY++QPG+DNMWLHSMIES HD+G+
Sbjct: 219 VAILIGSSASSDDISREIAGVAKEVHVASRSVADETYQEQPGYDNMWLHSMIESVHDDGS 278

Query: 61  VVFRNGHTVHADVILHCTGYKYHFPFLETNGIVTMDDNRVGPLYKHVFPPVLAPWLSFVG 120
           V+FRNG  V AD+ILHCTGYKYHFPFL+TNGIVTMD+NRV PLYK VFPPVLAPWLSFVG
Sbjct: 279 VIFRNGRVVVADIILHCTGYKYHFPFLDTNGIVTMDENRVAPLYKQVFPPVLAPWLSFVG 338

Query: 121 LPWKVIPFPLCEYQSKWIAGVLSGQIVLPSQEEMMEDTKAFYSTLEASGTPKRYTHNMGD 180
           LPWKV+PFPL E Q+KWIAGVLSG I LPS EEMMED KAFY TLE+S  PK YTHN+G 
Sbjct: 339 LPWKVVPFPLVELQTKWIAGVLSGHIALPSPEEMMEDVKAFYETLESSNKPKHYTHNLGG 398

Query: 181 YQ 182
            Q
Sbjct: 399 CQ 400




Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|255577823|ref|XP_002529785.1| dimethylaniline monooxygenase, putative [Ricinus communis] gi|223530729|gb|EEF32599.1| dimethylaniline monooxygenase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|255577829|ref|XP_002529788.1| dimethylaniline monooxygenase, putative [Ricinus communis] gi|223530732|gb|EEF32602.1| dimethylaniline monooxygenase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|255638856|gb|ACU19731.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|356540456|ref|XP_003538705.1| PREDICTED: flavin-containing monooxygenase FMO GS-OX-like 3-like isoform 1 [Glycine max] Back     alignment and taxonomy information
>gi|356540458|ref|XP_003538706.1| PREDICTED: flavin-containing monooxygenase FMO GS-OX-like 3-like isoform 2 [Glycine max] Back     alignment and taxonomy information
>gi|224125164|ref|XP_002329909.1| predicted protein [Populus trichocarpa] gi|222871146|gb|EEF08277.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255577827|ref|XP_002529787.1| dimethylaniline monooxygenase, putative [Ricinus communis] gi|223530731|gb|EEF32601.1| dimethylaniline monooxygenase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|169647195|gb|ACA61617.1| hypothetical protein AP5_G04.1 [Arabidopsis lyrata subsp. petraea] Back     alignment and taxonomy information
>gi|357481971|ref|XP_003611271.1| Flavin-containing monooxygenase FMO GS-OX5 [Medicago truncatula] gi|355512606|gb|AES94229.1| Flavin-containing monooxygenase FMO GS-OX5 [Medicago truncatula] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query182
TAIR|locus:2201991465 FMO "AT1G12200" [Arabidopsis t 0.989 0.387 0.694 1.8e-69
TAIR|locus:2203866450 AT1G62620 "AT1G62620" [Arabido 1.0 0.404 0.664 1.3e-68
TAIR|locus:2031336450 AT1G63370 "AT1G63370" [Arabido 1.0 0.404 0.664 3.5e-68
TAIR|locus:2203921452 AT1G62600 "AT1G62600" [Arabido 0.983 0.396 0.687 4.4e-68
TAIR|locus:2203911464 NOGC1 "AT1G62580" [Arabidopsis 0.983 0.385 0.666 9.4e-66
TAIR|locus:2201971459 FMO GS-OX5 "flavin-monooxygena 1.0 0.396 0.609 2.3e-62
TAIR|locus:2203901461 FMO GS-OX4 "AT1G62570" [Arabid 1.0 0.394 0.573 2.8e-57
TAIR|locus:2009754459 FMO GS-OX1 "AT1G65860" [Arabid 0.983 0.389 0.561 3.7e-55
TAIR|locus:2203891462 FMO GS-OX3 "AT1G62560" [Arabid 1.0 0.393 0.551 1.5e-53
TAIR|locus:2203871457 FMO GS-OX2 "AT1G62540" [Arabid 1.0 0.398 0.551 2.4e-53
TAIR|locus:2201991 FMO "AT1G12200" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 704 (252.9 bits), Expect = 1.8e-69, P = 1.8e-69
 Identities = 125/180 (69%), Positives = 152/180 (84%)

Query:     1 VIILVGSSASAVDICRDLAGVAKEVHLVSRSVADGTYEKQPGFDNMWLHSMIESAHDNGA 60
             V+I++GSSAS VDICRD+A VAKEVH+ SRS +  TYEK  G++N+WLHS I+ A ++G+
Sbjct:   212 VVIVIGSSASGVDICRDIAQVAKEVHVSSRSTSPDTYEKLTGYENLWLHSTIQIAREDGS 271

Query:    61 VVFRNGHTVHADVILHCTGYKYHFPFLETNGIVTMDDNRVGPLYKHVFPPVLAPWLSFVG 120
             VVF NG T++AD I+HCTGYKY+FPFL+T G VT+DDNRVGPLYKHVFPP LAP LSF+G
Sbjct:   272 VVFENGKTIYADTIMHCTGYKYYFPFLDTKGEVTVDDNRVGPLYKHVFPPALAPSLSFIG 331

Query:   121 LPWKVIPFPLCEYQSKWIAGVLSGQIVLPSQEEMMEDTKAFYSTLEASGTPKRYTHNMGD 180
             LPW++ PFP+ E QSKW+A VLSG++ LPSQ+EMMEDTKAFY  LEASG PKRYTH M D
Sbjct:   332 LPWQITPFPMFELQSKWVAAVLSGRVSLPSQDEMMEDTKAFYDKLEASGIPKRYTHLMPD 391




GO:0004497 "monooxygenase activity" evidence=ISS
GO:0004499 "N,N-dimethylaniline monooxygenase activity" evidence=IEA
GO:0005634 "nucleus" evidence=ISM
GO:0050660 "flavin adenine dinucleotide binding" evidence=IEA
GO:0050661 "NADP binding" evidence=IEA
GO:0055114 "oxidation-reduction process" evidence=IEA
GO:0050832 "defense response to fungus" evidence=IEP
TAIR|locus:2203866 AT1G62620 "AT1G62620" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2031336 AT1G63370 "AT1G63370" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2203921 AT1G62600 "AT1G62600" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2203911 NOGC1 "AT1G62580" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2201971 FMO GS-OX5 "flavin-monooxygenase glucosinolate S-oxygenase 5" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2203901 FMO GS-OX4 "AT1G62570" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2009754 FMO GS-OX1 "AT1G65860" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2203891 FMO GS-OX3 "AT1G62560" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2203871 FMO GS-OX2 "AT1G62540" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query182
PLN02172461 PLN02172, PLN02172, flavin-containing monooxygenas 5e-90
pfam00743532 pfam00743, FMO-like, Flavin-binding monooxygenase- 1e-15
COG2072443 COG2072, TrkA, Predicted flavoprotein involved in 3e-04
TIGR04018316 TIGR04018, Bthiol_YpdA, putative bacillithiol syst 0.001
>gnl|CDD|215116 PLN02172, PLN02172, flavin-containing monooxygenase FMO GS-OX Back     alignment and domain information
 Score =  270 bits (691), Expect = 5e-90
 Identities = 109/183 (59%), Positives = 144/183 (78%), Gaps = 1/183 (0%)

Query: 1   VIILVGSSASAVDICRDLAGVAKEVHLVSRSVADGTYEKQP-GFDNMWLHSMIESAHDNG 59
           V++++G+ AS  DI RD+A VAKEVH+ SR+    TYEK P   +N+W+HS I++AH++G
Sbjct: 206 VVVVIGNFASGADISRDIAKVAKEVHIASRASESDTYEKLPVPQNNLWMHSEIDTAHEDG 265

Query: 60  AVVFRNGHTVHADVILHCTGYKYHFPFLETNGIVTMDDNRVGPLYKHVFPPVLAPWLSFV 119
           ++VF+NG  V+AD I+HCTGYKYHFPFLETNG + +D+NRV PLYKHVFPP LAP LSF+
Sbjct: 266 SIVFKNGKVVYADTIVHCTGYKYHFPFLETNGYMRIDENRVEPLYKHVFPPALAPGLSFI 325

Query: 120 GLPWKVIPFPLCEYQSKWIAGVLSGQIVLPSQEEMMEDTKAFYSTLEASGTPKRYTHNMG 179
           GLP   I F + E QSKW+A VLSG++ LPS+++MMED  A+Y++LEA G PKRYTH +G
Sbjct: 326 GLPAMGIQFVMFEIQSKWVAAVLSGRVTLPSEDKMMEDINAWYASLEALGIPKRYTHKLG 385

Query: 180 DYQ 182
             Q
Sbjct: 386 KIQ 388


Length = 461

>gnl|CDD|109787 pfam00743, FMO-like, Flavin-binding monooxygenase-like Back     alignment and domain information
>gnl|CDD|224983 COG2072, TrkA, Predicted flavoprotein involved in K+ transport [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|188533 TIGR04018, Bthiol_YpdA, putative bacillithiol system oxidoreductase, YpdA family Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 182
PLN02172461 flavin-containing monooxygenase FMO GS-OX 100.0
PF00743531 FMO-like: Flavin-binding monooxygenase-like; Inter 100.0
KOG1399448 consensus Flavin-containing monooxygenase [Seconda 99.92
COG1252405 Ndh NADH dehydrogenase, FAD-containing subunit [En 99.59
PTZ00318424 NADH dehydrogenase-like protein; Provisional 99.5
PRK13512438 coenzyme A disulfide reductase; Provisional 99.46
PRK07846451 mycothione reductase; Reviewed 99.45
TIGR01421450 gluta_reduc_1 glutathione-disulfide reductase, ani 99.43
PRK04965377 NADH:flavorubredoxin oxidoreductase; Provisional 99.42
PLN02507499 glutathione reductase 99.42
TIGR03385427 CoA_CoA_reduc CoA-disulfide reductase. Members of 99.4
TIGR01292300 TRX_reduct thioredoxin-disulfide reductase. This m 99.38
TIGR03452452 mycothione_red mycothione reductase. Mycothiol, a 99.38
PRK06116450 glutathione reductase; Validated 99.37
COG0492305 TrxB Thioredoxin reductase [Posttranslational modi 99.35
TIGR01423486 trypano_reduc trypanothione-disulfide reductase. T 99.35
TIGR02374 785 nitri_red_nirB nitrite reductase [NAD(P)H], large 99.35
PRK06416462 dihydrolipoamide dehydrogenase; Reviewed 99.34
PTZ00052 499 thioredoxin reductase; Provisional 99.34
PRK07845466 flavoprotein disulfide reductase; Reviewed 99.34
TIGR01424446 gluta_reduc_2 glutathione-disulfide reductase, pla 99.33
PRK09754396 phenylpropionate dioxygenase ferredoxin reductase 99.33
PRK05249461 soluble pyridine nucleotide transhydrogenase; Prov 99.33
PRK07818466 dihydrolipoamide dehydrogenase; Reviewed 99.32
TIGR01438 484 TGR thioredoxin and glutathione reductase selenopr 99.3
PRK10262321 thioredoxin reductase; Provisional 99.29
PRK11749457 dihydropyrimidine dehydrogenase subunit A; Provisi 99.27
COG1249454 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, 99.27
PRK06115466 dihydrolipoamide dehydrogenase; Reviewed 99.26
PRK06370463 mercuric reductase; Validated 99.26
PRK09564444 coenzyme A disulfide reductase; Reviewed 99.26
PRK14989 847 nitrite reductase subunit NirD; Provisional 99.25
TIGR02053463 MerA mercuric reductase. This model represents the 99.24
PRK06292460 dihydrolipoamide dehydrogenase; Validated 99.24
PLN02546 558 glutathione reductase 99.24
PRK12831464 putative oxidoreductase; Provisional 99.24
PTZ00153 659 lipoamide dehydrogenase; Provisional 99.23
PRK06327475 dihydrolipoamide dehydrogenase; Validated 99.23
PRK13748561 putative mercuric reductase; Provisional 99.22
PRK06467471 dihydrolipoamide dehydrogenase; Reviewed 99.22
TIGR01316449 gltA glutamate synthase (NADPH), homotetrameric. T 99.21
PTZ00058561 glutathione reductase; Provisional 99.21
TIGR03169364 Nterm_to_SelD pyridine nucleotide-disulfide oxidor 99.21
TIGR01350461 lipoamide_DH dihydrolipoamide dehydrogenase. The m 99.2
PRK09853 1019 putative selenate reductase subunit YgfK; Provisio 99.2
PRK05976472 dihydrolipoamide dehydrogenase; Validated 99.19
PRK14727479 putative mercuric reductase; Provisional 99.17
PRK06912458 acoL dihydrolipoamide dehydrogenase; Validated 99.17
PRK08010441 pyridine nucleotide-disulfide oxidoreductase; Prov 99.17
PRK14694468 putative mercuric reductase; Provisional 99.16
PRK07251438 pyridine nucleotide-disulfide oxidoreductase; Prov 99.16
KOG2495491 consensus NADH-dehydrogenase (ubiquinone) [Energy 99.14
TIGR03140515 AhpF alkyl hydroperoxide reductase, F subunit. Thi 99.12
PRK15317517 alkyl hydroperoxide reductase subunit F; Provision 99.12
PRK12770352 putative glutamate synthase subunit beta; Provisio 99.1
PRK12814 652 putative NADPH-dependent glutamate synthase small 99.08
TIGR03315 1012 Se_ygfK putative selenate reductase, YgfK subunit. 99.08
PRK12778752 putative bifunctional 2-polyprenylphenol hydroxyla 99.06
PRK12779 944 putative bifunctional glutamate synthase subunit b 99.0
KOG0404322 consensus Thioredoxin reductase [Posttranslational 99.0
TIGR03143 555 AhpF_homolog putative alkyl hydroperoxide reductas 98.97
PRK12810471 gltD glutamate synthase subunit beta; Reviewed 98.96
PRK12775 1006 putative trifunctional 2-polyprenylphenol hydroxyl 98.93
COG2072443 TrkA Predicted flavoprotein involved in K+ transpo 98.92
PRK12769654 putative oxidoreductase Fe-S binding subunit; Revi 98.9
TIGR01318467 gltD_gamma_fam glutamate synthase small subunit fa 98.88
TIGR01317485 GOGAT_sm_gam glutamate synthases, NADH/NADPH, smal 98.87
PRK12771564 putative glutamate synthase (NADPH) small subunit; 98.87
PRK13984604 putative oxidoreductase; Provisional 98.85
COG3634520 AhpF Alkyl hydroperoxide reductase, large subunit 98.79
PRK12809639 putative oxidoreductase Fe-S binding subunit; Revi 98.69
KOG0405478 consensus Pyridine nucleotide-disulphide oxidoredu 98.68
COG1251 793 NirB NAD(P)H-nitrite reductase [Energy production 98.65
KOG1336478 consensus Monodehydroascorbate/ferredoxin reductas 98.64
PF0007080 Pyr_redox: Pyridine nucleotide-disulphide oxidored 98.63
TIGR01292300 TRX_reduct thioredoxin-disulfide reductase. This m 98.49
PF13434341 K_oxygenase: L-lysine 6-monooxygenase (NADPH-requi 98.48
TIGR01372 985 soxA sarcosine oxidase, alpha subunit family, hete 98.47
TIGR03169 364 Nterm_to_SelD pyridine nucleotide-disulfide oxidor 98.26
COG0446415 HcaD Uncharacterized NAD(FAD)-dependent dehydrogen 98.22
PTZ00318 424 NADH dehydrogenase-like protein; Provisional 98.21
PRK09754 396 phenylpropionate dioxygenase ferredoxin reductase 98.19
COG3486436 IucD Lysine/ornithine N-monooxygenase [Secondary m 98.15
PRK09564 444 coenzyme A disulfide reductase; Reviewed 98.14
PLN02852 491 ferredoxin-NADP+ reductase 98.06
PRK04965 377 NADH:flavorubredoxin oxidoreductase; Provisional 98.06
COG1252 405 Ndh NADH dehydrogenase, FAD-containing subunit [En 98.05
PRK13512 438 coenzyme A disulfide reductase; Provisional 98.04
PRK07251 438 pyridine nucleotide-disulfide oxidoreductase; Prov 97.92
TIGR03140515 AhpF alkyl hydroperoxide reductase, F subunit. Thi 97.92
PRK15317517 alkyl hydroperoxide reductase subunit F; Provision 97.9
TIGR02374 785 nitri_red_nirB nitrite reductase [NAD(P)H], large 97.87
PRK06116 450 glutathione reductase; Validated 97.84
PF01134 392 GIDA: Glucose inhibited division protein A; InterP 97.8
PRK14989 847 nitrite reductase subunit NirD; Provisional 97.8
TIGR01789 370 lycopene_cycl lycopene cyclase. This model represe 97.78
COG2072 443 TrkA Predicted flavoprotein involved in K+ transpo 97.76
PRK08010 441 pyridine nucleotide-disulfide oxidoreductase; Prov 97.75
TIGR01421 450 gluta_reduc_1 glutathione-disulfide reductase, ani 97.75
TIGR01424 446 gluta_reduc_2 glutathione-disulfide reductase, pla 97.75
PRK10262 321 thioredoxin reductase; Provisional 97.73
COG2081 408 Predicted flavoproteins [General function predicti 97.67
KOG1335506 consensus Dihydrolipoamide dehydrogenase [Energy p 97.66
PF13738203 Pyr_redox_3: Pyridine nucleotide-disulphide oxidor 97.66
PRK14694 468 putative mercuric reductase; Provisional 97.61
PRK06370 463 mercuric reductase; Validated 97.61
COG0492305 TrxB Thioredoxin reductase [Posttranslational modi 97.58
PTZ00058 561 glutathione reductase; Provisional 97.56
PRK05249 461 soluble pyridine nucleotide transhydrogenase; Prov 97.54
PRK12779 944 putative bifunctional glutamate synthase subunit b 97.54
PLN02463 447 lycopene beta cyclase 97.54
PLN02172 461 flavin-containing monooxygenase FMO GS-OX 97.54
KOG3851 446 consensus Sulfide:quinone oxidoreductase/flavo-bin 97.54
PRK06753 373 hypothetical protein; Provisional 97.53
PRK06847 375 hypothetical protein; Provisional 97.51
PRK06467 471 dihydrolipoamide dehydrogenase; Reviewed 97.5
PRK07236 386 hypothetical protein; Provisional 97.46
KOG1346 659 consensus Programmed cell death 8 (apoptosis-induc 97.46
PF05834 374 Lycopene_cycl: Lycopene cyclase protein; InterPro: 97.45
PRK09853 1019 putative selenate reductase subunit YgfK; Provisio 97.43
TIGR02053 463 MerA mercuric reductase. This model represents the 97.42
PLN02852 491 ferredoxin-NADP+ reductase 97.41
TIGR03143 555 AhpF_homolog putative alkyl hydroperoxide reductas 97.4
PLN02546 558 glutathione reductase 97.37
PF03486 409 HI0933_like: HI0933-like protein; InterPro: IPR004 97.36
PRK07588 391 hypothetical protein; Provisional 97.33
PRK05868 372 hypothetical protein; Validated 97.29
PRK06115 466 dihydrolipoamide dehydrogenase; Reviewed 97.29
TIGR01350 461 lipoamide_DH dihydrolipoamide dehydrogenase. The m 97.28
PF00743 531 FMO-like: Flavin-binding monooxygenase-like; Inter 97.28
PLN02507 499 glutathione reductase 97.26
PRK05976 472 dihydrolipoamide dehydrogenase; Validated 97.24
TIGR03219 414 salicylate_mono salicylate 1-monooxygenase. Member 97.2
PRK06416 462 dihydrolipoamide dehydrogenase; Reviewed 97.19
KOG4716 503 consensus Thioredoxin reductase [Posttranslational 97.18
PRK11749 457 dihydropyrimidine dehydrogenase subunit A; Provisi 97.14
PRK06912 458 acoL dihydrolipoamide dehydrogenase; Validated 97.08
PTZ00052 499 thioredoxin reductase; Provisional 97.08
PRK07845 466 flavoprotein disulfide reductase; Reviewed 97.08
PRK13748 561 putative mercuric reductase; Provisional 97.07
TIGR01438 484 TGR thioredoxin and glutathione reductase selenopr 97.07
PRK12778 752 putative bifunctional 2-polyprenylphenol hydroxyla 97.05
COG1249 454 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, 97.05
PRK07818 466 dihydrolipoamide dehydrogenase; Reviewed 97.04
PRK06292 460 dihydrolipoamide dehydrogenase; Validated 97.04
KOG1399 448 consensus Flavin-containing monooxygenase [Seconda 97.02
TIGR03315 1012 Se_ygfK putative selenate reductase, YgfK subunit. 97.02
TIGR01423 486 trypano_reduc trypanothione-disulfide reductase. T 97.02
PRK14727 479 putative mercuric reductase; Provisional 97.01
PRK07846 451 mycothione reductase; Reviewed 96.95
PRK06567 1028 putative bifunctional glutamate synthase subunit b 96.88
PRK12775 1006 putative trifunctional 2-polyprenylphenol hydroxyl 96.85
TIGR01372 985 soxA sarcosine oxidase, alpha subunit family, hete 96.84
PLN02697 529 lycopene epsilon cyclase 96.83
PRK06567 1028 putative bifunctional glutamate synthase subunit b 96.82
PRK01438 480 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 96.76
PRK06327 475 dihydrolipoamide dehydrogenase; Validated 96.66
PF1345068 NAD_binding_8: NAD(P)-binding Rossmann-like domain 96.65
KOG1336 478 consensus Monodehydroascorbate/ferredoxin reductas 96.51
TIGR03452 452 mycothione_red mycothione reductase. Mycothiol, a 96.51
COG0445 621 GidA Flavin-dependent tRNA uridine 5-carboxymethyl 96.43
TIGR00137 433 gid_trmFO tRNA:m(5)U-54 methyltransferase. This mo 96.38
COG1635262 THI4 Ribulose 1,5-bisphosphate synthetase, convert 96.37
KOG2755 334 consensus Oxidoreductase [General function predict 96.36
PRK05335 436 tRNA (uracil-5-)-methyltransferase Gid; Reviewed 96.35
PF01494 356 FAD_binding_3: FAD binding domain; InterPro: IPR00 96.33
PF07992201 Pyr_redox_2: Pyridine nucleotide-disulphide oxidor 96.31
TIGR02032 295 GG-red-SF geranylgeranyl reductase family. This mo 96.19
KOG2311 679 consensus NAD/FAD-utilizing protein possibly invol 96.16
PTZ00153 659 lipoamide dehydrogenase; Provisional 96.15
COG1148 622 HdrA Heterodisulfide reductase, subunit A and rela 96.04
PF01946230 Thi4: Thi4 family; PDB: 1RP0_A 3FPZ_B 3JSK_K. 96.0
PRK11259 376 solA N-methyltryptophan oxidase; Provisional 95.93
PRK07233 434 hypothetical protein; Provisional 95.92
PRK07364 415 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 95.91
PRK04176257 ribulose-1,5-biphosphate synthetase; Provisional 95.88
PRK08773 392 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 95.83
TIGR00292254 thiazole biosynthesis enzyme. This enzyme is invol 95.81
TIGR02028 398 ChlP geranylgeranyl reductase. This model represen 95.8
PRK09126 392 hypothetical protein; Provisional 95.76
PF01266 358 DAO: FAD dependent oxidoreductase; InterPro: IPR00 95.75
TIGR01988 385 Ubi-OHases Ubiquinone biosynthesis hydroxylase, Ub 95.74
PRK12409 410 D-amino acid dehydrogenase small subunit; Provisio 95.72
TIGR01377 380 soxA_mon sarcosine oxidase, monomeric form. Sarcos 95.71
TIGR01984 382 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase. T 95.69
PRK05192 618 tRNA uridine 5-carboxymethylaminomethyl modificati 95.68
PRK08244 493 hypothetical protein; Provisional 95.67
PRK07608 388 ubiquinone biosynthesis hydroxylase family protein 95.66
PRK06184 502 hypothetical protein; Provisional 95.65
TIGR02023 388 BchP-ChlP geranylgeranyl reductase. This model rep 95.63
PRK07494 388 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio 95.63
COG3634520 AhpF Alkyl hydroperoxide reductase, large subunit 95.61
PRK07045 388 putative monooxygenase; Reviewed 95.61
PRK08013 400 oxidoreductase; Provisional 95.57
KOG0399 2142 consensus Glutamate synthase [Amino acid transport 95.55
PRK12266 508 glpD glycerol-3-phosphate dehydrogenase; Reviewed 95.55
COG0562 374 Glf UDP-galactopyranose mutase [Cell envelope biog 95.53
PRK11728 393 hydroxyglutarate oxidase; Provisional 95.49
PRK12770 352 putative glutamate synthase subunit beta; Provisio 95.48
PRK08163 396 salicylate hydroxylase; Provisional 95.48
PRK10157 428 putative oxidoreductase FixC; Provisional 95.44
PTZ00188 506 adrenodoxin reductase; Provisional 95.42
PLN00093 450 geranylgeranyl diphosphate reductase; Provisional 95.41
PRK10015 429 oxidoreductase; Provisional 95.41
TIGR01790 388 carotene-cycl lycopene cyclase family protein. Thi 95.39
PRK06185 407 hypothetical protein; Provisional 95.39
PRK05714 405 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 95.38
PRK06126 545 hypothetical protein; Provisional 95.37
KOG0404 322 consensus Thioredoxin reductase [Posttranslational 95.35
PF12831 428 FAD_oxidored: FAD dependent oxidoreductase; PDB: 3 95.34
PRK08020 391 ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquin 95.31
PRK00711 416 D-amino acid dehydrogenase small subunit; Validate 95.31
PRK06475 400 salicylate hydroxylase; Provisional 95.27
TIGR00031 377 UDP-GALP_mutase UDP-galactopyranose mutase. The ge 95.26
PRK13369 502 glycerol-3-phosphate dehydrogenase; Provisional 95.25
PRK06617 374 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 95.24
COG0644 396 FixC Dehydrogenases (flavoproteins) [Energy produc 95.23
KOG03992142 consensus Glutamate synthase [Amino acid transport 95.22
PRK11101 546 glpA sn-glycerol-3-phosphate dehydrogenase subunit 95.21
TIGR03364 365 HpnW_proposed FAD dependent oxidoreductase TIGR033 95.19
PRK12810 471 gltD glutamate synthase subunit beta; Reviewed 95.18
COG0654 387 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and 95.18
PRK11445 351 putative oxidoreductase; Provisional 95.18
PF13241103 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_ 95.14
PRK08849 384 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 95.12
PRK08243 392 4-hydroxybenzoate 3-monooxygenase; Validated 95.11
PRK11883 451 protoporphyrinogen oxidase; Reviewed 95.1
PRK12831 464 putative oxidoreductase; Provisional 95.1
PRK08850 405 2-octaprenyl-6-methoxyphenol hydroxylase; Validate 95.1
KOG1800 468 consensus Ferredoxin/adrenodoxin reductase [Nucleo 95.08
TIGR01316 449 gltA glutamate synthase (NADPH), homotetrameric. T 95.08
PRK07333 403 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio 95.05
PRK06834 488 hypothetical protein; Provisional 95.02
PRK05732 395 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 95.0
PRK07190 487 hypothetical protein; Provisional 95.0
TIGR02360 390 pbenz_hydroxyl 4-hydroxybenzoate 3-monooxygenase. 94.99
PRK08132 547 FAD-dependent oxidoreductase; Provisional 94.98
TIGR02731 453 phytoene_desat phytoene desaturase. Plants and cya 94.94
TIGR01989 437 COQ6 Ubiquinone biosynthesis mono0xygenase COQ6. T 94.93
PRK07538 413 hypothetical protein; Provisional 94.89
PLN02268 435 probable polyamine oxidase 94.88
PRK06183 538 mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Va 94.87
PRK07208 479 hypothetical protein; Provisional 94.86
PLN02464 627 glycerol-3-phosphate dehydrogenase 94.86
PRK08294 634 phenol 2-monooxygenase; Provisional 94.84
PRK12769 654 putative oxidoreductase Fe-S binding subunit; Revi 94.76
PF00890 417 FAD_binding_2: FAD binding domain of the Pfam fami 94.68
TIGR00562 462 proto_IX_ox protoporphyrinogen oxidase. This prote 94.67
TIGR01318 467 gltD_gamma_fam glutamate synthase small subunit fa 94.59
KOG0029 501 consensus Amine oxidase [Secondary metabolites bio 94.55
TIGR01373 407 soxB sarcosine oxidase, beta subunit family, heter 94.54
COG0665 387 DadA Glycine/D-amino acid oxidases (deaminating) [ 94.52
PF01210157 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate 94.5
PF00732 296 GMC_oxred_N: GMC oxidoreductase; InterPro: IPR0001 94.47
PRK01747 662 mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltrans 94.46
TIGR02734 502 crtI_fam phytoene desaturase. Phytoene is converte 94.45
PLN02985 514 squalene monooxygenase 94.45
TIGR03329 460 Phn_aa_oxid putative aminophosphonate oxidoreducta 94.44
PRK12814 652 putative NADPH-dependent glutamate synthase small 94.4
COG1233 487 Phytoene dehydrogenase and related proteins [Secon 94.39
TIGR01470205 cysG_Nterm siroheme synthase, N-terminal domain. T 94.38
TIGR01813 439 flavo_cyto_c flavocytochrome c. This model describ 94.36
TIGR01317 485 GOGAT_sm_gam glutamate synthases, NADH/NADPH, smal 94.33
PF13434 341 K_oxygenase: L-lysine 6-monooxygenase (NADPH-requi 94.32
PRK08274 466 tricarballylate dehydrogenase; Validated 94.31
COG0578 532 GlpA Glycerol-3-phosphate dehydrogenase [Energy pr 94.29
PRK06996 398 hypothetical protein; Provisional 94.26
PLN02576 496 protoporphyrinogen oxidase 94.25
PRK12809 639 putative oxidoreductase Fe-S binding subunit; Revi 94.16
TIGR02733 492 desat_CrtD C-3',4' desaturase CrtD. Members of thi 94.15
PLN02927 668 antheraxanthin epoxidase/zeaxanthin epoxidase 94.02
TIGR01320 483 mal_quin_oxido malate:quinone-oxidoreductase. This 93.92
COG1251 793 NirB NAD(P)H-nitrite reductase [Energy production 93.91
PF02737180 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD bind 93.91
PTZ00188 506 adrenodoxin reductase; Provisional 93.85
PRK07121 492 hypothetical protein; Validated 93.81
PRK06719157 precorrin-2 dehydrogenase; Validated 93.78
TIGR02730 493 carot_isom carotene isomerase. Members of this fam 93.73
PRK12416 463 protoporphyrinogen oxidase; Provisional 93.63
COG3349 485 Uncharacterized conserved protein [Function unknow 93.62
PRK09897 534 hypothetical protein; Provisional 93.58
COG0446 415 HcaD Uncharacterized NAD(FAD)-dependent dehydrogen 93.47
PTZ00367 567 squalene epoxidase; Provisional 93.4
TIGR02732 474 zeta_caro_desat carotene 7,8-desaturase. Carotene 93.27
PRK08401 466 L-aspartate oxidase; Provisional 93.26
PF02558151 ApbA: Ketopantoate reductase PanE/ApbA; InterPro: 93.25
PRK12771 564 putative glutamate synthase (NADPH) small subunit; 93.23
PRK06481 506 fumarate reductase flavoprotein subunit; Validated 93.14
PRK06718202 precorrin-2 dehydrogenase; Reviewed 93.11
PTZ00383 497 malate:quinone oxidoreductase; Provisional 93.09
TIGR00136 617 gidA glucose-inhibited division protein A. GidA, t 93.08
TIGR01812 566 sdhA_frdA_Gneg succinate dehydrogenase or fumarate 93.01
PRK05257 494 malate:quinone oxidoreductase; Validated 92.94
PLN02661357 Putative thiazole synthesis 92.86
PRK12842 574 putative succinate dehydrogenase; Reviewed 92.85
COG0579 429 Predicted dehydrogenase [General function predicti 92.75
PF04820 454 Trp_halogenase: Tryptophan halogenase; InterPro: I 92.64
PRK12837 513 3-ketosteroid-delta-1-dehydrogenase; Provisional 92.63
PRK12834 549 putative FAD-binding dehydrogenase; Reviewed 92.6
KOG1298 509 consensus Squalene monooxygenase [Lipid transport 92.53
PLN02529 738 lysine-specific histone demethylase 1 92.51
PRK13339 497 malate:quinone oxidoreductase; Reviewed 92.38
PRK08255 765 salicylyl-CoA 5-hydroxylase; Reviewed 92.34
PLN02676 487 polyamine oxidase 92.31
COG4529 474 Uncharacterized protein conserved in bacteria [Fun 92.27
PLN02568 539 polyamine oxidase 92.26
PTZ00363 443 rab-GDP dissociation inhibitor; Provisional 92.26
PLN02487 569 zeta-carotene desaturase 92.21
PRK02106 560 choline dehydrogenase; Validated 92.14
PRK07804 541 L-aspartate oxidase; Provisional 92.07
PRK05562223 precorrin-2 dehydrogenase; Provisional 92.01
PRK07803 626 sdhA succinate dehydrogenase flavoprotein subunit; 91.99
PF01488135 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; 91.91
PRK12844 557 3-ketosteroid-delta-1-dehydrogenase; Reviewed 91.9
KOG1346 659 consensus Programmed cell death 8 (apoptosis-induc 91.84
PRK06854 608 adenylylsulfate reductase subunit alpha; Validated 91.84
PRK12835 584 3-ketosteroid-delta-1-dehydrogenase; Reviewed 91.84
PRK07057 591 sdhA succinate dehydrogenase flavoprotein subunit; 91.71
PRK08626 657 fumarate reductase flavoprotein subunit; Provision 91.7
PRK06452 566 sdhA succinate dehydrogenase flavoprotein subunit; 91.66
PLN02328 808 lysine-specific histone demethylase 1 homolog 91.65
PRK08641 589 sdhA succinate dehydrogenase flavoprotein subunit; 91.64
PRK09078 598 sdhA succinate dehydrogenase flavoprotein subunit; 91.58
PRK05329 422 anaerobic glycerol-3-phosphate dehydrogenase subun 91.52
COG0493457 GltD NADPH-dependent glutamate synthase beta chain 91.5
COG0493 457 GltD NADPH-dependent glutamate synthase beta chain 91.45
TIGR00551 488 nadB L-aspartate oxidase. L-aspartate oxidase is t 91.36
PRK06069 577 sdhA succinate dehydrogenase flavoprotein subunit; 91.36
TIGR00275 400 flavoprotein, HI0933 family. The model when search 91.32
PF13454156 NAD_binding_9: FAD-NAD(P)-binding 91.3
PRK07573 640 sdhA succinate dehydrogenase flavoprotein subunit; 91.18
PTZ00139 617 Succinate dehydrogenase [ubiquinone] flavoprotein 91.17
PRK04148134 hypothetical protein; Provisional 90.99
TIGR01811 603 sdhA_Bsu succinate dehydrogenase or fumarate reduc 90.93
PRK08275 554 putative oxidoreductase; Provisional 90.93
PLN02612 567 phytoene desaturase 90.9
PLN03000 881 amine oxidase 90.88
PRK07843 557 3-ketosteroid-delta-1-dehydrogenase; Reviewed 90.79
PRK06522 304 2-dehydropantoate 2-reductase; Reviewed 90.73
PRK13984 604 putative oxidoreductase; Provisional 90.69
PRK08958 588 sdhA succinate dehydrogenase flavoprotein subunit; 90.68
PRK06134 581 putative FAD-binding dehydrogenase; Reviewed 90.65
TIGR02462 544 pyranose_ox pyranose oxidase. Pyranose oxidase (al 90.63
TIGR01810 532 betA choline dehydrogenase. This enzyme is a membe 90.61
PRK07819286 3-hydroxybutyryl-CoA dehydrogenase; Validated 90.61
PLN00128 635 Succinate dehydrogenase [ubiquinone] flavoprotein 90.41
PRK08293 287 3-hydroxybutyryl-CoA dehydrogenase; Validated 90.38
COG1232 444 HemY Protoporphyrinogen oxidase [Coenzyme metaboli 90.38
cd0519186 NAD_bind_amino_acid_DH NAD(P) binding domain of am 90.32
PRK05329422 anaerobic glycerol-3-phosphate dehydrogenase subun 90.25
PRK05945 575 sdhA succinate dehydrogenase flavoprotein subunit; 90.24
PF13460183 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X 90.22
PRK14106 450 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 89.97
PRK02705 459 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 89.9
PRK05708 305 2-dehydropantoate 2-reductase; Provisional 89.89
TIGR02061 614 aprA adenosine phosphosulphate reductase, alpha su 89.8
PRK12921 305 2-dehydropantoate 2-reductase; Provisional 89.71
PRK08205 583 sdhA succinate dehydrogenase flavoprotein subunit; 89.63
COG3380 331 Predicted NAD/FAD-dependent oxidoreductase [Genera 89.61
PLN02815 594 L-aspartate oxidase 89.59
PF00899135 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-a 89.5
PF02254116 TrkA_N: TrkA-N domain; InterPro: IPR003148 The reg 89.43
PRK07395 553 L-aspartate oxidase; Provisional 89.38
PRK09077 536 L-aspartate oxidase; Provisional 89.38
PRK07066 321 3-hydroxybutyryl-CoA dehydrogenase; Validated 89.35
KOG2614 420 consensus Kynurenine 3-monooxygenase and related f 89.34
PF0380796 F420_oxidored: NADP oxidoreductase coenzyme F420-d 89.32
PRK09260 288 3-hydroxybutyryl-CoA dehydrogenase; Validated 89.2
COG0771 448 MurD UDP-N-acetylmuramoylalanine-D-glutamate ligas 89.17
PRK06263 543 sdhA succinate dehydrogenase flavoprotein subunit; 89.16
PLN02785 587 Protein HOTHEAD 89.1
PRK06175 433 L-aspartate oxidase; Provisional 89.01
COG3075 421 GlpB Anaerobic glycerol-3-phosphate dehydrogenase 88.96
PRK08071 510 L-aspartate oxidase; Provisional 88.83
PRK13977 576 myosin-cross-reactive antigen; Provisional 88.75
PRK07530 292 3-hydroxybutyryl-CoA dehydrogenase; Validated 88.75
cd01080168 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of 88.74
PRK13800 897 putative oxidoreductase/HEAT repeat-containing pro 88.69
PRK06249 313 2-dehydropantoate 2-reductase; Provisional 88.65
PRK12845 564 3-ketosteroid-delta-1-dehydrogenase; Reviewed 88.58
COG0569225 TrkA K+ transport systems, NAD-binding component [ 88.54
PRK06035 291 3-hydroxyacyl-CoA dehydrogenase; Validated 88.53
COG2303 542 BetA Choline dehydrogenase and related flavoprotei 88.36
KOG2495 491 consensus NADH-dehydrogenase (ubiquinone) [Energy 88.33
PRK06129 308 3-hydroxyacyl-CoA dehydrogenase; Validated 88.3
PRK12843 578 putative FAD-binding dehydrogenase; Reviewed 88.3
PRK09231 582 fumarate reductase flavoprotein subunit; Validated 88.19
PRK15116268 sulfur acceptor protein CsdL; Provisional 88.07
KOG1276 491 consensus Protoporphyrinogen oxidase [Coenzyme tra 88.06
PF13454156 NAD_binding_9: FAD-NAD(P)-binding 87.78
TIGR02354200 thiF_fam2 thiamine biosynthesis protein ThiF, fami 87.59
PTZ00306 1167 NADH-dependent fumarate reductase; Provisional 87.39
PLN02545 295 3-hydroxybutyryl-CoA dehydrogenase 87.39
COG1648210 CysG Siroheme synthase (precorrin-2 oxidase/ferroc 87.32
TIGR01176 580 fum_red_Fp fumarate reductase, flavoprotein subuni 87.31
cd05294 309 LDH-like_MDH_nadp A lactate dehydrogenases-like st 87.3
COG1053 562 SdhA Succinate dehydrogenase/fumarate reductase, f 87.27
PRK12839 572 hypothetical protein; Provisional 87.24
cd01078194 NAD_bind_H4MPT_DH NADP binding domain of methylene 87.1
COG2907 447 Predicted NAD/FAD-binding protein [General functio 87.05
cd01483143 E1_enzyme_family Superfamily of activating enzymes 86.96
TIGR03378 419 glycerol3P_GlpB glycerol-3-phosphate dehydrogenase 86.94
COG1231 450 Monoamine oxidase [Amino acid transport and metabo 86.91
PRK14620 326 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 86.85
PLN02976 1713 amine oxidase 86.58
PF02826178 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehy 86.55
cd01065155 NAD_bind_Shikimate_DH NAD(P) binding domain of Shi 86.51
PRK06130 311 3-hydroxybutyryl-CoA dehydrogenase; Validated 86.37
PF00056141 Ldh_1_N: lactate/malate dehydrogenase, NAD binding 86.25
PF03721185 UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogen 86.12
PRK07512 513 L-aspartate oxidase; Provisional 86.07
TIGR02853287 spore_dpaA dipicolinic acid synthetase, A subunit. 85.94
PRK00094 325 gpsA NAD(P)H-dependent glycerol-3-phosphate dehydr 85.94
PF10100 429 DUF2338: Uncharacterized protein conserved in bact 85.72
KOG0042 680 consensus Glycerol-3-phosphate dehydrogenase [Ener 85.41
PRK05808282 3-hydroxybutyryl-CoA dehydrogenase; Validated 85.37
cd01487174 E1_ThiF_like E1_ThiF_like. Member of superfamily o 85.33
COG3573 552 Predicted oxidoreductase [General function predict 85.31
PRK00536262 speE spermidine synthase; Provisional 84.96
PRK00258278 aroE shikimate 5-dehydrogenase; Reviewed 84.79
cd01485198 E1-1_like Ubiquitin activating enzyme (E1), repeat 84.76
PRK08229 341 2-dehydropantoate 2-reductase; Provisional 84.67
COG0029 518 NadB Aspartate oxidase [Coenzyme metabolism] 84.53
TIGR02356202 adenyl_thiF thiazole biosynthesis adenylyltransfer 84.42
cd00757228 ThiF_MoeB_HesA_family ThiF_MoeB_HesA. Family of E1 84.27
KOG0685 498 consensus Flavin-containing amine oxidase [Coenzym 84.23
KOG0405 478 consensus Pyridine nucleotide-disulphide oxidoredu 84.09
cd05292 308 LDH_2 A subgroup of L-lactate dehydrogenases. L-la 83.92
cd01484234 E1-2_like Ubiquitin activating enzyme (E1), repeat 83.78
PRK12475 338 thiamine/molybdopterin biosynthesis MoeB-like prot 83.67
PF01262168 AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal 83.61
COG1206 439 Gid NAD(FAD)-utilizing enzyme possibly involved in 83.55
PRK14618 328 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 83.52
PRK09496 453 trkA potassium transporter peripheral membrane com 83.46
PRK07417279 arogenate dehydrogenase; Reviewed 83.46
cd01489 312 Uba2_SUMO Ubiquitin activating enzyme (E1) subunit 83.4
cd01492197 Aos1_SUMO Ubiquitin activating enzyme (E1) subunit 83.39
PRK14175286 bifunctional 5,10-methylene-tetrahydrofolate dehyd 83.31
cd05213311 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain 83.17
TIGR01505 291 tartro_sem_red 2-hydroxy-3-oxopropionate reductase 83.13
PF01118121 Semialdhyde_dh: Semialdehyde dehydrogenase, NAD bi 83.13
cd01338 322 MDH_choloroplast_like Chloroplast-like malate dehy 83.03
PRK07688 339 thiamine/molybdopterin biosynthesis ThiF/MoeB-like 83.0
TIGR01915219 npdG NADPH-dependent F420 reductase. This model re 82.96
PRK08306296 dipicolinate synthase subunit A; Reviewed 82.92
cd01075200 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of l 82.71
COG1748 389 LYS9 Saccharopine dehydrogenase and related protei 82.25
cd05291 306 HicDH_like L-2-hydroxyisocapronate dehydrogenases 81.92
KOG1335 506 consensus Dihydrolipoamide dehydrogenase [Energy p 81.8
cd05311226 NAD_bind_2_malic_enz NAD(P) binding domain of mali 81.68
TIGR00518370 alaDH alanine dehydrogenase. The family of known L 81.66
cd01488 291 Uba3_RUB Ubiquitin activating enzyme (E1) subunit 81.65
TIGR01035417 hemA glutamyl-tRNA reductase. This enzyme, togethe 81.58
TIGR03026 411 NDP-sugDHase nucleotide sugar dehydrogenase. All o 81.51
COG3486 436 IucD Lysine/ornithine N-monooxygenase [Secondary m 81.49
COG1893 307 ApbA Ketopantoate reductase [Coenzyme metabolism] 81.48
PRK07531 495 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioe 81.24
PRK14619 308 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 81.17
cd01490 435 Ube1_repeat2 Ubiquitin activating enzyme (E1), rep 80.97
TIGR02279 503 PaaC-3OHAcCoADH 3-hydroxyacyl-CoA dehydrogenase Pa 80.93
PRK08644212 thiamine biosynthesis protein ThiF; Provisional 80.78
PRK11730 715 fadB multifunctional fatty acid oxidation complex 80.53
TIGR02355240 moeB molybdopterin synthase sulfurylase MoeB. This 80.47
PRK01710 458 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 80.31
COG2085211 Predicted dinucleotide-binding enzymes [General fu 80.22
KOG3855 481 consensus Monooxygenase involved in coenzyme Q (ub 80.13
PRK10637 457 cysG siroheme synthase; Provisional 80.06
>PLN02172 flavin-containing monooxygenase FMO GS-OX Back     alignment and domain information
Probab=100.00  E-value=2.5e-38  Score=270.70  Aligned_cols=182  Identities=60%  Similarity=1.062  Sum_probs=157.4

Q ss_pred             CEEEEcCCccHHHHHHHHhccCCeEEEEeccCCCCCCCCCC-CCCCeEEcceeEEeeCCCeEEEcCCcEEecCEEEEecc
Q 037525            1 VIILVGSSASAVDICRDLAGVAKEVHLVSRSVADGTYEKQP-GFDNMWLHSMIESAHDNGAVVFRNGHTVHADVILHCTG   79 (182)
Q Consensus         1 ~V~VVG~G~sg~d~A~~l~~~a~~V~l~~r~~~~~~~~~~~-~~~~i~~~~~v~~~~~~~~v~~~dg~~~~~D~vi~atG   79 (182)
                      +|+|||+|+||+|+|.+|++.+++|++++|+........++ ...++..++.|.++.++++|+|.||+.+++|.||+|||
T Consensus       206 ~VvVVG~G~Sg~diA~~L~~~a~~V~l~~r~~~~~~~~~~~~~~~~v~~~~~I~~~~~~g~V~f~DG~~~~~D~Ii~~TG  285 (461)
T PLN02172        206 VVVVIGNFASGADISRDIAKVAKEVHIASRASESDTYEKLPVPQNNLWMHSEIDTAHEDGSIVFKNGKVVYADTIVHCTG  285 (461)
T ss_pred             EEEEECCCcCHHHHHHHHHHhCCeEEEEEeeccccccccCcCCCCceEECCcccceecCCeEEECCCCCccCCEEEECCc
Confidence            59999999999999999999999999999976543222222 12356667777776665679999999999999999999


Q ss_pred             cccCCCCCCCCCceecCCCccccccccccCCCCCCCEEEEeccCCcccccHHHHHHHHHHHHHcCCCCCCCHHHHHHHHH
Q 037525           80 YKYHFPFLETNGIVTMDDNRVGPLYKHVFPPVLAPWLSFVGLPWKVIPFPLCEYQSKWIAGVLSGQIVLPSQEEMMEDTK  159 (182)
Q Consensus        80 ~~~~~~~l~~~~~~~~~~~~~~~ly~~~~~~~~~p~l~~iG~~~~~~~~~~~e~qa~~ia~~l~g~~~lP~~~~m~~~~~  159 (182)
                      |+++++||+..+.+.++++++.+||+++|++...|+|+|+|.+..+++|+++|+||+|+|++|+|+.+||++++|.++++
T Consensus       286 y~~~~pfL~~~~~i~v~~~~v~~Ly~~~f~~~~~p~LafiG~~~~~~~f~~~E~Qa~~~a~v~sG~~~LPs~~~m~~~~~  365 (461)
T PLN02172        286 YKYHFPFLETNGYMRIDENRVEPLYKHVFPPALAPGLSFIGLPAMGIQFVMFEIQSKWVAAVLSGRVTLPSEDKMMEDIN  365 (461)
T ss_pred             CCccccccCcccceeeCCCcchhhHHhhcCCCCCCcEEEEeccccccCchhHHHHHHHHHHHHcCCCCCcCHHHHHHHHH
Confidence            99999999865556677888878999999997459999999998788999999999999999999999999999999999


Q ss_pred             HHHHHHHHcCCCCcceecCCCCC
Q 037525          160 AFYSTLEASGTPKRYTHNMGDYQ  182 (182)
Q Consensus       160 ~~~~~~~~~~~~~~~~~~~~~~~  182 (182)
                      ++++.+++.|.++||+|.|++.|
T Consensus       366 ~~~~~~~~~g~~~r~~h~~~~~~  388 (461)
T PLN02172        366 AWYASLEALGIPKRYTHKLGKIQ  388 (461)
T ss_pred             HHHHHHHhcCCCCceeEEcCccH
Confidence            99999888999999999998644



>PF00743 FMO-like: Flavin-binding monooxygenase-like; InterPro: IPR020946 Flavin-containing monooxygenases (FMOs) constitute a family of xenobiotic-metabolising enzymes [] Back     alignment and domain information
>KOG1399 consensus Flavin-containing monooxygenase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>COG1252 Ndh NADH dehydrogenase, FAD-containing subunit [Energy production and conversion] Back     alignment and domain information
>PTZ00318 NADH dehydrogenase-like protein; Provisional Back     alignment and domain information
>PRK13512 coenzyme A disulfide reductase; Provisional Back     alignment and domain information
>PRK07846 mycothione reductase; Reviewed Back     alignment and domain information
>TIGR01421 gluta_reduc_1 glutathione-disulfide reductase, animal/bacterial Back     alignment and domain information
>PRK04965 NADH:flavorubredoxin oxidoreductase; Provisional Back     alignment and domain information
>PLN02507 glutathione reductase Back     alignment and domain information
>TIGR03385 CoA_CoA_reduc CoA-disulfide reductase Back     alignment and domain information
>TIGR01292 TRX_reduct thioredoxin-disulfide reductase Back     alignment and domain information
>TIGR03452 mycothione_red mycothione reductase Back     alignment and domain information
>PRK06116 glutathione reductase; Validated Back     alignment and domain information
>COG0492 TrxB Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR01423 trypano_reduc trypanothione-disulfide reductase Back     alignment and domain information
>TIGR02374 nitri_red_nirB nitrite reductase [NAD(P)H], large subunit Back     alignment and domain information
>PRK06416 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PTZ00052 thioredoxin reductase; Provisional Back     alignment and domain information
>PRK07845 flavoprotein disulfide reductase; Reviewed Back     alignment and domain information
>TIGR01424 gluta_reduc_2 glutathione-disulfide reductase, plant Back     alignment and domain information
>PRK09754 phenylpropionate dioxygenase ferredoxin reductase subunit; Provisional Back     alignment and domain information
>PRK05249 soluble pyridine nucleotide transhydrogenase; Provisional Back     alignment and domain information
>PRK07818 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>TIGR01438 TGR thioredoxin and glutathione reductase selenoprotein Back     alignment and domain information
>PRK10262 thioredoxin reductase; Provisional Back     alignment and domain information
>PRK11749 dihydropyrimidine dehydrogenase subunit A; Provisional Back     alignment and domain information
>COG1249 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component, and related enzymes [Energy production and conversion] Back     alignment and domain information
>PRK06115 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK06370 mercuric reductase; Validated Back     alignment and domain information
>PRK09564 coenzyme A disulfide reductase; Reviewed Back     alignment and domain information
>PRK14989 nitrite reductase subunit NirD; Provisional Back     alignment and domain information
>TIGR02053 MerA mercuric reductase Back     alignment and domain information
>PRK06292 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PLN02546 glutathione reductase Back     alignment and domain information
>PRK12831 putative oxidoreductase; Provisional Back     alignment and domain information
>PTZ00153 lipoamide dehydrogenase; Provisional Back     alignment and domain information
>PRK06327 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PRK13748 putative mercuric reductase; Provisional Back     alignment and domain information
>PRK06467 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>TIGR01316 gltA glutamate synthase (NADPH), homotetrameric Back     alignment and domain information
>PTZ00058 glutathione reductase; Provisional Back     alignment and domain information
>TIGR03169 Nterm_to_SelD pyridine nucleotide-disulfide oxidoreductase family protein Back     alignment and domain information
>TIGR01350 lipoamide_DH dihydrolipoamide dehydrogenase Back     alignment and domain information
>PRK09853 putative selenate reductase subunit YgfK; Provisional Back     alignment and domain information
>PRK05976 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PRK14727 putative mercuric reductase; Provisional Back     alignment and domain information
>PRK06912 acoL dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PRK08010 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>PRK14694 putative mercuric reductase; Provisional Back     alignment and domain information
>PRK07251 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>KOG2495 consensus NADH-dehydrogenase (ubiquinone) [Energy production and conversion] Back     alignment and domain information
>TIGR03140 AhpF alkyl hydroperoxide reductase, F subunit Back     alignment and domain information
>PRK15317 alkyl hydroperoxide reductase subunit F; Provisional Back     alignment and domain information
>PRK12770 putative glutamate synthase subunit beta; Provisional Back     alignment and domain information
>PRK12814 putative NADPH-dependent glutamate synthase small subunit; Provisional Back     alignment and domain information
>TIGR03315 Se_ygfK putative selenate reductase, YgfK subunit Back     alignment and domain information
>PRK12778 putative bifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta; Provisional Back     alignment and domain information
>PRK12779 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Provisional Back     alignment and domain information
>KOG0404 consensus Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03143 AhpF_homolog putative alkyl hydroperoxide reductase F subunit Back     alignment and domain information
>PRK12810 gltD glutamate synthase subunit beta; Reviewed Back     alignment and domain information
>PRK12775 putative trifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta/ferritin domain-containing protein; Provisional Back     alignment and domain information
>COG2072 TrkA Predicted flavoprotein involved in K+ transport [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK12769 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>TIGR01318 gltD_gamma_fam glutamate synthase small subunit family protein, proteobacterial Back     alignment and domain information
>TIGR01317 GOGAT_sm_gam glutamate synthases, NADH/NADPH, small subunit Back     alignment and domain information
>PRK12771 putative glutamate synthase (NADPH) small subunit; Provisional Back     alignment and domain information
>PRK13984 putative oxidoreductase; Provisional Back     alignment and domain information
>COG3634 AhpF Alkyl hydroperoxide reductase, large subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK12809 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>KOG0405 consensus Pyridine nucleotide-disulphide oxidoreductase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>COG1251 NirB NAD(P)H-nitrite reductase [Energy production and conversion] Back     alignment and domain information
>KOG1336 consensus Monodehydroascorbate/ferredoxin reductase [General function prediction only] Back     alignment and domain information
>PF00070 Pyr_redox: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR001327 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] Back     alignment and domain information
>TIGR01292 TRX_reduct thioredoxin-disulfide reductase Back     alignment and domain information
>PF13434 K_oxygenase: L-lysine 6-monooxygenase (NADPH-requiring); PDB: 3S61_B 3S5W_B Back     alignment and domain information
>TIGR01372 soxA sarcosine oxidase, alpha subunit family, heterotetrameric form Back     alignment and domain information
>TIGR03169 Nterm_to_SelD pyridine nucleotide-disulfide oxidoreductase family protein Back     alignment and domain information
>COG0446 HcaD Uncharacterized NAD(FAD)-dependent dehydrogenases [General function prediction only] Back     alignment and domain information
>PTZ00318 NADH dehydrogenase-like protein; Provisional Back     alignment and domain information
>PRK09754 phenylpropionate dioxygenase ferredoxin reductase subunit; Provisional Back     alignment and domain information
>COG3486 IucD Lysine/ornithine N-monooxygenase [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PRK09564 coenzyme A disulfide reductase; Reviewed Back     alignment and domain information
>PLN02852 ferredoxin-NADP+ reductase Back     alignment and domain information
>PRK04965 NADH:flavorubredoxin oxidoreductase; Provisional Back     alignment and domain information
>COG1252 Ndh NADH dehydrogenase, FAD-containing subunit [Energy production and conversion] Back     alignment and domain information
>PRK13512 coenzyme A disulfide reductase; Provisional Back     alignment and domain information
>PRK07251 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>TIGR03140 AhpF alkyl hydroperoxide reductase, F subunit Back     alignment and domain information
>PRK15317 alkyl hydroperoxide reductase subunit F; Provisional Back     alignment and domain information
>TIGR02374 nitri_red_nirB nitrite reductase [NAD(P)H], large subunit Back     alignment and domain information
>PRK06116 glutathione reductase; Validated Back     alignment and domain information
>PF01134 GIDA: Glucose inhibited division protein A; InterPro: IPR002218 GidA is a tRNA modification enzyme found in bacteria and mitochondria Back     alignment and domain information
>PRK14989 nitrite reductase subunit NirD; Provisional Back     alignment and domain information
>TIGR01789 lycopene_cycl lycopene cyclase Back     alignment and domain information
>COG2072 TrkA Predicted flavoprotein involved in K+ transport [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK08010 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>TIGR01421 gluta_reduc_1 glutathione-disulfide reductase, animal/bacterial Back     alignment and domain information
>TIGR01424 gluta_reduc_2 glutathione-disulfide reductase, plant Back     alignment and domain information
>PRK10262 thioredoxin reductase; Provisional Back     alignment and domain information
>COG2081 Predicted flavoproteins [General function prediction only] Back     alignment and domain information
>KOG1335 consensus Dihydrolipoamide dehydrogenase [Energy production and conversion] Back     alignment and domain information
>PF13738 Pyr_redox_3: Pyridine nucleotide-disulphide oxidoreductase; PDB: 3D1C_A 4A9W_B 2YLX_A 2YM2_A 2YLW_A 2YLR_A 2YM1_A 2YLS_A 1W4X_A 2YLT_A Back     alignment and domain information
>PRK14694 putative mercuric reductase; Provisional Back     alignment and domain information
>PRK06370 mercuric reductase; Validated Back     alignment and domain information
>COG0492 TrxB Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PTZ00058 glutathione reductase; Provisional Back     alignment and domain information
>PRK05249 soluble pyridine nucleotide transhydrogenase; Provisional Back     alignment and domain information
>PRK12779 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Provisional Back     alignment and domain information
>PLN02463 lycopene beta cyclase Back     alignment and domain information
>PLN02172 flavin-containing monooxygenase FMO GS-OX Back     alignment and domain information
>KOG3851 consensus Sulfide:quinone oxidoreductase/flavo-binding protein [Energy production and conversion] Back     alignment and domain information
>PRK06753 hypothetical protein; Provisional Back     alignment and domain information
>PRK06847 hypothetical protein; Provisional Back     alignment and domain information
>PRK06467 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK07236 hypothetical protein; Provisional Back     alignment and domain information
>KOG1346 consensus Programmed cell death 8 (apoptosis-inducing factor) [Signal transduction mechanisms] Back     alignment and domain information
>PF05834 Lycopene_cycl: Lycopene cyclase protein; InterPro: IPR008671 This family consists of lycopene beta and epsilon cyclase proteins Back     alignment and domain information
>PRK09853 putative selenate reductase subunit YgfK; Provisional Back     alignment and domain information
>TIGR02053 MerA mercuric reductase Back     alignment and domain information
>PLN02852 ferredoxin-NADP+ reductase Back     alignment and domain information
>TIGR03143 AhpF_homolog putative alkyl hydroperoxide reductase F subunit Back     alignment and domain information
>PLN02546 glutathione reductase Back     alignment and domain information
>PF03486 HI0933_like: HI0933-like protein; InterPro: IPR004792 This is a family of conserved hypothetical proteins that may include proteins with a dinucleotide-binding motif (Rossman fold), including oxidoreductases and dehydrogenases Back     alignment and domain information
>PRK07588 hypothetical protein; Provisional Back     alignment and domain information
>PRK05868 hypothetical protein; Validated Back     alignment and domain information
>PRK06115 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>TIGR01350 lipoamide_DH dihydrolipoamide dehydrogenase Back     alignment and domain information
>PF00743 FMO-like: Flavin-binding monooxygenase-like; InterPro: IPR020946 Flavin-containing monooxygenases (FMOs) constitute a family of xenobiotic-metabolising enzymes [] Back     alignment and domain information
>PLN02507 glutathione reductase Back     alignment and domain information
>PRK05976 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>TIGR03219 salicylate_mono salicylate 1-monooxygenase Back     alignment and domain information
>PRK06416 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>KOG4716 consensus Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK11749 dihydropyrimidine dehydrogenase subunit A; Provisional Back     alignment and domain information
>PRK06912 acoL dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PTZ00052 thioredoxin reductase; Provisional Back     alignment and domain information
>PRK07845 flavoprotein disulfide reductase; Reviewed Back     alignment and domain information
>PRK13748 putative mercuric reductase; Provisional Back     alignment and domain information
>TIGR01438 TGR thioredoxin and glutathione reductase selenoprotein Back     alignment and domain information
>PRK12778 putative bifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta; Provisional Back     alignment and domain information
>COG1249 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component, and related enzymes [Energy production and conversion] Back     alignment and domain information
>PRK07818 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK06292 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>KOG1399 consensus Flavin-containing monooxygenase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>TIGR03315 Se_ygfK putative selenate reductase, YgfK subunit Back     alignment and domain information
>TIGR01423 trypano_reduc trypanothione-disulfide reductase Back     alignment and domain information
>PRK14727 putative mercuric reductase; Provisional Back     alignment and domain information
>PRK07846 mycothione reductase; Reviewed Back     alignment and domain information
>PRK06567 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Validated Back     alignment and domain information
>PRK12775 putative trifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta/ferritin domain-containing protein; Provisional Back     alignment and domain information
>TIGR01372 soxA sarcosine oxidase, alpha subunit family, heterotetrameric form Back     alignment and domain information
>PLN02697 lycopene epsilon cyclase Back     alignment and domain information
>PRK06567 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Validated Back     alignment and domain information
>PRK01438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK06327 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PF13450 NAD_binding_8: NAD(P)-binding Rossmann-like domain; PDB: 3KA7_A 1V0J_D 3INR_B 3KYB_B 3GF4_A 2BI8_A 3INT_B 1WAM_A 2BI7_A 3MJ4_G Back     alignment and domain information
>KOG1336 consensus Monodehydroascorbate/ferredoxin reductase [General function prediction only] Back     alignment and domain information
>TIGR03452 mycothione_red mycothione reductase Back     alignment and domain information
>COG0445 GidA Flavin-dependent tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>TIGR00137 gid_trmFO tRNA:m(5)U-54 methyltransferase Back     alignment and domain information
>COG1635 THI4 Ribulose 1,5-bisphosphate synthetase, converts PRPP to RuBP, flavoprotein [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG2755 consensus Oxidoreductase [General function prediction only] Back     alignment and domain information
>PRK05335 tRNA (uracil-5-)-methyltransferase Gid; Reviewed Back     alignment and domain information
>PF01494 FAD_binding_3: FAD binding domain; InterPro: IPR002938 Monooxygenases incorporate one hydroxyl group into substrates and are found in many metabolic pathways Back     alignment and domain information
>PF07992 Pyr_redox_2: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR023753 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] Back     alignment and domain information
>TIGR02032 GG-red-SF geranylgeranyl reductase family Back     alignment and domain information
>KOG2311 consensus NAD/FAD-utilizing protein possibly involved in translation [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PTZ00153 lipoamide dehydrogenase; Provisional Back     alignment and domain information
>COG1148 HdrA Heterodisulfide reductase, subunit A and related polyferredoxins [Energy production and conversion] Back     alignment and domain information
>PF01946 Thi4: Thi4 family; PDB: 1RP0_A 3FPZ_B 3JSK_K Back     alignment and domain information
>PRK11259 solA N-methyltryptophan oxidase; Provisional Back     alignment and domain information
>PRK07233 hypothetical protein; Provisional Back     alignment and domain information
>PRK07364 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>PRK04176 ribulose-1,5-biphosphate synthetase; Provisional Back     alignment and domain information
>PRK08773 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Validated Back     alignment and domain information
>TIGR00292 thiazole biosynthesis enzyme Back     alignment and domain information
>TIGR02028 ChlP geranylgeranyl reductase Back     alignment and domain information
>PRK09126 hypothetical protein; Provisional Back     alignment and domain information
>PF01266 DAO: FAD dependent oxidoreductase; InterPro: IPR006076 This entry includes various FAD dependent oxidoreductases: Glycerol-3-phosphate dehydrogenase (1 Back     alignment and domain information
>TIGR01988 Ubi-OHases Ubiquinone biosynthesis hydroxylase, UbiH/UbiF/VisC/COQ6 family Back     alignment and domain information
>PRK12409 D-amino acid dehydrogenase small subunit; Provisional Back     alignment and domain information
>TIGR01377 soxA_mon sarcosine oxidase, monomeric form Back     alignment and domain information
>TIGR01984 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase Back     alignment and domain information
>PRK05192 tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA; Validated Back     alignment and domain information
>PRK08244 hypothetical protein; Provisional Back     alignment and domain information
>PRK07608 ubiquinone biosynthesis hydroxylase family protein; Provisional Back     alignment and domain information
>PRK06184 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02023 BchP-ChlP geranylgeranyl reductase Back     alignment and domain information
>PRK07494 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional Back     alignment and domain information
>COG3634 AhpF Alkyl hydroperoxide reductase, large subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK07045 putative monooxygenase; Reviewed Back     alignment and domain information
>PRK08013 oxidoreductase; Provisional Back     alignment and domain information
>KOG0399 consensus Glutamate synthase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK12266 glpD glycerol-3-phosphate dehydrogenase; Reviewed Back     alignment and domain information
>COG0562 Glf UDP-galactopyranose mutase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK11728 hydroxyglutarate oxidase; Provisional Back     alignment and domain information
>PRK12770 putative glutamate synthase subunit beta; Provisional Back     alignment and domain information
>PRK08163 salicylate hydroxylase; Provisional Back     alignment and domain information
>PRK10157 putative oxidoreductase FixC; Provisional Back     alignment and domain information
>PTZ00188 adrenodoxin reductase; Provisional Back     alignment and domain information
>PLN00093 geranylgeranyl diphosphate reductase; Provisional Back     alignment and domain information
>PRK10015 oxidoreductase; Provisional Back     alignment and domain information
>TIGR01790 carotene-cycl lycopene cyclase family protein Back     alignment and domain information
>PRK06185 hypothetical protein; Provisional Back     alignment and domain information
>PRK05714 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional Back     alignment and domain information
>PRK06126 hypothetical protein; Provisional Back     alignment and domain information
>KOG0404 consensus Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12831 FAD_oxidored: FAD dependent oxidoreductase; PDB: 3ADA_A 1VRQ_A 1X31_A 3AD9_A 3AD8_A 3AD7_A 2GAG_A 2GAH_A Back     alignment and domain information
>PRK08020 ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Reviewed Back     alignment and domain information
>PRK00711 D-amino acid dehydrogenase small subunit; Validated Back     alignment and domain information
>PRK06475 salicylate hydroxylase; Provisional Back     alignment and domain information
>TIGR00031 UDP-GALP_mutase UDP-galactopyranose mutase Back     alignment and domain information
>PRK13369 glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK06617 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>COG0644 FixC Dehydrogenases (flavoproteins) [Energy production and conversion] Back     alignment and domain information
>KOG0399 consensus Glutamate synthase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK11101 glpA sn-glycerol-3-phosphate dehydrogenase subunit A; Provisional Back     alignment and domain information
>TIGR03364 HpnW_proposed FAD dependent oxidoreductase TIGR03364 Back     alignment and domain information
>PRK12810 gltD glutamate synthase subunit beta; Reviewed Back     alignment and domain information
>COG0654 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases [Coenzyme metabolism / Energy production and conversion] Back     alignment and domain information
>PRK11445 putative oxidoreductase; Provisional Back     alignment and domain information
>PF13241 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_B 1PJT_A 1PJS_A 1PJQ_A 1KYQ_B Back     alignment and domain information
>PRK08849 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional Back     alignment and domain information
>PRK08243 4-hydroxybenzoate 3-monooxygenase; Validated Back     alignment and domain information
>PRK11883 protoporphyrinogen oxidase; Reviewed Back     alignment and domain information
>PRK12831 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK08850 2-octaprenyl-6-methoxyphenol hydroxylase; Validated Back     alignment and domain information
>KOG1800 consensus Ferredoxin/adrenodoxin reductase [Nucleotide transport and metabolism] Back     alignment and domain information
>TIGR01316 gltA glutamate synthase (NADPH), homotetrameric Back     alignment and domain information
>PRK07333 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional Back     alignment and domain information
>PRK06834 hypothetical protein; Provisional Back     alignment and domain information
>PRK05732 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>PRK07190 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02360 pbenz_hydroxyl 4-hydroxybenzoate 3-monooxygenase Back     alignment and domain information
>PRK08132 FAD-dependent oxidoreductase; Provisional Back     alignment and domain information
>TIGR02731 phytoene_desat phytoene desaturase Back     alignment and domain information
>TIGR01989 COQ6 Ubiquinone biosynthesis mono0xygenase COQ6 Back     alignment and domain information
>PRK07538 hypothetical protein; Provisional Back     alignment and domain information
>PLN02268 probable polyamine oxidase Back     alignment and domain information
>PRK06183 mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Validated Back     alignment and domain information
>PRK07208 hypothetical protein; Provisional Back     alignment and domain information
>PLN02464 glycerol-3-phosphate dehydrogenase Back     alignment and domain information
>PRK08294 phenol 2-monooxygenase; Provisional Back     alignment and domain information
>PRK12769 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>PF00890 FAD_binding_2: FAD binding domain of the Pfam family Back     alignment and domain information
>TIGR00562 proto_IX_ox protoporphyrinogen oxidase Back     alignment and domain information
>TIGR01318 gltD_gamma_fam glutamate synthase small subunit family protein, proteobacterial Back     alignment and domain information
>KOG0029 consensus Amine oxidase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>TIGR01373 soxB sarcosine oxidase, beta subunit family, heterotetrameric form Back     alignment and domain information
>COG0665 DadA Glycine/D-amino acid oxidases (deaminating) [Amino acid transport and metabolism] Back     alignment and domain information
>PF01210 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus; InterPro: IPR011128 NAD-dependent glycerol-3-phosphate dehydrogenase (GPDH) catalyses the interconversion of dihydroxyacetone phosphate and L-glycerol-3-phosphate Back     alignment and domain information
>PF00732 GMC_oxred_N: GMC oxidoreductase; InterPro: IPR000172 The glucose-methanol-choline (GMC) oxidoreductases are FAD flavoproteins oxidoreductases [, ] Back     alignment and domain information
>PRK01747 mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltransferase/FAD-dependent cmnm(5)s(2)U34 oxidoreductase; Reviewed Back     alignment and domain information
>TIGR02734 crtI_fam phytoene desaturase Back     alignment and domain information
>PLN02985 squalene monooxygenase Back     alignment and domain information
>TIGR03329 Phn_aa_oxid putative aminophosphonate oxidoreductase Back     alignment and domain information
>PRK12814 putative NADPH-dependent glutamate synthase small subunit; Provisional Back     alignment and domain information
>COG1233 Phytoene dehydrogenase and related proteins [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>TIGR01470 cysG_Nterm siroheme synthase, N-terminal domain Back     alignment and domain information
>TIGR01813 flavo_cyto_c flavocytochrome c Back     alignment and domain information
>TIGR01317 GOGAT_sm_gam glutamate synthases, NADH/NADPH, small subunit Back     alignment and domain information
>PF13434 K_oxygenase: L-lysine 6-monooxygenase (NADPH-requiring); PDB: 3S61_B 3S5W_B Back     alignment and domain information
>PRK08274 tricarballylate dehydrogenase; Validated Back     alignment and domain information
>COG0578 GlpA Glycerol-3-phosphate dehydrogenase [Energy production and conversion] Back     alignment and domain information
>PRK06996 hypothetical protein; Provisional Back     alignment and domain information
>PLN02576 protoporphyrinogen oxidase Back     alignment and domain information
>PRK12809 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>TIGR02733 desat_CrtD C-3',4' desaturase CrtD Back     alignment and domain information
>PLN02927 antheraxanthin epoxidase/zeaxanthin epoxidase Back     alignment and domain information
>TIGR01320 mal_quin_oxido malate:quinone-oxidoreductase Back     alignment and domain information
>COG1251 NirB NAD(P)H-nitrite reductase [Energy production and conversion] Back     alignment and domain information
>PF02737 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain; InterPro: IPR006176 3-hydroxyacyl-CoA dehydrogenase (1 Back     alignment and domain information
>PTZ00188 adrenodoxin reductase; Provisional Back     alignment and domain information
>PRK07121 hypothetical protein; Validated Back     alignment and domain information
>PRK06719 precorrin-2 dehydrogenase; Validated Back     alignment and domain information
>TIGR02730 carot_isom carotene isomerase Back     alignment and domain information
>PRK12416 protoporphyrinogen oxidase; Provisional Back     alignment and domain information
>COG3349 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK09897 hypothetical protein; Provisional Back     alignment and domain information
>COG0446 HcaD Uncharacterized NAD(FAD)-dependent dehydrogenases [General function prediction only] Back     alignment and domain information
>PTZ00367 squalene epoxidase; Provisional Back     alignment and domain information
>TIGR02732 zeta_caro_desat carotene 7,8-desaturase Back     alignment and domain information
>PRK08401 L-aspartate oxidase; Provisional Back     alignment and domain information
>PF02558 ApbA: Ketopantoate reductase PanE/ApbA; InterPro: IPR013332 ApbA, the ketopantoate reductase enzyme 1 Back     alignment and domain information
>PRK12771 putative glutamate synthase (NADPH) small subunit; Provisional Back     alignment and domain information
>PRK06481 fumarate reductase flavoprotein subunit; Validated Back     alignment and domain information
>PRK06718 precorrin-2 dehydrogenase; Reviewed Back     alignment and domain information
>PTZ00383 malate:quinone oxidoreductase; Provisional Back     alignment and domain information
>TIGR00136 gidA glucose-inhibited division protein A Back     alignment and domain information
>TIGR01812 sdhA_frdA_Gneg succinate dehydrogenase or fumarate reductase, flavoprotein subunitGram-negative/mitochondrial subgroup Back     alignment and domain information
>PRK05257 malate:quinone oxidoreductase; Validated Back     alignment and domain information
>PLN02661 Putative thiazole synthesis Back     alignment and domain information
>PRK12842 putative succinate dehydrogenase; Reviewed Back     alignment and domain information
>COG0579 Predicted dehydrogenase [General function prediction only] Back     alignment and domain information
>PF04820 Trp_halogenase: Tryptophan halogenase; InterPro: IPR006905 Tryptophan halogenase catalyses the chlorination of tryptophan to form 7-chlorotryptophan Back     alignment and domain information
>PRK12837 3-ketosteroid-delta-1-dehydrogenase; Provisional Back     alignment and domain information
>PRK12834 putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>KOG1298 consensus Squalene monooxygenase [Lipid transport and metabolism] Back     alignment and domain information
>PLN02529 lysine-specific histone demethylase 1 Back     alignment and domain information
>PRK13339 malate:quinone oxidoreductase; Reviewed Back     alignment and domain information
>PRK08255 salicylyl-CoA 5-hydroxylase; Reviewed Back     alignment and domain information
>PLN02676 polyamine oxidase Back     alignment and domain information
>COG4529 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PLN02568 polyamine oxidase Back     alignment and domain information
>PTZ00363 rab-GDP dissociation inhibitor; Provisional Back     alignment and domain information
>PLN02487 zeta-carotene desaturase Back     alignment and domain information
>PRK02106 choline dehydrogenase; Validated Back     alignment and domain information
>PRK07804 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK05562 precorrin-2 dehydrogenase; Provisional Back     alignment and domain information
>PRK07803 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PF01488 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; InterPro: IPR006151 This entry represents a domain found in shikimate and quinate dehydrogenases, as well as glutamyl-tRNA reductases Back     alignment and domain information
>PRK12844 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>KOG1346 consensus Programmed cell death 8 (apoptosis-inducing factor) [Signal transduction mechanisms] Back     alignment and domain information
>PRK06854 adenylylsulfate reductase subunit alpha; Validated Back     alignment and domain information
>PRK12835 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>PRK07057 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK08626 fumarate reductase flavoprotein subunit; Provisional Back     alignment and domain information
>PRK06452 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PLN02328 lysine-specific histone demethylase 1 homolog Back     alignment and domain information
>PRK08641 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK09078 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK05329 anaerobic glycerol-3-phosphate dehydrogenase subunit B; Validated Back     alignment and domain information
>COG0493 GltD NADPH-dependent glutamate synthase beta chain and related oxidoreductases [Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>COG0493 GltD NADPH-dependent glutamate synthase beta chain and related oxidoreductases [Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>TIGR00551 nadB L-aspartate oxidase Back     alignment and domain information
>PRK06069 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>TIGR00275 flavoprotein, HI0933 family Back     alignment and domain information
>PF13454 NAD_binding_9: FAD-NAD(P)-binding Back     alignment and domain information
>PRK07573 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PTZ00139 Succinate dehydrogenase [ubiquinone] flavoprotein subunit; Provisional Back     alignment and domain information
>PRK04148 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01811 sdhA_Bsu succinate dehydrogenase or fumarate reductase, flavoprotein subunit, Bacillus subtilis subgroup Back     alignment and domain information
>PRK08275 putative oxidoreductase; Provisional Back     alignment and domain information
>PLN02612 phytoene desaturase Back     alignment and domain information
>PLN03000 amine oxidase Back     alignment and domain information
>PRK07843 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>PRK06522 2-dehydropantoate 2-reductase; Reviewed Back     alignment and domain information
>PRK13984 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK08958 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK06134 putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>TIGR02462 pyranose_ox pyranose oxidase Back     alignment and domain information
>TIGR01810 betA choline dehydrogenase Back     alignment and domain information
>PRK07819 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PLN00128 Succinate dehydrogenase [ubiquinone] flavoprotein subunit Back     alignment and domain information
>PRK08293 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>COG1232 HemY Protoporphyrinogen oxidase [Coenzyme metabolism] Back     alignment and domain information
>cd05191 NAD_bind_amino_acid_DH NAD(P) binding domain of amino acid dehydrogenase-like proteins Back     alignment and domain information
>PRK05329 anaerobic glycerol-3-phosphate dehydrogenase subunit B; Validated Back     alignment and domain information
>PRK05945 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PF13460 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X_A 3GPI_A 3QVO_A 2Q46_B 1YBM_B 1XQ6_B 2Q4B_B 3EW7_A 3IUS_B Back     alignment and domain information
>PRK14106 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK02705 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK05708 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>TIGR02061 aprA adenosine phosphosulphate reductase, alpha subunit Back     alignment and domain information
>PRK12921 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>PRK08205 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>COG3380 Predicted NAD/FAD-dependent oxidoreductase [General function prediction only] Back     alignment and domain information
>PLN02815 L-aspartate oxidase Back     alignment and domain information
>PF00899 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-activating enzyme (E1 enzyme) [, ] activates ubiquitin by first adenylating with ATP its C-terminal glycine residue and thereafter linking this residue to the side chain of a cysteine residue in E1, yielding an ubiquitin-E1 thiolester and free AMP Back     alignment and domain information
>PF02254 TrkA_N: TrkA-N domain; InterPro: IPR003148 The regulator of K+ conductance (RCK) domain is found in many ligand-gated K+ channels, most often attached to the intracellular carboxy terminus Back     alignment and domain information
>PRK07395 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK09077 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK07066 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>KOG2614 consensus Kynurenine 3-monooxygenase and related flavoprotein monooxygenases [Energy production and conversion; General function prediction only] Back     alignment and domain information
>PF03807 F420_oxidored: NADP oxidoreductase coenzyme F420-dependent; InterPro: IPR004455 The function of F420-dependent NADP reductase is the transfer of electrons from reduced coenzyme F420 into an electron transport chain Back     alignment and domain information
>PRK09260 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>COG0771 MurD UDP-N-acetylmuramoylalanine-D-glutamate ligase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK06263 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PLN02785 Protein HOTHEAD Back     alignment and domain information
>PRK06175 L-aspartate oxidase; Provisional Back     alignment and domain information
>COG3075 GlpB Anaerobic glycerol-3-phosphate dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK08071 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK13977 myosin-cross-reactive antigen; Provisional Back     alignment and domain information
>PRK07530 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>cd01080 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of methylene-tetrahydrofolate dehydrogenase/cyclohydrolase Back     alignment and domain information
>PRK13800 putative oxidoreductase/HEAT repeat-containing protein; Provisional Back     alignment and domain information
>PRK06249 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>PRK12845 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>COG0569 TrkA K+ transport systems, NAD-binding component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK06035 3-hydroxyacyl-CoA dehydrogenase; Validated Back     alignment and domain information
>COG2303 BetA Choline dehydrogenase and related flavoproteins [Amino acid transport and metabolism] Back     alignment and domain information
>KOG2495 consensus NADH-dehydrogenase (ubiquinone) [Energy production and conversion] Back     alignment and domain information
>PRK06129 3-hydroxyacyl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK12843 putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>PRK09231 fumarate reductase flavoprotein subunit; Validated Back     alignment and domain information
>PRK15116 sulfur acceptor protein CsdL; Provisional Back     alignment and domain information
>KOG1276 consensus Protoporphyrinogen oxidase [Coenzyme transport and metabolism] Back     alignment and domain information
>PF13454 NAD_binding_9: FAD-NAD(P)-binding Back     alignment and domain information
>TIGR02354 thiF_fam2 thiamine biosynthesis protein ThiF, family 2 Back     alignment and domain information
>PTZ00306 NADH-dependent fumarate reductase; Provisional Back     alignment and domain information
>PLN02545 3-hydroxybutyryl-CoA dehydrogenase Back     alignment and domain information
>COG1648 CysG Siroheme synthase (precorrin-2 oxidase/ferrochelatase domain) [Coenzyme metabolism] Back     alignment and domain information
>TIGR01176 fum_red_Fp fumarate reductase, flavoprotein subunit Back     alignment and domain information
>cd05294 LDH-like_MDH_nadp A lactate dehydrogenases-like structure with malate dehydrogenase enzymatic activity Back     alignment and domain information
>COG1053 SdhA Succinate dehydrogenase/fumarate reductase, flavoprotein subunit [Energy production and conversion] Back     alignment and domain information
>PRK12839 hypothetical protein; Provisional Back     alignment and domain information
>cd01078 NAD_bind_H4MPT_DH NADP binding domain of methylene tetrahydromethanopterin dehydrogenase Back     alignment and domain information
>COG2907 Predicted NAD/FAD-binding protein [General function prediction only] Back     alignment and domain information
>cd01483 E1_enzyme_family Superfamily of activating enzymes (E1) of the ubiquitin-like proteins Back     alignment and domain information
>TIGR03378 glycerol3P_GlpB glycerol-3-phosphate dehydrogenase, anaerobic, B subunit Back     alignment and domain information
>COG1231 Monoamine oxidase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK14620 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PLN02976 amine oxidase Back     alignment and domain information
>PF02826 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain; InterPro: IPR006140 A number of NAD-dependent 2-hydroxyacid dehydrogenases which seem to be specific for the D-isomer of their substrate have been shown to be functionally and structurally related Back     alignment and domain information
>cd01065 NAD_bind_Shikimate_DH NAD(P) binding domain of Shikimate dehydrogenase Back     alignment and domain information
>PRK06130 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PF00056 Ldh_1_N: lactate/malate dehydrogenase, NAD binding domain Prosite entry for lactate dehydrogenase Prosite entry for malate dehydrogenase; InterPro: IPR001236 L-lactate dehydrogenases are metabolic enzymes which catalyse the conversion of L-lactate to pyruvate, the last step in anaerobic glycolysis [] Back     alignment and domain information
>PF03721 UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogenase family, NAD binding domain; InterPro: IPR001732 The UDP-glucose/GDP-mannose dehydrogenases are a small group of enzymes which possesses the ability to catalyse the NAD-dependent 2-fold oxidation of an alcohol to an acid without the release of an aldehyde intermediate [, ] Back     alignment and domain information
>PRK07512 L-aspartate oxidase; Provisional Back     alignment and domain information
>TIGR02853 spore_dpaA dipicolinic acid synthetase, A subunit Back     alignment and domain information
>PRK00094 gpsA NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Validated Back     alignment and domain information
>PF10100 DUF2338: Uncharacterized protein conserved in bacteria (DUF2338); InterPro: IPR016935 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>KOG0042 consensus Glycerol-3-phosphate dehydrogenase [Energy production and conversion] Back     alignment and domain information
>PRK05808 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>cd01487 E1_ThiF_like E1_ThiF_like Back     alignment and domain information
>COG3573 Predicted oxidoreductase [General function prediction only] Back     alignment and domain information
>PRK00536 speE spermidine synthase; Provisional Back     alignment and domain information
>PRK00258 aroE shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>cd01485 E1-1_like Ubiquitin activating enzyme (E1), repeat 1-like Back     alignment and domain information
>PRK08229 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>COG0029 NadB Aspartate oxidase [Coenzyme metabolism] Back     alignment and domain information
>TIGR02356 adenyl_thiF thiazole biosynthesis adenylyltransferase ThiF, E Back     alignment and domain information
>cd00757 ThiF_MoeB_HesA_family ThiF_MoeB_HesA Back     alignment and domain information
>KOG0685 consensus Flavin-containing amine oxidase [Coenzyme transport and metabolism] Back     alignment and domain information
>KOG0405 consensus Pyridine nucleotide-disulphide oxidoreductase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>cd05292 LDH_2 A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>cd01484 E1-2_like Ubiquitin activating enzyme (E1), repeat 2-like Back     alignment and domain information
>PRK12475 thiamine/molybdopterin biosynthesis MoeB-like protein; Provisional Back     alignment and domain information
>PF01262 AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal domain; InterPro: IPR007698 Alanine dehydrogenases (1 Back     alignment and domain information
>COG1206 Gid NAD(FAD)-utilizing enzyme possibly involved in translation [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK14618 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK09496 trkA potassium transporter peripheral membrane component; Reviewed Back     alignment and domain information
>PRK07417 arogenate dehydrogenase; Reviewed Back     alignment and domain information
>cd01489 Uba2_SUMO Ubiquitin activating enzyme (E1) subunit UBA2 Back     alignment and domain information
>cd01492 Aos1_SUMO Ubiquitin activating enzyme (E1) subunit Aos1 Back     alignment and domain information
>PRK14175 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>cd05213 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain of glutamyl-tRNA reductase Back     alignment and domain information
>TIGR01505 tartro_sem_red 2-hydroxy-3-oxopropionate reductase Back     alignment and domain information
>PF01118 Semialdhyde_dh: Semialdehyde dehydrogenase, NAD binding domain; InterPro: IPR000534 The semialdehyde dehydrogenase family is found in N-acetyl-glutamine semialdehyde dehydrogenase (AgrC), which is involved in arginine biosynthesis, and aspartate-semialdehyde dehydrogenase [], an enzyme involved in the biosynthesis of various amino acids from aspartate Back     alignment and domain information
>cd01338 MDH_choloroplast_like Chloroplast-like malate dehydrogenases Back     alignment and domain information
>PRK07688 thiamine/molybdopterin biosynthesis ThiF/MoeB-like protein; Validated Back     alignment and domain information
>TIGR01915 npdG NADPH-dependent F420 reductase Back     alignment and domain information
>PRK08306 dipicolinate synthase subunit A; Reviewed Back     alignment and domain information
>cd01075 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase Back     alignment and domain information
>COG1748 LYS9 Saccharopine dehydrogenase and related proteins [Amino acid transport and metabolism] Back     alignment and domain information
>cd05291 HicDH_like L-2-hydroxyisocapronate dehydrogenases and some bacterial L-lactate dehydrogenases Back     alignment and domain information
>KOG1335 consensus Dihydrolipoamide dehydrogenase [Energy production and conversion] Back     alignment and domain information
>cd05311 NAD_bind_2_malic_enz NAD(P) binding domain of malic enzyme (ME), subgroup 2 Back     alignment and domain information
>TIGR00518 alaDH alanine dehydrogenase Back     alignment and domain information
>cd01488 Uba3_RUB Ubiquitin activating enzyme (E1) subunit UBA3 Back     alignment and domain information
>TIGR01035 hemA glutamyl-tRNA reductase Back     alignment and domain information
>TIGR03026 NDP-sugDHase nucleotide sugar dehydrogenase Back     alignment and domain information
>COG3486 IucD Lysine/ornithine N-monooxygenase [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>COG1893 ApbA Ketopantoate reductase [Coenzyme metabolism] Back     alignment and domain information
>PRK07531 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioesterase; Validated Back     alignment and domain information
>PRK14619 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>cd01490 Ube1_repeat2 Ubiquitin activating enzyme (E1), repeat 2 Back     alignment and domain information
>TIGR02279 PaaC-3OHAcCoADH 3-hydroxyacyl-CoA dehydrogenase PaaC Back     alignment and domain information
>PRK08644 thiamine biosynthesis protein ThiF; Provisional Back     alignment and domain information
>PRK11730 fadB multifunctional fatty acid oxidation complex subunit alpha; Reviewed Back     alignment and domain information
>TIGR02355 moeB molybdopterin synthase sulfurylase MoeB Back     alignment and domain information
>PRK01710 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>COG2085 Predicted dinucleotide-binding enzymes [General function prediction only] Back     alignment and domain information
>KOG3855 consensus Monooxygenase involved in coenzyme Q (ubiquinone) biosynthesis [Coenzyme transport and metabolism; Energy production and conversion] Back     alignment and domain information
>PRK10637 cysG siroheme synthase; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query182
1vqw_A457 Crystal Structure Of A Protein With Similarity To F 5e-13
2gv8_A447 Crystal Structure Of Flavin-Containing Monooxygenas 5e-13
2xvi_A464 Crystal Structure Of The Mutant Bacterial Flavin Co 3e-10
2xve_A464 Crystal Structure Of Bacterial Flavin-Containing Mo 7e-10
2xls_A461 Joint-Functions Of Protein Residues And Nadp(H) In 8e-10
2xlp_A461 Joint-Functions Of Protein Residues And Nadp(H) In 8e-10
2xlr_A461 Joint-Functions Of Protein Residues And Nadp(H) In 8e-10
2vq7_A461 Bacterial Flavin-Containing Monooxygenase In Comple 8e-10
2xvf_A464 Crystal Structure Of Bacterial Flavin-Containing Mo 9e-09
>pdb|1VQW|A Chain A, Crystal Structure Of A Protein With Similarity To Flavin- Containing Monooxygenases And To Mammalian Dimethylalanine Monooxygenases Length = 457 Back     alignment and structure

Iteration: 1

Score = 70.5 bits (171), Expect = 5e-13, Method: Compositional matrix adjust. Identities = 52/165 (31%), Positives = 88/165 (53%), Gaps = 18/165 (10%) Query: 2 IILVGSSASAVDICRDLAGVAKEVHLVSRSVADGTYEKQPGFDNMWLHSMIESAH---DN 58 +++VG ++SA D+ R L VAK H + +S+ G N L + E Sbjct: 217 VLVVGGASSANDLVRHLTPVAK--HPIYQSLLGGG-----DIQNESLQQVPEITKFDPTT 269 Query: 59 GAVVFRNGHTV-HADVILHCTGYKYHFPF-----LETNGIVTMDD-NRVGPLYKHVFPPV 111 + + G + + D +++CTGY Y PF L++ +DD + V +Y+H+F + Sbjct: 270 REIYLKGGKVLSNIDRVIYCTGYLYSVPFPSLAKLKSPETKLIDDGSHVHNVYQHIFY-I 328 Query: 112 LAPWLSFVGLPWKVIPFPLCEYQSKWIAGVLSGQIVLPSQEEMME 156 P L+FVGL V+PFP + Q+ ++A V SG++ LPS+EE ++ Sbjct: 329 PDPTLAFVGLALHVVPFPTSQAQAAFLARVWSGRLKLPSKEEQLK 373
>pdb|2GV8|A Chain A, Crystal Structure Of Flavin-Containing Monooxygenase (Fmo) From S.Pombe And Nadph Cofactor Complex Length = 447 Back     alignment and structure
>pdb|2XVI|A Chain A, Crystal Structure Of The Mutant Bacterial Flavin Containing Monooxygenase (Y207s) Length = 464 Back     alignment and structure
>pdb|2XVE|A Chain A, Crystal Structure Of Bacterial Flavin-Containing Monooxygenase Length = 464 Back     alignment and structure
>pdb|2XLS|A Chain A, Joint-Functions Of Protein Residues And Nadp(H) In Oxygen-Activation By Flavin-Containing Monooxygenase: Asn78lys Mutant Length = 461 Back     alignment and structure
>pdb|2XLP|A Chain A, Joint-Functions Of Protein Residues And Nadp(H) In Oxygen- Activation By Flavin-Containing Monooxygenase: Asn78ser Mutant Length = 461 Back     alignment and structure
>pdb|2XLR|A Chain A, Joint-Functions Of Protein Residues And Nadp(H) In Oxygen-Activation By Flavin-Containing Monooxygenase: Asn78asp Mutant Length = 461 Back     alignment and structure
>pdb|2VQ7|A Chain A, Bacterial Flavin-Containing Monooxygenase In Complex With Nadp: Native Data Length = 461 Back     alignment and structure
>pdb|2XVF|A Chain A, Crystal Structure Of Bacterial Flavin-Containing Monooxygenase Length = 464 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query182
2gv8_A447 Monooxygenase; FMO, FAD, NADPH, cofactor complex, 7e-52
2xve_A464 Flavin-containing monooxygenase; oxidoreductase; H 6e-46
4a9w_A357 Monooxygenase; baeyer-villiger, FAD, oxidoreductas 2e-11
3d1c_A369 Flavin-containing putative monooxygenase; NP_37310 2e-08
>2gv8_A Monooxygenase; FMO, FAD, NADPH, cofactor complex, PSI, structura genomics, protein structure initiative; HET: FAD NDP; 2.10A {Schizosaccharomyces pombe} SCOP: c.3.1.5 c.3.1.5 PDB: 2gvc_A* 1vqw_A* Length = 447 Back     alignment and structure
 Score =  170 bits (433), Expect = 7e-52
 Identities = 51/187 (27%), Positives = 87/187 (46%), Gaps = 17/187 (9%)

Query: 1   VIILVGSSASAVDICRDLAGVAKEVHLVSRSVADGTYEKQPGFDNMWLHSMIESAHDNGA 60
            +++VG ++SA D+ R L  VAK     S     G  + Q   +++     I        
Sbjct: 214 SVLVVGGASSANDLVRHLTPVAKHPIYQSLL---GGGDIQN--ESLQQVPEITKFDPTTR 268

Query: 61  VVFRNGHTV--HADVILHCTGYKYHFPFLE------TNGIVTMDDNRVGPLYKHVFPPVL 112
            ++  G  V  + D +++CTGY Y  PF            +  D + V  +Y+H+F    
Sbjct: 269 EIYLKGGKVLSNIDRVIYCTGYLYSVPFPSLAKLKSPETKLIDDGSHVHNVYQHIFYI-P 327

Query: 113 APWLSFVGLPWKVIPFPLCEYQSKWIAGVLSGQIVLPSQEEMMEDTKAFYSTLEASGTPK 172
            P L+FVGL   V+PFP  + Q+ ++A V SG++ LPS+EE ++       +L  +    
Sbjct: 328 DPTLAFVGLALHVVPFPTSQAQAAFLARVWSGRLKLPSKEEQLKWQDELMFSLSGAN--- 384

Query: 173 RYTHNMG 179
              H++ 
Sbjct: 385 NMYHSLD 391


>2xve_A Flavin-containing monooxygenase; oxidoreductase; HET: FAD; 1.99A {Methylophaga aminisulfidivorans} PDB: 2xvf_A* 2xvh_A* 2xvi_A* 2xvj_A* 2xlt_A* 2vqb_A* 2vq7_A* 2xlu_A* 2xlp_A* 2xls_A* 2xlr_A* Length = 464 Back     alignment and structure
>4a9w_A Monooxygenase; baeyer-villiger, FAD, oxidoreductase; HET: FAD; 2.72A {Stenotrophomonas maltophilia} Length = 357 Back     alignment and structure
>3d1c_A Flavin-containing putative monooxygenase; NP_373108.1, struc genomics, joint center for structural genomics, JCSG; HET: FAD UNL; 2.40A {Staphylococcus aureus} Length = 369 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query182
2xve_A464 Flavin-containing monooxygenase; oxidoreductase; H 99.97
2gv8_A447 Monooxygenase; FMO, FAD, NADPH, cofactor complex, 99.96
3gwf_A540 Cyclohexanone monooxygenase; flavoprotein biocatal 99.78
3uox_A545 Otemo; baeyer-villiger monooxygenase, oxidoreducta 99.76
4ap3_A549 Steroid monooxygenase; oxidoreductase, baeyer-vill 99.73
3d1c_A369 Flavin-containing putative monooxygenase; NP_37310 99.67
4a9w_A357 Monooxygenase; baeyer-villiger, FAD, oxidoreductas 99.63
1w4x_A542 Phenylacetone monooxygenase; baeyer-villiger, FAD; 99.61
4eqs_A437 Coenzyme A disulfide reductase; oxidoreductase; HE 99.55
2gqw_A408 Ferredoxin reductase; flavoprotein, oxidoreductase 99.5
2q7v_A325 Thioredoxin reductase; rossman fold, FAD, flavopro 99.48
3fg2_P404 Putative rubredoxin reductase; ferredoxin reductas 99.47
1onf_A500 GR, grase, glutathione reductase; oxidoreductase; 99.47
3lxd_A415 FAD-dependent pyridine nucleotide-disulphide oxido 99.47
2a87_A335 TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TL 99.47
2bc0_A490 NADH oxidase; flavoprotein, pyridine nucleotide di 99.46
1vdc_A333 NTR, NADPH dependent thioredoxin reductase; hypoth 99.46
3itj_A338 Thioredoxin reductase 1; disulfide B flavoprotein, 99.45
3ef6_A410 Toluene 1,2-dioxygenase system ferredoxin--NAD(+) 99.45
3fbs_A297 Oxidoreductase; structural genomics, PSI2, MCSG, p 99.45
2hqm_A479 GR, grase, glutathione reductase; glutathione redu 99.45
1ges_A450 Glutathione reductase; oxidoreductase(flavoenzyme) 99.44
3cty_A319 Thioredoxin reductase; FAD, oxidoreductase, flavin 99.44
1xhc_A367 NADH oxidase /nitrite reductase; southe collaborat 99.44
2q0l_A311 TRXR, thioredoxin reductase; bacterial thiredoxin 99.43
2wpf_A 495 Trypanothione reductase; oxidoreductase, trypanoso 99.43
2a8x_A464 Dihydrolipoyl dehydrogenase, E3 component of alpha 99.42
2r9z_A463 Glutathione amide reductase; NAD, FAD, substrate s 99.42
1ebd_A455 E3BD, dihydrolipoamide dehydrogenase; redox-active 99.42
3ntd_A 565 FAD-dependent pyridine nucleotide-disulphide oxido 99.41
1dxl_A470 Dihydrolipoamide dehydrogenase; oxidoreductase, mu 99.41
1q1r_A431 Putidaredoxin reductase; glutathione reductase fol 99.4
1fec_A 490 Trypanothione reductase; redox-active center, oxid 99.4
1xdi_A 499 RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno fun 99.4
1ojt_A482 Surface protein; redox-active center, glycolysis, 99.4
3iwa_A 472 FAD-dependent pyridine nucleotide-disulphide oxido 99.4
2zbw_A335 Thioredoxin reductase; redox protein, oxidoreducta 99.4
2cdu_A452 NADPH oxidase; flavoenzyme, oxidoreductase; HET: F 99.4
3ics_A 588 Coenzyme A-disulfide reductase; pyridine nucleotid 99.4
1v59_A478 Dihydrolipoamide dehydrogenase; 2-oxoacid dehydrog 99.4
3lad_A476 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 99.39
1fl2_A310 Alkyl hydroperoxide reductase subunit F; reactive 99.39
4dna_A463 Probable glutathione reductase; structural genomic 99.39
1lvl_A458 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 99.39
3ab1_A360 Ferredoxin--NADP reductase; oxidoreductase, electr 99.39
3kd9_A449 Coenzyme A disulfide reductase; PSI-II, NYSGXRC, o 99.38
2yqu_A455 2-oxoglutarate dehydrogenase E3 component; lipoami 99.38
3oc4_A 452 Oxidoreductase, pyridine nucleotide-disulfide FAM; 99.37
3l8k_A466 Dihydrolipoyl dehydrogenase; redox-active center, 99.37
1zmd_A474 Dihydrolipoyl dehydrogenase; lipoamide dehydrogena 99.37
1trb_A320 Thioredoxin reductase; oxidoreductase(flavoenzyme) 99.37
3urh_A491 Dihydrolipoyl dehydrogenase; PSI-biology, structur 99.36
3f8d_A323 Thioredoxin reductase (TRXB-3); redox protein, nuc 99.36
3o0h_A484 Glutathione reductase; ssgcid, structur genomics, 99.36
2v3a_A384 Rubredoxin reductase; alkane degradation, NADH oxi 99.36
3cgb_A480 Pyridine nucleotide-disulfide oxidoreductase, CLA; 99.36
2eq6_A464 Pyruvate dehydrogenase complex, dihydrolipoamide d 99.36
3ic9_A 492 Dihydrolipoamide dehydrogenase; APC62701, colwelli 99.35
3klj_A385 NAD(FAD)-dependent dehydrogenase, NIRB-family (N- 99.35
2qae_A468 Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystin 99.35
3dk9_A478 Grase, GR, glutathione reductase; flavoenzyme, nic 99.34
3dgh_A483 TRXR-1, thioredoxin reductase 1, mitochondrial; ox 99.33
1mo9_A 523 ORF3; nucleotide binding motifs, nucleotide bindin 99.32
3r9u_A315 Thioredoxin reductase; structural genomics, center 99.32
3lzw_A332 Ferredoxin--NADP reductase 2; ferredoxin reductase 99.32
1nhp_A447 NADH peroxidase; oxidoreductase (H2O2(A)); HET: FA 99.3
2x8g_A 598 Thioredoxin glutathione reductase; redox-active ce 99.28
4g6h_A502 Rotenone-insensitive NADH-ubiquinone oxidoreducta 99.27
1zk7_A467 HGII, reductase, mercuric reductase; mercuric ION 99.26
3dgz_A488 Thioredoxin reductase 2; oxidoreductase, rossmann, 99.26
4b63_A501 L-ornithine N5 monooxygenase; oxidoreductase, side 99.26
1hyu_A521 AHPF, alkyl hydroperoxide reductase subunit F; thi 99.24
2ywl_A180 Thioredoxin reductase related protein; uncharacter 99.22
1m6i_A 493 Programmed cell death protein 8; apoptosis, AIF, o 99.22
4a5l_A314 Thioredoxin reductase; oxidoreductase, redox metab 99.2
4b1b_A 542 TRXR, thioredoxin reductase; oxidoreductase, FAD, 99.2
3qfa_A 519 Thioredoxin reductase 1, cytoplasmic; protein-prot 99.2
2vdc_G456 Glutamate synthase [NADPH] small chain; oxidoreduc 99.19
3s5w_A463 L-ornithine 5-monooxygenase; class B flavin depend 99.17
3h8l_A409 NADH oxidase; membrane protein, complete form, ros 99.11
4gcm_A312 TRXR, thioredoxin reductase; FAD/NAD-linked reduct 99.06
3k30_A690 Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP bi 99.03
1lqt_A456 FPRA; NADP+ derivative, oxidoreductase, structural 99.03
3sx6_A437 Sulfide-quinone reductase, putative; sulfide:quino 99.02
1cjc_A460 Protein (adrenodoxin reductase); flavoenzyme, MAD 98.94
2gag_A 965 Heterotetrameric sarcosine oxidase alpha-subunit; 98.93
3h28_A430 Sulfide-quinone reductase; monotopic membrane prot 98.91
1gte_A 1025 Dihydropyrimidine dehydrogenase; electron transfer 98.89
1ps9_A671 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel 98.88
1o94_A729 Tmadh, trimethylamine dehydrogenase; electron tran 98.85
2cul_A232 Glucose-inhibited division protein A-related PROT 98.85
4fk1_A304 Putative thioredoxin reductase; structural genomic 98.74
3fbs_A297 Oxidoreductase; structural genomics, PSI2, MCSG, p 98.5
3klj_A 385 NAD(FAD)-dependent dehydrogenase, NIRB-family (N- 98.46
3hyw_A430 Sulfide-quinone reductase; monotopic membrane prot 98.42
3hyw_A 430 Sulfide-quinone reductase; monotopic membrane prot 98.36
3vrd_B401 FCCB subunit, flavocytochrome C flavin subunit; su 98.35
1y56_A493 Hypothetical protein PH1363; dehydrogenase, protei 98.34
3sx6_A 437 Sulfide-quinone reductase, putative; sulfide:quino 98.33
3h8l_A 409 NADH oxidase; membrane protein, complete form, ros 98.31
3fg2_P 404 Putative rubredoxin reductase; ferredoxin reductas 98.25
3f8d_A323 Thioredoxin reductase (TRXB-3); redox protein, nuc 98.25
3lxd_A 415 FAD-dependent pyridine nucleotide-disulphide oxido 98.23
3vrd_B 401 FCCB subunit, flavocytochrome C flavin subunit; su 98.21
3h28_A 430 Sulfide-quinone reductase; monotopic membrane prot 98.21
3ef6_A 410 Toluene 1,2-dioxygenase system ferredoxin--NAD(+) 98.19
4fk1_A304 Putative thioredoxin reductase; structural genomic 98.19
4gcm_A312 TRXR, thioredoxin reductase; FAD/NAD-linked reduct 98.17
1q1r_A 431 Putidaredoxin reductase; glutathione reductase fol 98.14
3lzw_A 332 Ferredoxin--NADP reductase 2; ferredoxin reductase 98.14
1xhc_A 367 NADH oxidase /nitrite reductase; southe collaborat 98.11
2gv8_A 447 Monooxygenase; FMO, FAD, NADPH, cofactor complex, 98.09
2zbw_A 335 Thioredoxin reductase; redox protein, oxidoreducta 98.08
2q7v_A 325 Thioredoxin reductase; rossman fold, FAD, flavopro 98.06
3itj_A338 Thioredoxin reductase 1; disulfide B flavoprotein, 98.06
4a9w_A 357 Monooxygenase; baeyer-villiger, FAD, oxidoreductas 98.04
3uox_A 545 Otemo; baeyer-villiger monooxygenase, oxidoreducta 98.04
3oc4_A 452 Oxidoreductase, pyridine nucleotide-disulfide FAM; 98.04
4ap3_A 549 Steroid monooxygenase; oxidoreductase, baeyer-vill 98.01
4g6h_A 502 Rotenone-insensitive NADH-ubiquinone oxidoreducta 98.01
2gqw_A 408 Ferredoxin reductase; flavoprotein, oxidoreductase 98.0
4a5l_A314 Thioredoxin reductase; oxidoreductase, redox metab 97.99
3kd9_A 449 Coenzyme A disulfide reductase; PSI-II, NYSGXRC, o 97.99
2q0l_A311 TRXR, thioredoxin reductase; bacterial thiredoxin 97.99
3iwa_A 472 FAD-dependent pyridine nucleotide-disulphide oxido 97.98
3ab1_A 360 Ferredoxin--NADP reductase; oxidoreductase, electr 97.97
3l8k_A 466 Dihydrolipoyl dehydrogenase; redox-active center, 97.96
1fl2_A310 Alkyl hydroperoxide reductase subunit F; reactive 97.95
3ntd_A 565 FAD-dependent pyridine nucleotide-disulphide oxido 97.91
3gwf_A 540 Cyclohexanone monooxygenase; flavoprotein biocatal 97.9
1m6i_A 493 Programmed cell death protein 8; apoptosis, AIF, o 97.9
3alj_A 379 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; 97.89
3s5w_A 463 L-ornithine 5-monooxygenase; class B flavin depend 97.88
2xve_A 464 Flavin-containing monooxygenase; oxidoreductase; H 97.86
3r9u_A315 Thioredoxin reductase; structural genomics, center 97.86
3ics_A 588 Coenzyme A-disulfide reductase; pyridine nucleotid 97.83
1nhp_A 447 NADH peroxidase; oxidoreductase (H2O2(A)); HET: FA 97.78
1hyu_A521 AHPF, alkyl hydroperoxide reductase subunit F; thi 97.77
4eqs_A 437 Coenzyme A disulfide reductase; oxidoreductase; HE 97.77
1vdc_A 333 NTR, NADPH dependent thioredoxin reductase; hypoth 97.76
4hb9_A 412 Similarities with probable monooxygenase; flavin, 97.74
1trb_A 320 Thioredoxin reductase; oxidoreductase(flavoenzyme) 97.72
1mo9_A 523 ORF3; nucleotide binding motifs, nucleotide bindin 97.72
2bry_A 497 NEDD9 interacting protein with calponin homology a 97.71
1w4x_A 542 Phenylacetone monooxygenase; baeyer-villiger, FAD; 97.69
2cdu_A 452 NADPH oxidase; flavoenzyme, oxidoreductase; HET: F 97.68
2a87_A 335 TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TL 97.68
2vou_A 397 2,6-dihydroxypyridine hydroxylase; oxidoreductase, 97.66
3cty_A319 Thioredoxin reductase; FAD, oxidoreductase, flavin 97.65
1rp0_A284 ARA6, thiazole biosynthetic enzyme; protein ligand 97.64
2bc0_A 490 NADH oxidase; flavoprotein, pyridine nucleotide di 97.64
1zk7_A 467 HGII, reductase, mercuric reductase; mercuric ION 97.64
2xdo_A 398 TETX2 protein; tetracycline degradation, tigecycli 97.63
3cgb_A 480 Pyridine nucleotide-disulfide oxidoreductase, CLA; 97.61
3rp8_A 407 Flavoprotein monooxygenase; FAD-binding protein, o 97.6
1ges_A 450 Glutathione reductase; oxidoreductase(flavoenzyme) 97.56
2v3a_A 384 Rubredoxin reductase; alkane degradation, NADH oxi 97.55
3dk9_A 478 Grase, GR, glutathione reductase; flavoenzyme, nic 97.55
3d1c_A 369 Flavin-containing putative monooxygenase; NP_37310 97.51
3o0h_A 484 Glutathione reductase; ssgcid, structur genomics, 97.5
2r9z_A 463 Glutathione amide reductase; NAD, FAD, substrate s 97.48
3nlc_A 549 Uncharacterized protein VP0956; FAD-binding protei 97.48
3ic9_A 492 Dihydrolipoamide dehydrogenase; APC62701, colwelli 97.45
1lvl_A 458 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 97.43
4dna_A 463 Probable glutathione reductase; structural genomic 97.41
2hqm_A 479 GR, grase, glutathione reductase; glutathione redu 97.39
3kkj_A 336 Amine oxidase, flavin-containing; oxidoreductase, 97.35
2yqu_A 455 2-oxoglutarate dehydrogenase E3 component; lipoami 97.35
3urh_A 491 Dihydrolipoyl dehydrogenase; PSI-biology, structur 97.29
1o94_A 729 Tmadh, trimethylamine dehydrogenase; electron tran 97.28
2eq6_A 464 Pyruvate dehydrogenase complex, dihydrolipoamide d 97.25
1ebd_A 455 E3BD, dihydrolipoamide dehydrogenase; redox-active 97.23
2qae_A 468 Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystin 97.22
1zmd_A 474 Dihydrolipoyl dehydrogenase; lipoamide dehydrogena 97.21
2wpf_A 495 Trypanothione reductase; oxidoreductase, trypanoso 97.21
1y56_A 493 Hypothetical protein PH1363; dehydrogenase, protei 97.18
3dgh_A 483 TRXR-1, thioredoxin reductase 1, mitochondrial; ox 97.17
3qfa_A 519 Thioredoxin reductase 1, cytoplasmic; protein-prot 97.16
1onf_A 500 GR, grase, glutathione reductase; oxidoreductase; 97.15
1lqt_A 456 FPRA; NADP+ derivative, oxidoreductase, structural 97.12
1fec_A 490 Trypanothione reductase; redox-active center, oxid 97.11
1dxl_A 470 Dihydrolipoamide dehydrogenase; oxidoreductase, mu 97.11
3dgz_A 488 Thioredoxin reductase 2; oxidoreductase, rossmann, 96.98
1ojt_A 482 Surface protein; redox-active center, glycolysis, 96.96
2x8g_A 598 Thioredoxin glutathione reductase; redox-active ce 96.94
2a8x_A 464 Dihydrolipoyl dehydrogenase, E3 component of alpha 96.93
1xdi_A 499 RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno fun 96.93
2gag_A 965 Heterotetrameric sarcosine oxidase alpha-subunit; 96.75
1gte_A 1025 Dihydropyrimidine dehydrogenase; electron transfer 96.73
3oz2_A 397 Digeranylgeranylglycerophospholipid reductase; str 96.63
1yvv_A 336 Amine oxidase, flavin-containing; oxidoreductase, 96.49
4dgk_A 501 Phytoene dehydrogenase; the FAD/NAD(P)-binding ros 96.14
4b1b_A 542 TRXR, thioredoxin reductase; oxidoreductase, FAD, 96.13
3v76_A 417 Flavoprotein; structural genomics, PSI-biology, NE 96.06
1k0i_A 394 P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, h 96.0
2oln_A 397 NIKD protein; flavoprotein, rossmann fold, oxidore 95.99
3nix_A 421 Flavoprotein/dehydrogenase; structural genomics, P 95.98
3c4a_A 381 Probable tryptophan hydroxylase VIOD; alpha-beta p 95.97
3ihm_A 430 Styrene monooxygenase A; rossman fold, anti-parall 95.97
3dme_A 369 Conserved exported protein; structural genomics, P 95.95
2x3n_A 399 Probable FAD-dependent monooxygenase; oxidoreducta 95.92
2gqf_A 401 Hypothetical protein HI0933; structural genomics, 95.91
1ryi_A 382 Glycine oxidase; flavoprotein, protein-inhibitor c 95.9
3cgv_A 397 Geranylgeranyl reductase related protein; NP_39399 95.89
1y56_B 382 Sarcosine oxidase; dehydrogenase, protein-protein 95.89
3atr_A 453 Conserved archaeal protein; saturating double bond 95.88
2vdc_G 456 Glutamate synthase [NADPH] small chain; oxidoreduc 95.88
3c96_A 410 Flavin-containing monooxygenase; FAD, oxidoreducta 95.87
2gf3_A 389 MSOX, monomeric sarcosine oxidase; flavoprotein ox 95.79
2uzz_A 372 N-methyl-L-tryptophan oxidase; N-methyltryptophan 95.78
3ka7_A 425 Oxidoreductase; structural genomics, PSI-2, protei 95.76
3nrn_A 421 Uncharacterized protein PF1083; alpha-beta protein 95.74
4gde_A 513 UDP-galactopyranose mutase; flavin adenine dinucle 95.74
3k7m_X 431 6-hydroxy-L-nicotine oxidase; enantiomeric substra 95.69
2gag_B 405 Heterotetrameric sarcosine oxidase beta-subunit; f 95.69
3qj4_A 342 Renalase; FAD/NAD(P)-binding rossmann fold superfa 95.67
1c0p_A 363 D-amino acid oxidase; alpha-beta-alpha motif, flav 95.66
3g5s_A 443 Methylenetetrahydrofolate--tRNA-(uracil-5-)- methy 95.61
3fpz_A326 Thiazole biosynthetic enzyme; FAD, mitochondrion, 95.6
2i0z_A 447 NAD(FAD)-utilizing dehydrogenases; structural geno 95.59
2b9w_A 424 Putative aminooxidase; isomerase, conjugated linol 95.56
2iid_A 498 L-amino-acid oxidase; flavoenzyme, FAD binding dom 95.55
1y0p_A 571 Fumarate reductase flavoprotein subunit; flavocyto 95.52
3dje_A 438 Fructosyl amine: oxygen oxidoreductase; fructosyl- 95.51
4b63_A 501 L-ornithine N5 monooxygenase; oxidoreductase, side 95.49
3ihg_A 535 RDME; flavoenzyme, anthracycline, polyketide biosy 95.44
3nks_A 477 Protoporphyrinogen oxidase; FAD containing protein 95.44
2bcg_G 453 Secretory pathway GDP dissociation inhibitor; RABG 95.42
2qa1_A 500 PGAE, polyketide oxygenase PGAE; FAD, angucycline, 95.42
2bi7_A 384 UDP-galactopyranose mutase; FAD, flavoprotein, iso 95.41
3k30_A 690 Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP bi 95.4
2qcu_A 501 Aerobic glycerol-3-phosphate dehydrogenase; glycer 95.38
2zxi_A 637 TRNA uridine 5-carboxymethylaminomethyl modificat 95.38
2qa2_A 499 CABE, polyketide oxygenase CABE; FAD, angucycline, 95.31
3i6d_A 470 Protoporphyrinogen oxidase; protein-inhibitor comp 95.3
3lad_A 476 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 95.3
3e1t_A 512 Halogenase; flavoprotein; HET: FAD; 2.05A {Chondro 95.29
2r0c_A 549 REBC; flavin adenine dinucleotide, monooxygenase, 95.27
3jsk_A344 Cypbp37 protein; octameric thiazole synthase, bios 95.26
3ces_A 651 MNMG, tRNA uridine 5-carboxymethylaminomethyl modi 95.26
3g3e_A 351 D-amino-acid oxidase; FAD, flavoprotein, oxidoredu 95.26
3c4n_A 405 Uncharacterized protein DR_0571; alpha-beta protei 95.25
2aqj_A 538 Tryptophan halogenase, pRNA; flavin-dependent halo 95.23
2gjc_A326 Thiazole biosynthetic enzyme, mitochondrial; gluta 95.23
1s3e_A 520 Amine oxidase [flavin-containing] B; human monoami 95.19
3fmw_A 570 Oxygenase; mithramycin, baeyer-villiger, flavin bi 95.18
2jae_A 489 L-amino acid oxidase; oxidoreductase, dimerisation 95.17
3da1_A 561 Glycerol-3-phosphate dehydrogenase; NESG BHR167 Q9 95.14
2ivd_A 478 PPO, PPOX, protoporphyrinogen oxidase; porphyrin b 95.13
1rsg_A 516 FMS1 protein; FAD binding motif, oxidoreductase; H 95.13
2rgh_A 571 Alpha-glycerophosphate oxidase; flavoprotein oxida 95.11
3nyc_A 381 D-arginine dehydrogenase; FAD, imino-arginine, oxi 95.09
3hdq_A 397 UDP-galactopyranose mutase; substrate and inhibito 95.09
3ps9_A 676 TRNA 5-methylaminomethyl-2-thiouridine biosynthes 95.07
1v59_A 478 Dihydrolipoamide dehydrogenase; 2-oxoacid dehydrog 95.04
3pvc_A 689 TRNA 5-methylaminomethyl-2-thiouridine biosynthes 95.04
3cp8_A 641 TRNA uridine 5-carboxymethylaminomethyl modificati 95.03
2yg5_A 453 Putrescine oxidase; oxidoreductase, flavin; HET: F 95.03
1qo8_A 566 Flavocytochrome C3 fumarate reductase; oxidoreduct 95.03
1v0j_A 399 UDP-galactopyranose mutase; flavoprotein, isomeras 95.03
1ps9_A 671 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel 95.01
1i8t_A 367 UDP-galactopyranose mutase; rossman fold, FAD, con 95.01
3axb_A 448 Putative oxidoreductase; dinucleotide-binding fold 94.99
2dkh_A 639 3-hydroxybenzoate hydroxylase; flavoprotein, monoo 94.93
2gmh_A 584 Electron transfer flavoprotein-ubiquinone oxidored 94.89
3i3l_A 591 Alkylhalidase CMLS; flavin-dependent halogenase, c 94.88
2e4g_A 550 Tryptophan halogenase; flavin-binding, rebeccamyci 94.87
2e1m_A 376 L-glutamate oxidase; L-amino acid oxidase, FAD, L- 94.87
2weu_A 511 Tryptophan 5-halogenase; regioselectivity, antifun 94.86
1sez_A 504 Protoporphyrinogen oxidase, mitochondrial; FAD-bin 94.86
4at0_A 510 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidore 94.83
1cjc_A 460 Protein (adrenodoxin reductase); flavoenzyme, MAD 94.79
3lov_A 475 Protoporphyrinogen oxidase; structural genomics, J 94.64
2pyx_A 526 Tryptophan halogenase; structural genomics, JOI fo 94.62
2e5v_A 472 L-aspartate oxidase; archaea, oxidoreductase; HET: 94.31
1d4d_A 572 Flavocytochrome C fumarate reductase; oxidoreducta 94.31
2vvm_A 495 Monoamine oxidase N; FAD, peroxisome, flavoprotein 94.31
1pn0_A 665 Phenol 2-monooxygenase; two dimers, TLS refinement 94.3
4dsg_A 484 UDP-galactopyranose mutase; rossmann fold, flavin 94.25
1chu_A 540 Protein (L-aspartate oxidase); flavoenzyme, NAD bi 94.21
3dfz_A223 SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase 94.2
1pj5_A 830 N,N-dimethylglycine oxidase; channelling, FAD bind 94.14
2wdq_A 588 Succinate dehydrogenase flavoprotein subunit; succ 93.99
1id1_A153 Putative potassium channel protein; RCK domain, E. 93.8
1lss_A140 TRK system potassium uptake protein TRKA homolog; 93.77
3p1w_A 475 Rabgdi protein; GDI RAB, malaria, structural genom 93.76
2g1u_A155 Hypothetical protein TM1088A; structural genomics, 93.75
2bs2_A 660 Quinol-fumarate reductase flavoprotein subunit A; 93.64
1d5t_A 433 Guanine nucleotide dissociation inhibitor; ultra-h 93.6
1kf6_A 602 Fumarate reductase flavoprotein; respiration, fuma 93.56
3pl8_A 623 Pyranose 2-oxidase; substrate complex, H167A mutan 93.56
3ic5_A118 Putative saccharopine dehydrogenase; structural ge 93.55
2h88_A 621 Succinate dehydrogenase flavoprotein subunit; comp 93.47
3fwz_A140 Inner membrane protein YBAL; TRKA-N domain, E.coli 93.43
1kyq_A274 Met8P, siroheme biosynthesis protein Met8; homodim 93.41
3llv_A141 Exopolyphosphatase-related protein; NAD(P)-binding 93.3
2z3y_A 662 Lysine-specific histone demethylase 1; chromatin, 93.26
1jnr_A 643 Adenylylsulfate reductase; oxidoreductase; HET: FA 93.19
1b37_A 472 Protein (polyamine oxidase); flavin-dependent amin 92.88
2xag_A 852 Lysine-specific histone demethylase 1; amine oxida 92.85
4gut_A 776 Lysine-specific histone demethylase 1B; histone de 92.84
3gyx_A 662 Adenylylsulfate reductase; oxidoreductase; HET: FA 92.79
1ju2_A 536 HydroxynitrIle lyase; flavin, GMC oxidoreductase, 92.64
2hmt_A144 YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane 92.33
3t37_A 526 Probable dehydrogenase; BET alpha beta fold, ADP b 92.3
1kdg_A 546 CDH, cellobiose dehydrogenase; GMC oxidoreductase, 92.09
3c85_A183 Putative glutathione-regulated potassium-efflux S 92.07
3hn2_A 312 2-dehydropantoate 2-reductase; PSI-2, NYSGXRC, str 90.74
3l4b_C218 TRKA K+ channel protien TM1088B; potassium channel 90.68
3ayj_A 721 Pro-enzyme of L-phenylalanine oxidase; amino acid 90.66
1n4w_A 504 CHOD, cholesterol oxidase; flavoenzyme, steroid me 90.26
3i83_A 320 2-dehydropantoate 2-reductase; structural genomics 90.13
1coy_A 507 Cholesterol oxidase; oxidoreductase(oxygen recepto 90.12
3q9t_A 577 Choline dehydrogenase and related flavoproteins; g 89.93
1pjq_A 457 CYSG, siroheme synthase; rossman fold, nucleotide 89.57
1ks9_A 291 KPA reductase;, 2-dehydropantoate 2-reductase; PAN 89.3
1gpe_A 587 Protein (glucose oxidase); oxidoreductase(flavopro 89.2
2jbv_A 546 Choline oxidase; alcohol oxidation, flavoenyzme ox 88.83
2raf_A209 Putative dinucleotide-binding oxidoreductase; NP_7 88.8
4e12_A283 Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1 88.78
3ado_A 319 Lambda-crystallin; L-gulonate 3-dehydrogenase, str 88.23
2ew2_A 316 2-dehydropantoate 2-reductase, putative; alpha-str 88.21
3g17_A 294 Similar to 2-dehydropantoate 2-reductase; structur 88.07
1f0y_A 302 HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive 88.03
2vns_A215 Metalloreductase steap3; metal-binding, transmembr 88.02
2x5o_A 439 UDP-N-acetylmuramoylalanine--D-glutamate ligase; A 88.02
3oj0_A144 Glutr, glutamyl-tRNA reductase; structural genomic 87.7
3fim_B 566 ARYL-alcohol oxidase; AAO, lignin degradation, oxi 87.69
1jay_A212 Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossma 87.58
3ghy_A 335 Ketopantoate reductase protein; oxidoreductase, NA 87.44
3lk7_A 451 UDP-N-acetylmuramoylalanine--D-glutamate ligase; a 87.35
1jw9_B249 Molybdopterin biosynthesis MOEB protein; MOEB: mod 87.32
3ius_A286 Uncharacterized conserved protein; APC63810, silic 87.18
3k7m_X431 6-hydroxy-L-nicotine oxidase; enantiomeric substra 87.17
3ew7_A221 LMO0794 protein; Q8Y8U8_lismo, putative NAD-depend 87.0
1vg0_A 650 RAB proteins geranylgeranyltransferase component A 86.99
3qvp_A 583 Glucose oxidase; oxidoreductase; HET: NAG BMA MAN 86.86
1bg6_A 359 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L 86.8
3gpi_A286 NAD-dependent epimerase/dehydratase; structural ge 86.68
1lld_A 319 L-lactate dehydrogenase; oxidoreductase(CHOH (D)-N 86.63
1hdo_A206 Biliverdin IX beta reductase; foetal metabolism, H 86.6
3ego_A 307 Probable 2-dehydropantoate 2-reductase; structural 86.27
3hwr_A 318 2-dehydropantoate 2-reductase; YP_299159.1, PANE/A 86.25
3h2s_A224 Putative NADH-flavin reductase; Q03B84, NESG, LCR1 86.13
3qha_A296 Putative oxidoreductase; seattle structural genomi 86.03
2cvz_A 289 Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase; 85.82
3pdu_A 287 3-hydroxyisobutyrate dehydrogenase family protein; 85.77
3k96_A 356 Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA 85.46
1b0a_A288 Protein (fold bifunctional protein); folate, dehyd 85.1
2gf2_A 296 Hibadh, 3-hydroxyisobutyrate dehydrogenase; struct 84.94
3phh_A269 Shikimate dehydrogenase; shikimate pathway, helico 84.75
1nyt_A271 Shikimate 5-dehydrogenase; alpha/beta domains, WID 84.74
3e8x_A236 Putative NAD-dependent epimerase/dehydratase; stru 84.65
2dpo_A 319 L-gulonate 3-dehydrogenase; structural genomics, N 84.56
1txg_A 335 Glycerol-3-phosphate dehydrogenase [NAD(P)+]; oxid 84.5
2aef_A234 Calcium-gated potassium channel MTHK; rossmann fol 84.25
1a4i_A301 Methylenetetrahydrofolate dehydrogenase / methenyl 84.11
2uyy_A 316 N-PAC protein; long-chain dehydrogenase, cytokine; 84.03
3pef_A 287 6-phosphogluconate dehydrogenase, NAD-binding; gam 83.98
2h78_A 302 Hibadh, 3-hydroxyisobutyrate dehydrogenase; APC601 83.97
1yqg_A263 Pyrroline-5-carboxylate reductase; structural geno 83.92
4b4o_A 298 Epimerase family protein SDR39U1; isomerase; HET: 83.88
3dtt_A245 NADP oxidoreductase; structural genomics, joint ce 83.87
1guz_A 310 Malate dehydrogenase; oxidoreductase, tricarboxyli 83.74
2c2x_A281 Methylenetetrahydrofolate dehydrogenase- methenylt 83.58
4huj_A220 Uncharacterized protein; PSI-biology, nysgrc, stru 83.53
3aw8_A 369 PURK, phosphoribosylaminoimidazole carboxylase, AT 83.46
4g65_A 461 TRK system potassium uptake protein TRKA; structur 83.38
2f1k_A279 Prephenate dehydrogenase; tyrosine synthesis, X-RA 83.29
3i6i_A 346 Putative leucoanthocyanidin reductase 1; rossmann 83.28
1vpd_A 299 Tartronate semialdehyde reductase; structural geno 83.27
3doj_A 310 AT3G25530, dehydrogenase-like protein; gamma-hydro 83.1
4ffl_A 363 PYLC; amino acid, biosynthesis of pyrrolysine, iso 83.07
4dll_A 320 2-hydroxy-3-oxopropionate reductase; structural ge 83.01
3dqp_A219 Oxidoreductase YLBE; alpha-beta protein., structur 83.0
1mv8_A 436 GMD, GDP-mannose 6-dehydrogenase; rossman fold, do 82.86
3l9w_A 413 Glutathione-regulated potassium-efflux system Pro 82.82
3eag_A 326 UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME 82.79
2v6b_A 304 L-LDH, L-lactate dehydrogenase; oxidoreductase, ra 82.72
3cky_A 301 2-hydroxymethyl glutarate dehydrogenase; rossmann 82.72
1hyh_A 309 L-hicdh, L-2-hydroxyisocaproate dehydrogenase; L-2 82.69
2rir_A300 Dipicolinate synthase, A chain; structural genomic 82.58
2pv7_A298 T-protein [includes: chorismate mutase (EC 5.4.99 82.57
3d4o_A293 Dipicolinate synthase subunit A; NP_243269.1, stru 82.47
1p77_A272 Shikimate 5-dehydrogenase; NADPH, oxidoreductase; 82.35
1z82_A 335 Glycerol-3-phosphate dehydrogenase; TM0378, struct 82.27
1yj8_A 375 Glycerol-3-phosphate dehydrogenase; SGPP, structur 82.26
2rcy_A262 Pyrroline carboxylate reductase; malaria, structur 82.17
2ewd_A 317 Lactate dehydrogenase,; protein-substrate_cofactor 82.12
1hdg_O 332 Holo-D-glyceraldehyde-3-phosphate dehydrogenase; o 82.09
1zud_1251 Adenylyltransferase THIF; thiamin, thiazole, prote 82.04
3dhn_A227 NAD-dependent epimerase/dehydratase; reductase, PF 82.04
1qyc_A 308 Phenylcoumaran benzylic ether reductase PT1; NADPH 82.02
3c24_A286 Putative oxidoreductase; YP_511008.1, structural g 81.91
2r6j_A 318 Eugenol synthase 1; phenylpropene, PIP reductase, 81.9
1evy_A 366 Glycerol-3-phosphate dehydrogenase; rossmann fold, 81.77
4dio_A405 NAD(P) transhydrogenase subunit alpha PART 1; stru 81.76
1nvt_A287 Shikimate 5'-dehydrogenase; structural genomics, P 81.73
2gas_A 307 Isoflavone reductase; NADPH-dependent reductase, o 81.7
3c1o_A 321 Eugenol synthase; phenylpropene, PIP reductase, sh 81.68
1zcj_A 463 Peroxisomal bifunctional enzyme; peroxisomal multi 81.57
1edz_A320 5,10-methylenetetrahydrofolate dehydrogenase; nucl 81.53
4ina_A 405 Saccharopine dehydrogenase; structural genomics, P 81.5
3p2y_A381 Alanine dehydrogenase/pyridine nucleotide transhy; 81.45
3g0o_A 303 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine 81.27
2ahr_A259 Putative pyrroline carboxylate reductase; pyrrolin 81.15
1x0v_A 354 GPD-C, GPDH-C, glycerol-3-phosphate dehydrogenase 81.14
3u62_A253 Shikimate dehydrogenase; shikimate pathway, oxidor 81.08
1vl6_A388 Malate oxidoreductase; TM0542, NAD-dependent malic 81.03
3g79_A 478 NDP-N-acetyl-D-galactosaminuronic acid dehydrogen; 81.01
2d5c_A263 AROE, shikimate 5-dehydrogenase; substrate, dimer, 80.96
2qyt_A 317 2-dehydropantoate 2-reductase; APC81190, porphyrom 80.88
3gg2_A 450 Sugar dehydrogenase, UDP-glucose/GDP-mannose dehyd 80.84
3vps_A 321 TUNA, NAD-dependent epimerase/dehydratase; tunicam 80.74
2egg_A297 AROE, shikimate 5-dehydrogenase; dimer, X-RAY diff 80.53
1a5z_A 319 L-lactate dehydrogenase; oxidoreductase, glycolysi 80.4
3gt0_A247 Pyrroline-5-carboxylate reductase; structural geno 80.34
4ezb_A 317 Uncharacterized conserved protein; structural geno 80.34
3d1l_A266 Putative NADP oxidoreductase BF3122; structural ge 80.32
1x13_A401 NAD(P) transhydrogenase subunit alpha; NAD(H)-bind 80.32
3o8q_A281 Shikimate 5-dehydrogenase I alpha; structural geno 80.3
1pzg_A 331 LDH, lactate dehydrogenase; apicomplexa, APAD, tet 80.24
1npy_A271 Hypothetical shikimate 5-dehydrogenase-like protei 80.2
2eez_A369 Alanine dehydrogenase; TTHA0216, structural genomi 80.14
>2xve_A Flavin-containing monooxygenase; oxidoreductase; HET: FAD; 1.99A {Methylophaga aminisulfidivorans} PDB: 2xvf_A* 2xvh_A* 2xvi_A* 2xvj_A* 2xlt_A* 2vqb_A* 2vq7_A* 2xlu_A* 2xlp_A* 2xls_A* 2xlr_A* Back     alignment and structure
Probab=99.97  E-value=1.8e-29  Score=215.24  Aligned_cols=170  Identities=26%  Similarity=0.334  Sum_probs=142.6

Q ss_pred             CEEEEcCCccHHHHHHHHhccCCeEEEEeccCCCCCCCCCCCCCCeEEcceeEEeeCCCeEEEcCCcEEecCEEEEeccc
Q 037525            1 VIILVGSSASAVDICRDLAGVAKEVHLVSRSVADGTYEKQPGFDNMWLHSMIESAHDNGAVVFRNGHTVHADVILHCTGY   80 (182)
Q Consensus         1 ~V~VVG~G~sg~d~A~~l~~~a~~V~l~~r~~~~~~~~~~~~~~~i~~~~~v~~~~~~~~v~~~dg~~~~~D~vi~atG~   80 (182)
                      +|+|||+|+||+|+|.+|++.+++|+++.|++... ...++  .+|...+.|+++.+ ++|+|.||+++++|.||+||||
T Consensus       199 ~VvVVG~G~sg~eiA~~l~~~g~~V~li~~~~~~~-~~~~~--~~V~~~~~V~~i~~-~~V~~~dG~~i~~D~Vi~atG~  274 (464)
T 2xve_A          199 TVLLVGSSYSAEDIGSQCYKYGAKKLISCYRTAPM-GYKWP--ENWDERPNLVRVDT-ENAYFADGSSEKVDAIILCTGY  274 (464)
T ss_dssp             EEEEECCSTTHHHHHHHHHHTTCSEEEEECSSCCC-CCCCC--TTEEECSCEEEECS-SEEEETTSCEEECSEEEECCCB
T ss_pred             EEEEEcCCCCHHHHHHHHHHhCCeEEEEEECCCCC-CCCCC--CceEEcCCeEEEeC-CEEEECCCCEEeCCEEEECCCC
Confidence            58999999999999999999999999999876532 11122  36777789999976 4899999999999999999999


Q ss_pred             ccCCCCCCCCCceecCCC-ccccccccccCCCCCCCEEEEeccCCcccccHHHHHHHHHHHHHcCCCCCCCHHHHHHHHH
Q 037525           81 KYHFPFLETNGIVTMDDN-RVGPLYKHVFPPVLAPWLSFVGLPWKVIPFPLCEYQSKWIAGVLSGQIVLPSQEEMMEDTK  159 (182)
Q Consensus        81 ~~~~~~l~~~~~~~~~~~-~~~~ly~~~~~~~~~p~l~~iG~~~~~~~~~~~e~qa~~ia~~l~g~~~lP~~~~m~~~~~  159 (182)
                      +++++|++...++..+++ .+.++|++++.++ .|+||++|++.....++.++.||+|++++|.|+.+||+.++|.++++
T Consensus       275 ~p~~~~l~~~~gl~~~~~~~v~~~~~~~~~t~-~p~i~aiGd~~~~~~~~~a~~qa~~~a~~l~G~~~lP~~~~m~~~~~  353 (464)
T 2xve_A          275 IHHFPFLNDDLRLVTNNRLWPLNLYKGVVWED-NPKFFYIGMQDQWYSFNMFDAQAWYARDVIMGRLPLPSKEEMKADSM  353 (464)
T ss_dssp             CCCCTTBCTTTCCCCCSSSCCSSEETTTEESS-STTEEECSCSCCSSCHHHHHHHHHHHHHHHTTSSCCCCHHHHHHHHH
T ss_pred             CCCCCCcCcccccccCCCcccccccceEecCC-CCCEEEEeCcccccchHHHHHHHHHHHHHHcCCCCCcCHHHHHHHHH
Confidence            999999986445555554 5557899998887 79999999988777899999999999999999999999999999998


Q ss_pred             HHHHHHHHcCC--CCcceec
Q 037525          160 AFYSTLEASGT--PKRYTHN  177 (182)
Q Consensus       160 ~~~~~~~~~~~--~~~~~~~  177 (182)
                      ++.++  .+++  ++|++|+
T Consensus       354 ~~~~~--~~~~~~~~~~~~~  371 (464)
T 2xve_A          354 AWREK--ELTLVTAEEMYTY  371 (464)
T ss_dssp             HHHHH--HHTCCSHHHHHHH
T ss_pred             HHHHH--hhccCCCCCcccc
Confidence            87774  4444  5777775



>2gv8_A Monooxygenase; FMO, FAD, NADPH, cofactor complex, PSI, structura genomics, protein structure initiative; HET: FAD NDP; 2.10A {Schizosaccharomyces pombe} SCOP: c.3.1.5 c.3.1.5 PDB: 2gvc_A* 1vqw_A* Back     alignment and structure
>3gwf_A Cyclohexanone monooxygenase; flavoprotein biocatalysis baeyer-villiger oxidation green CH monooxygenase, oxidoreductase; HET: FAD NAP; 2.20A {Rhodococcus SP} PDB: 3gwd_A* 3ucl_A* Back     alignment and structure
>3uox_A Otemo; baeyer-villiger monooxygenase, oxidoreductase; HET: FAD; 1.96A {Pseudomonas putida} PDB: 3uov_A* 3uoy_A* 3uoz_A* 3up4_A* 3up5_A* Back     alignment and structure
>4ap3_A Steroid monooxygenase; oxidoreductase, baeyer-villiger; HET: FAD NAP; 2.39A {Rhodococcus rhodochrous} PDB: 4aox_A* 4aos_A* 4ap1_A* Back     alignment and structure
>3d1c_A Flavin-containing putative monooxygenase; NP_373108.1, struc genomics, joint center for structural genomics, JCSG; HET: FAD UNL; 2.40A {Staphylococcus aureus} Back     alignment and structure
>4a9w_A Monooxygenase; baeyer-villiger, FAD, oxidoreductase; HET: FAD; 2.72A {Stenotrophomonas maltophilia} Back     alignment and structure
>1w4x_A Phenylacetone monooxygenase; baeyer-villiger, FAD; HET: FAD; 1.7A {Thermobifida fusca} SCOP: c.3.1.5 c.3.1.5 PDB: 2ylr_A* 2yls_A* 2ylt_A* 2ym1_A* 2ylw_A* 2ym2_A* 2ylx_A* 2ylz_A* Back     alignment and structure
>4eqs_A Coenzyme A disulfide reductase; oxidoreductase; HET: COA FAD; 1.50A {Staphylococcus aureus subsp} PDB: 1yqz_A* 4eqw_A* 4em4_A* 4em3_A* 4eqr_A* 4emw_A* 4eqx_A* Back     alignment and structure
>2gqw_A Ferredoxin reductase; flavoprotein, oxidoreductase; HET: FAD; 1.40A {Pseudomonas SP} PDB: 1f3p_A* 1d7y_A* 2gr0_A* 2gr1_A* 2gr2_A* 2yvf_A* 2yvg_A* 2yvj_A* 2gr3_A* Back     alignment and structure
>2q7v_A Thioredoxin reductase; rossman fold, FAD, flavoprotein, oxidoreductase, redox- active center; HET: FAD; 1.90A {Deinococcus radiodurans} Back     alignment and structure
>3fg2_P Putative rubredoxin reductase; ferredoxin reductase, RPA3782, F flavoprotein, oxidoreductase; HET: FAD; 2.20A {Rhodopseudomonas palustris} Back     alignment and structure
>1onf_A GR, grase, glutathione reductase; oxidoreductase; HET: FAD; 2.60A {Plasmodium falciparum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>3lxd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; glutathione reductase (GR)-like ONFR; HET: FAD; 2.50A {Novosphingobium aromaticivorans} Back     alignment and structure
>2a87_A TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TLS, oxidoreduct structural genomics, PSI, protein structure initiative; HET: FAD NAP; 3.00A {Mycobacterium tuberculosis} Back     alignment and structure
>2bc0_A NADH oxidase; flavoprotein, pyridine nucleotide disulfide oxidoreductase, C(4A)-peroxyflavin, crystallography, conformational dynamics; HET: FAD; 2.00A {Streptococcus pyogenes} PDB: 2bcp_A* 2bc1_A* Back     alignment and structure
>1vdc_A NTR, NADPH dependent thioredoxin reductase; hypothetical protein, redox-active center, oxidoreductase, D oxidoreductase; HET: FAD; 2.50A {Arabidopsis thaliana} SCOP: c.3.1.5 c.3.1.5 PDB: 2whd_A* Back     alignment and structure
>3itj_A Thioredoxin reductase 1; disulfide B flavoprotein, NADP, oxidoreductase, phosphoprotein, redox-A center; HET: FAD CIT; 2.40A {Saccharomyces cerevisiae} PDB: 3d8x_A* Back     alignment and structure
>3ef6_A Toluene 1,2-dioxygenase system ferredoxin--NAD(+) reductase; FAD binding protein, NADH binding protein, aromatic hydrocar catabolism, FAD; HET: FAD; 1.80A {Pseudomonas putida} PDB: 4emi_A* 4emj_A* Back     alignment and structure
>3fbs_A Oxidoreductase; structural genomics, PSI2, MCSG, protein STR initiative, midwest center for structural genomics; HET: FAD; 2.15A {Agrobacterium tumefaciens} Back     alignment and structure
>2hqm_A GR, grase, glutathione reductase; glutathione reductase complexed with FAD, oxidoreductase; HET: NAG FAD GSH; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1ges_A Glutathione reductase; oxidoreductase(flavoenzyme); HET: FAD; 1.74A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1geu_A* 1ger_A* 1get_A* Back     alignment and structure
>3cty_A Thioredoxin reductase; FAD, oxidoreductase, flavin, flavoprotein; HET: FAD; 2.35A {Thermoplasma acidophilum} Back     alignment and structure
>1xhc_A NADH oxidase /nitrite reductase; southe collaboratory for structural genomics, secsg, hyperthermoph protein structure initiative, PSI; HET: FAD; 2.35A {Pyrococcus furiosus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>2q0l_A TRXR, thioredoxin reductase; bacterial thiredoxin reductase, NADP+ B reduced izoalloxazine bending, oxidoreductase; HET: FAD NAP; 1.45A {Helicobacter pylori} PDB: 2q0k_A* 3ish_A* Back     alignment and structure
>2wpf_A Trypanothione reductase; oxidoreductase, trypanosomiasis, sleeping sickness, flavoPro redox-active center; HET: FAD WPF; 1.90A {Trypanosoma brucei} PDB: 2wov_A* 2wow_A* 2wp5_A* 2wp6_A* 2wpc_A* 2wpe_A* 2woi_A* 2wba_A* 1nda_A* 1gxf_A* 1bzl_A* 1aog_A* Back     alignment and structure
>2a8x_A Dihydrolipoyl dehydrogenase, E3 component of alpha; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha keto acid dehydrogenase; HET: FAD; 2.40A {Mycobacterium tuberculosis} PDB: 3ii4_A* Back     alignment and structure
>2r9z_A Glutathione amide reductase; NAD, FAD, substrate specificity, oxidoreductase; HET: FAD; 2.10A {Marichromatium gracile} PDB: 2rab_A* Back     alignment and structure
>1ebd_A E3BD, dihydrolipoamide dehydrogenase; redox-active center, glycolysis, oxidoreductase; HET: FAD; 2.60A {Geobacillus stearothermophilus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>3ntd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; COA, persulfide reductase, rhodanese; HET: COA FAD; 1.99A {Shewanella loihica} PDB: 3nta_A* 3nt6_A* Back     alignment and structure
>1dxl_A Dihydrolipoamide dehydrogenase; oxidoreductase, multienzyme complex protein, pyruvate dehydrogenase complex, glycine decarboxylase complex; HET: FAD; 3.15A {Pisum sativum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>1q1r_A Putidaredoxin reductase; glutathione reductase fold, oxidoreductase; HET: FAD; 1.91A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1q1w_A* 3lb8_A* Back     alignment and structure
>1fec_A Trypanothione reductase; redox-active center, oxidoreductase, flavoprotein, FAD, NADP; HET: FAD; 1.70A {Crithidia fasciculata} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1fea_A* 1feb_A* 2tpr_A* 1tyt_A* 1typ_A* 2jk6_A* 2w0h_A* 2yau_A* 2x50_A* 2ve2_A* Back     alignment and structure
>1xdi_A RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno function; HET: FAD; 2.81A {Mycobacterium tuberculosis} SCOP: c.3.1.5 d.87.1.1 Back     alignment and structure
>1ojt_A Surface protein; redox-active center, glycolysis, oxidoreductase, NAD, flavop FAD, P64K; HET: FAD; 2.75A {Neisseria meningitidis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1bhy_A* Back     alignment and structure
>3iwa_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; structural genomics, PSI-2, protein structur initiative; 2.30A {Desulfovibrio vulgaris} Back     alignment and structure
>2zbw_A Thioredoxin reductase; redox protein, oxidoreductase, structural genomics, NPPSFA, project on protein structural and functional analyses; HET: FAD; 2.10A {Thermus thermophilus} Back     alignment and structure
>2cdu_A NADPH oxidase; flavoenzyme, oxidoreductase; HET: FAD ADP; 1.8A {Lactobacillus sanfranciscensis} Back     alignment and structure
>3ics_A Coenzyme A-disulfide reductase; pyridine nucleotide-disulfide oxidoreductase class I, rhodan coenzyme A, flavin adenine dinucleotide; HET: FAD COA ADP; 1.94A {Bacillus anthracis} PDB: 3icr_A* 3ict_A* Back     alignment and structure
>1v59_A Dihydrolipoamide dehydrogenase; 2-oxoacid dehydroganese complex, pyruvate dehydrogenase complex; HET: FAD NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1jeh_A* Back     alignment and structure
>3lad_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD; 2.20A {Azotobacter vinelandii} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1lpf_A* Back     alignment and structure
>1fl2_A Alkyl hydroperoxide reductase subunit F; reactive oxygen, FAD, disulphi oxidoreductase, oxidoreductase; HET: FAD; 1.90A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 Back     alignment and structure
>4dna_A Probable glutathione reductase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; HET: FAD; 2.80A {Sinorhizobium meliloti} Back     alignment and structure
>1lvl_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD NAD; 2.45A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>3ab1_A Ferredoxin--NADP reductase; oxidoreductase, electron transport, FAD, flavoprotein; HET: FAD; 2.39A {Chlorobaculum tepidum} Back     alignment and structure
>3kd9_A Coenzyme A disulfide reductase; PSI-II, NYSGXRC, oxidoreductase, structural genomics structure initiative; 2.75A {Pyrococcus horikoshii} Back     alignment and structure
>2yqu_A 2-oxoglutarate dehydrogenase E3 component; lipoamide dehydrogenase, 2-oxoglutarate dehydrogenase comple pyruvate dehydrogenase complex; HET: FAD; 1.70A {Thermus thermophilus} PDB: 2eq7_A* Back     alignment and structure
>3oc4_A Oxidoreductase, pyridine nucleotide-disulfide FAM; structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.60A {Enterococcus faecalis} Back     alignment and structure
>3l8k_A Dihydrolipoyl dehydrogenase; redox-active center, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.50A {Sulfolobus solfataricus} Back     alignment and structure
>1zmd_A Dihydrolipoyl dehydrogenase; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha- ketoglutarate dehydrogenase; HET: FAD NAI; 2.08A {Homo sapiens} PDB: 1zmc_A* 2f5z_A* 1zy8_A* 3rnm_A* Back     alignment and structure
>1trb_A Thioredoxin reductase; oxidoreductase(flavoenzyme); HET: FAD; 2.00A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 PDB: 1cl0_A* 1f6m_A* 1tdf_A* 1tde_A* Back     alignment and structure
>3urh_A Dihydrolipoyl dehydrogenase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium; HET: FAD; 1.90A {Sinorhizobium meliloti} Back     alignment and structure
>3f8d_A Thioredoxin reductase (TRXB-3); redox protein, nucleotide binding, FAD, flavoprotein, oxidoreductase; HET: FAD; 1.40A {Sulfolobus solfataricus} PDB: 3f8p_A* 3f8r_A* Back     alignment and structure
>3o0h_A Glutathione reductase; ssgcid, structur genomics, seattle structural genomics center for infectious gluathione reductase, oxidoreductase; HET: FAD; 1.90A {Bartonella henselae} Back     alignment and structure
>2v3a_A Rubredoxin reductase; alkane degradation, NADH oxidoreductase, rubredoxin reductas NAD, flavoprotein, oxidoreductase; HET: FAD; 2.4A {Pseudomonas aeruginosa} PDB: 2v3b_A* Back     alignment and structure
>3cgb_A Pyridine nucleotide-disulfide oxidoreductase, CLA; coenzyme A, flavin adenine dinucleotide, selenomethionine, F flavoprotein; HET: COA FAD; 1.90A {Bacillus anthracis str} PDB: 3cgc_A* 3cgd_A* 3cge_A* Back     alignment and structure
>2eq6_A Pyruvate dehydrogenase complex, dihydrolipoamide dehydrogenase E3 component; oxidoreductase, homodimer, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2eq8_A* 2eq9_A* Back     alignment and structure
>3ic9_A Dihydrolipoamide dehydrogenase; APC62701, colwellia psychrer 34H, structural genomics, PSI-2; HET: FAD; 2.15A {Colwellia psychrerythraea} Back     alignment and structure
>3klj_A NAD(FAD)-dependent dehydrogenase, NIRB-family (N- domain); FAD-binding protein, GR-fold, oxidoreductase; HET: FAD; 2.10A {Clostridium acetobutylicum} Back     alignment and structure
>2qae_A Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystine-oxidoreductase, homodimer; HET: FAD; 1.90A {Trypanosoma cruzi} Back     alignment and structure
>3dk9_A Grase, GR, glutathione reductase; flavoenzyme, nicotinamide, acetylation, alternative initiation, cytoplasm, FAD, flavoprotein, mitochondrion, NADP; HET: SO4 FAD; 0.95A {Homo sapiens} PDB: 1bwc_A* 1gra_A* 1gre_A* 1grf_A* 1grh_A* 1grb_A* 2gh5_A* 1gsn_A* 3dk4_A* 3dk8_A* 3djj_A* 3grs_A* 3sqp_A* 4gr1_A* 2aaq_A* 1dnc_A* 1grg_A* 1grt_A* 1xan_A* 5grt_A* ... Back     alignment and structure
>3dgh_A TRXR-1, thioredoxin reductase 1, mitochondrial; oxidoreductase, rossmann, flavoprotein, alternative initiati mitochondrion, NADP; HET: FAD; 1.75A {Drosophila melanogaster} PDB: 2nvk_X* 3dh9_A* Back     alignment and structure
>1mo9_A ORF3; nucleotide binding motifs, nucleotide binding domain, oxidor; HET: FAD KPC; 1.65A {Xanthobacter autotrophicus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1mok_A* 2c3c_A* 2c3d_A* 3q6j_A* Back     alignment and structure
>3r9u_A Thioredoxin reductase; structural genomics, center for structural genomics of infec diseases, csgid, thioredoxin-disulfide reductase, FAD; HET: FAD; 2.36A {Campylobacter jejuni} Back     alignment and structure
>3lzw_A Ferredoxin--NADP reductase 2; ferredoxin reductase, FAD, NADPH, flavoprotein, oxidor; HET: FAD NAP; 1.80A {Bacillus subtilis} PDB: 3lzx_A* Back     alignment and structure
>1nhp_A NADH peroxidase; oxidoreductase (H2O2(A)); HET: FAD; 2.00A {Enterococcus faecalis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1npx_A* 1joa_A* 2npx_A* 1nhq_A* 1nhs_A* 1nhr_A* 1f8w_A* Back     alignment and structure
>2x8g_A Thioredoxin glutathione reductase; redox-active center, detoxification pathway, oxidoreductase, flavoprotein; HET: FAD PG4; 1.90A {Schistosoma mansoni} PDB: 2x8c_A* 2x8h_A* 2x99_A* 3h4k_A* 2v6o_A* Back     alignment and structure
>4g6h_A Rotenone-insensitive NADH-ubiquinone oxidoreducta mitochondrial; rossmann fold, electron transfer, FAD, oxidoreductase; HET: FAD NAD; 2.26A {Saccharomyces cerevisiae} PDB: 4g6g_A* 4g73_A* 4g74_A* 4g9k_A* 4gap_A* 4gav_A* Back     alignment and structure
>1zk7_A HGII, reductase, mercuric reductase; mercuric ION reductase, oxidoreductase; HET: FAD; 1.60A {Pseudomonas aeruginosa} PDB: 1zx9_A* Back     alignment and structure
>3dgz_A Thioredoxin reductase 2; oxidoreductase, rossmann, flavoprotein, FAD, mitochondrion, redox-active center, selenium, selenocysteine, transit PEPT; HET: FAD NA7; 2.25A {Mus musculus} PDB: 1zkq_A* 1zdl_A* Back     alignment and structure
>4b63_A L-ornithine N5 monooxygenase; oxidoreductase, siderophore, flavin; HET: FAD NAP; 1.90A {Aspergillus fumigatus} PDB: 4b64_A* 4b65_A* 4b66_A* 4b67_A* 4b68_A* 4b69_A* Back     alignment and structure
>1hyu_A AHPF, alkyl hydroperoxide reductase subunit F; thiol-thiolate hydrogen bond, nucleotide binding fold, thior reductase, thioredoxin; HET: FAD; 2.00A {Salmonella typhimurium} SCOP: c.3.1.5 c.3.1.5 c.47.1.2 c.47.1.2 PDB: 1zyn_A 1zyp_A Back     alignment and structure
>2ywl_A Thioredoxin reductase related protein; uncharacterized conserved protein, rossmann fold, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2cvj_A* Back     alignment and structure
>1m6i_A Programmed cell death protein 8; apoptosis, AIF, oxidoreductase; HET: FAD; 1.80A {Homo sapiens} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 3gd3_A* 3gd4_A* 1gv4_A* Back     alignment and structure
>4a5l_A Thioredoxin reductase; oxidoreductase, redox metabolism, oxidative stress; HET: NDP FAD; 1.66A {Entamoeba histolytica} PDB: 4a65_A* Back     alignment and structure
>4b1b_A TRXR, thioredoxin reductase; oxidoreductase, FAD, NADPH, thiol-mediated redox metabolism, pyridine nucleotide-disulfide oxidoreductase; HET: FAD; 2.90A {Plasmodium falciparum} Back     alignment and structure
>3qfa_A Thioredoxin reductase 1, cytoplasmic; protein-protein complex, rossmann fold, HO pyridine nucleotide disulfide oxidoreductase, electron TRAN oxidoreductase; HET: FAD; 2.20A {Homo sapiens} PDB: 3qfb_A* 2j3n_A* 2zzc_A* 2zzb_A* 2zz0_A* 2cfy_A* 1h6v_A* 3ean_A* 3eao_A* Back     alignment and structure
>2vdc_G Glutamate synthase [NADPH] small chain; oxidoreductase, amidotransferase, ammonia assimilation, iron, zymogen; HET: OMT FMN AKG FAD; 9.50A {Azospirillum brasilense} Back     alignment and structure
>3s5w_A L-ornithine 5-monooxygenase; class B flavin dependent N-hydroxylating monooxygenase, CLAS flavin dependent monooxygenase N-hydroxylating; HET: FAD ONH NAP; 1.90A {Pseudomonas aeruginosa} PDB: 3s61_A* Back     alignment and structure
>3h8l_A NADH oxidase; membrane protein, complete form, rossman-like fold, oxidoreductase; HET: FAD; 2.57A {Acidianus ambivalens} PDB: 3h8i_A* Back     alignment and structure
>4gcm_A TRXR, thioredoxin reductase; FAD/NAD-linked reductases, PYR redox 2 family, structural GE joint center for structural genomics, JCSG; HET: MSE FAD NAP EPE; 1.80A {Staphylococcus aureus subsp} Back     alignment and structure
>3k30_A Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP binding site, oxidoreductase; HET: FMN ADP; 2.70A {Pimelobacter simplex} Back     alignment and structure
>1lqt_A FPRA; NADP+ derivative, oxidoreductase, structural G PSI, protein structure initiative, TB structural genomics consortium, TBSGC; HET: FAD ODP; 1.05A {Mycobacterium tuberculosis} SCOP: c.3.1.1 c.4.1.1 PDB: 1lqu_A* 2c7g_A* Back     alignment and structure
>3sx6_A Sulfide-quinone reductase, putative; sulfide:quinone oxidoreductase, Cys356Ala variant, integral membrane protein; HET: FAD LMT DCQ; 1.80A {Acidithiobacillus ferrooxidans} PDB: 3t0k_A* 3szc_A* 3sz0_A* 3t2z_A* 3t31_A* 3sy4_A* 3syi_A* 3sxi_A* 3t14_A* 3t2k_A* 3szw_A* 3szf_A* 3kpg_A* 3kpi_A* 3t2y_A* 3kpk_A* Back     alignment and structure
>1cjc_A Protein (adrenodoxin reductase); flavoenzyme, MAD analysis, electron transferase, oxidoreductase; HET: FAD; 1.70A {Bos taurus} SCOP: c.3.1.1 c.4.1.1 PDB: 1e1k_A* 1e1l_A* 1e1m_A* 1e1n_A* 1e6e_A* Back     alignment and structure
>2gag_A Heterotetrameric sarcosine oxidase alpha-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_A* 1x31_A* 1vrq_A* 3ad7_A* 3ad8_A* 3ad9_A* 3ada_A* Back     alignment and structure
>1gte_A Dihydropyrimidine dehydrogenase; electron transfer, flavin, iron-sulfur clusters, pyrimidine catabolism, 5-fluorouracil degradation, oxidoreductase; HET: FMN FAD; 1.65A {Sus scrofa} SCOP: a.1.2.2 c.1.4.1 c.3.1.1 c.4.1.1 d.58.1.5 PDB: 1gt8_A* 1gth_A* 1h7w_A* 1h7x_A* Back     alignment and structure
>1ps9_A 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel, flavodoxin, flavin, electron transfer, hydride transfer, oxidoreductase; HET: FAD FMN NAP MDE; 2.20A {Escherichia coli} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 Back     alignment and structure
>1o94_A Tmadh, trimethylamine dehydrogenase; electron transport, protein complex; HET: FMN ADP AMP; 2.0A {Methylophilus methylotrophus} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 PDB: 1djn_A* 1o95_A* 2tmd_A* 1djq_A* Back     alignment and structure
>2cul_A Glucose-inhibited division protein A-related PROT probable oxidoreductase; rossmann fold, protein-FAD complex; HET: FAD; 1.65A {Thermus thermophilus} SCOP: c.3.1.7 Back     alignment and structure
>4fk1_A Putative thioredoxin reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: MSE FAD; 2.40A {Bacillus anthracis} PDB: 4fk1_C* Back     alignment and structure
>3fbs_A Oxidoreductase; structural genomics, PSI2, MCSG, protein STR initiative, midwest center for structural genomics; HET: FAD; 2.15A {Agrobacterium tumefaciens} Back     alignment and structure
>3klj_A NAD(FAD)-dependent dehydrogenase, NIRB-family (N- domain); FAD-binding protein, GR-fold, oxidoreductase; HET: FAD; 2.10A {Clostridium acetobutylicum} Back     alignment and structure
>3hyw_A Sulfide-quinone reductase; monotopic membrane protein, flavoprotein, polysulfur, oxidoreductase; HET: FAD DCQ LMT; 2.00A {Aquifex aeolicus} PDB: 3hyv_A* 3hyx_A* Back     alignment and structure
>3hyw_A Sulfide-quinone reductase; monotopic membrane protein, flavoprotein, polysulfur, oxidoreductase; HET: FAD DCQ LMT; 2.00A {Aquifex aeolicus} PDB: 3hyv_A* 3hyx_A* Back     alignment and structure
>3vrd_B FCCB subunit, flavocytochrome C flavin subunit; sulfide oxidation, heme C binding, FAD binding, electron TRA oxidoreductase complex; HET: HEC FAD; 1.50A {Thermochromatium tepidum} PDB: 1fcd_A* Back     alignment and structure
>1y56_A Hypothetical protein PH1363; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} Back     alignment and structure
>3sx6_A Sulfide-quinone reductase, putative; sulfide:quinone oxidoreductase, Cys356Ala variant, integral membrane protein; HET: FAD LMT DCQ; 1.80A {Acidithiobacillus ferrooxidans} PDB: 3t0k_A* 3szc_A* 3sz0_A* 3t2z_A* 3t31_A* 3sy4_A* 3syi_A* 3sxi_A* 3t14_A* 3t2k_A* 3szw_A* 3szf_A* 3kpg_A* 3kpi_A* 3t2y_A* 3kpk_A* Back     alignment and structure
>3h8l_A NADH oxidase; membrane protein, complete form, rossman-like fold, oxidoreductase; HET: FAD; 2.57A {Acidianus ambivalens} PDB: 3h8i_A* Back     alignment and structure
>3fg2_P Putative rubredoxin reductase; ferredoxin reductase, RPA3782, F flavoprotein, oxidoreductase; HET: FAD; 2.20A {Rhodopseudomonas palustris} Back     alignment and structure
>3f8d_A Thioredoxin reductase (TRXB-3); redox protein, nucleotide binding, FAD, flavoprotein, oxidoreductase; HET: FAD; 1.40A {Sulfolobus solfataricus} PDB: 3f8p_A* 3f8r_A* Back     alignment and structure
>3lxd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; glutathione reductase (GR)-like ONFR; HET: FAD; 2.50A {Novosphingobium aromaticivorans} Back     alignment and structure
>3vrd_B FCCB subunit, flavocytochrome C flavin subunit; sulfide oxidation, heme C binding, FAD binding, electron TRA oxidoreductase complex; HET: HEC FAD; 1.50A {Thermochromatium tepidum} PDB: 1fcd_A* Back     alignment and structure
>3ef6_A Toluene 1,2-dioxygenase system ferredoxin--NAD(+) reductase; FAD binding protein, NADH binding protein, aromatic hydrocar catabolism, FAD; HET: FAD; 1.80A {Pseudomonas putida} PDB: 4emi_A* 4emj_A* Back     alignment and structure
>4fk1_A Putative thioredoxin reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: MSE FAD; 2.40A {Bacillus anthracis} PDB: 4fk1_C* Back     alignment and structure
>4gcm_A TRXR, thioredoxin reductase; FAD/NAD-linked reductases, PYR redox 2 family, structural GE joint center for structural genomics, JCSG; HET: MSE FAD NAP EPE; 1.80A {Staphylococcus aureus subsp} Back     alignment and structure
>1q1r_A Putidaredoxin reductase; glutathione reductase fold, oxidoreductase; HET: FAD; 1.91A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1q1w_A* 3lb8_A* Back     alignment and structure
>3lzw_A Ferredoxin--NADP reductase 2; ferredoxin reductase, FAD, NADPH, flavoprotein, oxidor; HET: FAD NAP; 1.80A {Bacillus subtilis} PDB: 3lzx_A* Back     alignment and structure
>1xhc_A NADH oxidase /nitrite reductase; southe collaboratory for structural genomics, secsg, hyperthermoph protein structure initiative, PSI; HET: FAD; 2.35A {Pyrococcus furiosus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>2gv8_A Monooxygenase; FMO, FAD, NADPH, cofactor complex, PSI, structura genomics, protein structure initiative; HET: FAD NDP; 2.10A {Schizosaccharomyces pombe} SCOP: c.3.1.5 c.3.1.5 PDB: 2gvc_A* 1vqw_A* Back     alignment and structure
>2zbw_A Thioredoxin reductase; redox protein, oxidoreductase, structural genomics, NPPSFA, project on protein structural and functional analyses; HET: FAD; 2.10A {Thermus thermophilus} Back     alignment and structure
>2q7v_A Thioredoxin reductase; rossman fold, FAD, flavoprotein, oxidoreductase, redox- active center; HET: FAD; 1.90A {Deinococcus radiodurans} Back     alignment and structure
>3itj_A Thioredoxin reductase 1; disulfide B flavoprotein, NADP, oxidoreductase, phosphoprotein, redox-A center; HET: FAD CIT; 2.40A {Saccharomyces cerevisiae} PDB: 3d8x_A* Back     alignment and structure
>4a9w_A Monooxygenase; baeyer-villiger, FAD, oxidoreductase; HET: FAD; 2.72A {Stenotrophomonas maltophilia} Back     alignment and structure
>3uox_A Otemo; baeyer-villiger monooxygenase, oxidoreductase; HET: FAD; 1.96A {Pseudomonas putida} PDB: 3uov_A* 3uoy_A* 3uoz_A* 3up4_A* 3up5_A* Back     alignment and structure
>3oc4_A Oxidoreductase, pyridine nucleotide-disulfide FAM; structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.60A {Enterococcus faecalis} Back     alignment and structure
>4ap3_A Steroid monooxygenase; oxidoreductase, baeyer-villiger; HET: FAD NAP; 2.39A {Rhodococcus rhodochrous} PDB: 4aox_A* 4aos_A* 4ap1_A* Back     alignment and structure
>4g6h_A Rotenone-insensitive NADH-ubiquinone oxidoreducta mitochondrial; rossmann fold, electron transfer, FAD, oxidoreductase; HET: FAD NAD; 2.26A {Saccharomyces cerevisiae} PDB: 4g6g_A* 4g73_A* 4g74_A* 4g9k_A* 4gap_A* 4gav_A* Back     alignment and structure
>2gqw_A Ferredoxin reductase; flavoprotein, oxidoreductase; HET: FAD; 1.40A {Pseudomonas SP} PDB: 1f3p_A* 1d7y_A* 2gr0_A* 2gr1_A* 2gr2_A* 2yvf_A* 2yvg_A* 2yvj_A* 2gr3_A* Back     alignment and structure
>4a5l_A Thioredoxin reductase; oxidoreductase, redox metabolism, oxidative stress; HET: NDP FAD; 1.66A {Entamoeba histolytica} PDB: 4a65_A* Back     alignment and structure
>3kd9_A Coenzyme A disulfide reductase; PSI-II, NYSGXRC, oxidoreductase, structural genomics structure initiative; 2.75A {Pyrococcus horikoshii} Back     alignment and structure
>2q0l_A TRXR, thioredoxin reductase; bacterial thiredoxin reductase, NADP+ B reduced izoalloxazine bending, oxidoreductase; HET: FAD NAP; 1.45A {Helicobacter pylori} PDB: 2q0k_A* 3ish_A* Back     alignment and structure
>3iwa_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; structural genomics, PSI-2, protein structur initiative; 2.30A {Desulfovibrio vulgaris} Back     alignment and structure
>3ab1_A Ferredoxin--NADP reductase; oxidoreductase, electron transport, FAD, flavoprotein; HET: FAD; 2.39A {Chlorobaculum tepidum} Back     alignment and structure
>3l8k_A Dihydrolipoyl dehydrogenase; redox-active center, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.50A {Sulfolobus solfataricus} Back     alignment and structure
>1fl2_A Alkyl hydroperoxide reductase subunit F; reactive oxygen, FAD, disulphi oxidoreductase, oxidoreductase; HET: FAD; 1.90A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 Back     alignment and structure
>3ntd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; COA, persulfide reductase, rhodanese; HET: COA FAD; 1.99A {Shewanella loihica} PDB: 3nta_A* 3nt6_A* Back     alignment and structure
>3gwf_A Cyclohexanone monooxygenase; flavoprotein biocatalysis baeyer-villiger oxidation green CH monooxygenase, oxidoreductase; HET: FAD NAP; 2.20A {Rhodococcus SP} PDB: 3gwd_A* 3ucl_A* Back     alignment and structure
>1m6i_A Programmed cell death protein 8; apoptosis, AIF, oxidoreductase; HET: FAD; 1.80A {Homo sapiens} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 3gd3_A* 3gd4_A* 1gv4_A* Back     alignment and structure
>3alj_A 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; alpha/beta fold, oxidoreductase; HET: FAD; 1.48A {Mesorhizobium loti} PDB: 3alh_A* 3ali_A* 3gmb_A* 3gmc_A* 3alk_A* 3alm_A* 3all_A* Back     alignment and structure
>3s5w_A L-ornithine 5-monooxygenase; class B flavin dependent N-hydroxylating monooxygenase, CLAS flavin dependent monooxygenase N-hydroxylating; HET: FAD ONH NAP; 1.90A {Pseudomonas aeruginosa} PDB: 3s61_A* Back     alignment and structure
>2xve_A Flavin-containing monooxygenase; oxidoreductase; HET: FAD; 1.99A {Methylophaga aminisulfidivorans} PDB: 2xvf_A* 2xvh_A* 2xvi_A* 2xvj_A* 2xlt_A* 2vqb_A* 2vq7_A* 2xlu_A* 2xlp_A* 2xls_A* 2xlr_A* Back     alignment and structure
>3r9u_A Thioredoxin reductase; structural genomics, center for structural genomics of infec diseases, csgid, thioredoxin-disulfide reductase, FAD; HET: FAD; 2.36A {Campylobacter jejuni} Back     alignment and structure
>3ics_A Coenzyme A-disulfide reductase; pyridine nucleotide-disulfide oxidoreductase class I, rhodan coenzyme A, flavin adenine dinucleotide; HET: FAD COA ADP; 1.94A {Bacillus anthracis} PDB: 3icr_A* 3ict_A* Back     alignment and structure
>1nhp_A NADH peroxidase; oxidoreductase (H2O2(A)); HET: FAD; 2.00A {Enterococcus faecalis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1npx_A* 1joa_A* 2npx_A* 1nhq_A* 1nhs_A* 1nhr_A* 1f8w_A* Back     alignment and structure
>1hyu_A AHPF, alkyl hydroperoxide reductase subunit F; thiol-thiolate hydrogen bond, nucleotide binding fold, thior reductase, thioredoxin; HET: FAD; 2.00A {Salmonella typhimurium} SCOP: c.3.1.5 c.3.1.5 c.47.1.2 c.47.1.2 PDB: 1zyn_A 1zyp_A Back     alignment and structure
>4eqs_A Coenzyme A disulfide reductase; oxidoreductase; HET: COA FAD; 1.50A {Staphylococcus aureus subsp} PDB: 1yqz_A* 4eqw_A* 4em4_A* 4em3_A* 4eqr_A* 4emw_A* 4eqx_A* Back     alignment and structure
>1vdc_A NTR, NADPH dependent thioredoxin reductase; hypothetical protein, redox-active center, oxidoreductase, D oxidoreductase; HET: FAD; 2.50A {Arabidopsis thaliana} SCOP: c.3.1.5 c.3.1.5 PDB: 2whd_A* Back     alignment and structure
>4hb9_A Similarities with probable monooxygenase; flavin, structural genomics, NEW YORK structural genomics RE consortium, nysgrc, PSI; HET: MSE FAD; 1.93A {Photorhabdus luminescens} Back     alignment and structure
>1trb_A Thioredoxin reductase; oxidoreductase(flavoenzyme); HET: FAD; 2.00A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 PDB: 1cl0_A* 1f6m_A* 1tdf_A* 1tde_A* Back     alignment and structure
>1mo9_A ORF3; nucleotide binding motifs, nucleotide binding domain, oxidor; HET: FAD KPC; 1.65A {Xanthobacter autotrophicus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1mok_A* 2c3c_A* 2c3d_A* 3q6j_A* Back     alignment and structure
>2bry_A NEDD9 interacting protein with calponin homology and LIM domains; transport, coiled coil, cytoskeleton, FAD, flavoprotein, metal-binding, zinc; HET: FAD; 1.45A {Mus musculus} PDB: 2c4c_A* 2bra_A* Back     alignment and structure
>1w4x_A Phenylacetone monooxygenase; baeyer-villiger, FAD; HET: FAD; 1.7A {Thermobifida fusca} SCOP: c.3.1.5 c.3.1.5 PDB: 2ylr_A* 2yls_A* 2ylt_A* 2ym1_A* 2ylw_A* 2ym2_A* 2ylx_A* 2ylz_A* Back     alignment and structure
>2cdu_A NADPH oxidase; flavoenzyme, oxidoreductase; HET: FAD ADP; 1.8A {Lactobacillus sanfranciscensis} Back     alignment and structure
>2a87_A TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TLS, oxidoreduct structural genomics, PSI, protein structure initiative; HET: FAD NAP; 3.00A {Mycobacterium tuberculosis} Back     alignment and structure
>2vou_A 2,6-dihydroxypyridine hydroxylase; oxidoreductase, aromatic hydroxylase, nicotine degradation, mono-oxygenase; HET: FAD; 2.6A {Arthrobacter nicotinovorans} SCOP: c.3.1.2 d.16.1.2 Back     alignment and structure
>3cty_A Thioredoxin reductase; FAD, oxidoreductase, flavin, flavoprotein; HET: FAD; 2.35A {Thermoplasma acidophilum} Back     alignment and structure
>1rp0_A ARA6, thiazole biosynthetic enzyme; protein ligand complex, biosynthetic protein; HET: AHZ HTO; 1.60A {Arabidopsis thaliana} SCOP: c.3.1.6 Back     alignment and structure
>1zk7_A HGII, reductase, mercuric reductase; mercuric ION reductase, oxidoreductase; HET: FAD; 1.60A {Pseudomonas aeruginosa} PDB: 1zx9_A* Back     alignment and structure
>2xdo_A TETX2 protein; tetracycline degradation, tigecycline, flavin, bacteroides F oxidoreductase; HET: FAD; 2.09A {Bacteroides thetaiotaomicron} PDB: 2y6q_A* 2xyo_A* 2y6r_A* 3p9u_A* Back     alignment and structure
>3cgb_A Pyridine nucleotide-disulfide oxidoreductase, CLA; coenzyme A, flavin adenine dinucleotide, selenomethionine, F flavoprotein; HET: COA FAD; 1.90A {Bacillus anthracis str} PDB: 3cgc_A* 3cgd_A* 3cge_A* Back     alignment and structure
>3rp8_A Flavoprotein monooxygenase; FAD-binding protein, oxidoreductase; HET: FAD; 1.97A {Klebsiella pneumoniae} PDB: 3rp7_A* 3rp6_A* Back     alignment and structure
>1ges_A Glutathione reductase; oxidoreductase(flavoenzyme); HET: FAD; 1.74A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1geu_A* 1ger_A* 1get_A* Back     alignment and structure
>2v3a_A Rubredoxin reductase; alkane degradation, NADH oxidoreductase, rubredoxin reductas NAD, flavoprotein, oxidoreductase; HET: FAD; 2.4A {Pseudomonas aeruginosa} PDB: 2v3b_A* Back     alignment and structure
>3dk9_A Grase, GR, glutathione reductase; flavoenzyme, nicotinamide, acetylation, alternative initiation, cytoplasm, FAD, flavoprotein, mitochondrion, NADP; HET: SO4 FAD; 0.95A {Homo sapiens} PDB: 1bwc_A* 1gra_A* 1gre_A* 1grf_A* 1grh_A* 1grb_A* 2gh5_A* 1gsn_A* 3dk4_A* 3dk8_A* 3djj_A* 3grs_A* 3sqp_A* 4gr1_A* 2aaq_A* 1dnc_A* 1grg_A* 1grt_A* 1xan_A* 5grt_A* ... Back     alignment and structure
>3d1c_A Flavin-containing putative monooxygenase; NP_373108.1, struc genomics, joint center for structural genomics, JCSG; HET: FAD UNL; 2.40A {Staphylococcus aureus} Back     alignment and structure
>3o0h_A Glutathione reductase; ssgcid, structur genomics, seattle structural genomics center for infectious gluathione reductase, oxidoreductase; HET: FAD; 1.90A {Bartonella henselae} Back     alignment and structure
>2r9z_A Glutathione amide reductase; NAD, FAD, substrate specificity, oxidoreductase; HET: FAD; 2.10A {Marichromatium gracile} PDB: 2rab_A* Back     alignment and structure
>3nlc_A Uncharacterized protein VP0956; FAD-binding protein, NESG, structural genomics, PSI-2, prote structure initiative; HET: FAD; 2.15A {Vibrio parahaemolyticus} Back     alignment and structure
>3ic9_A Dihydrolipoamide dehydrogenase; APC62701, colwellia psychrer 34H, structural genomics, PSI-2; HET: FAD; 2.15A {Colwellia psychrerythraea} Back     alignment and structure
>1lvl_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD NAD; 2.45A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>4dna_A Probable glutathione reductase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; HET: FAD; 2.80A {Sinorhizobium meliloti} Back     alignment and structure
>2hqm_A GR, grase, glutathione reductase; glutathione reductase complexed with FAD, oxidoreductase; HET: NAG FAD GSH; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3kkj_A Amine oxidase, flavin-containing; oxidoreductase, PSR10, Q888A4, X-RAY, structure, PSI, protein structure initiative; HET: FAD; 2.50A {Pseudomonas syringae PV} Back     alignment and structure
>2yqu_A 2-oxoglutarate dehydrogenase E3 component; lipoamide dehydrogenase, 2-oxoglutarate dehydrogenase comple pyruvate dehydrogenase complex; HET: FAD; 1.70A {Thermus thermophilus} PDB: 2eq7_A* Back     alignment and structure
>3urh_A Dihydrolipoyl dehydrogenase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium; HET: FAD; 1.90A {Sinorhizobium meliloti} Back     alignment and structure
>1o94_A Tmadh, trimethylamine dehydrogenase; electron transport, protein complex; HET: FMN ADP AMP; 2.0A {Methylophilus methylotrophus} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 PDB: 1djn_A* 1o95_A* 2tmd_A* 1djq_A* Back     alignment and structure
>2eq6_A Pyruvate dehydrogenase complex, dihydrolipoamide dehydrogenase E3 component; oxidoreductase, homodimer, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2eq8_A* 2eq9_A* Back     alignment and structure
>1ebd_A E3BD, dihydrolipoamide dehydrogenase; redox-active center, glycolysis, oxidoreductase; HET: FAD; 2.60A {Geobacillus stearothermophilus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>2qae_A Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystine-oxidoreductase, homodimer; HET: FAD; 1.90A {Trypanosoma cruzi} Back     alignment and structure
>1zmd_A Dihydrolipoyl dehydrogenase; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha- ketoglutarate dehydrogenase; HET: FAD NAI; 2.08A {Homo sapiens} PDB: 1zmc_A* 2f5z_A* 1zy8_A* 3rnm_A* Back     alignment and structure
>2wpf_A Trypanothione reductase; oxidoreductase, trypanosomiasis, sleeping sickness, flavoPro redox-active center; HET: FAD WPF; 1.90A {Trypanosoma brucei} PDB: 2wov_A* 2wow_A* 2wp5_A* 2wp6_A* 2wpc_A* 2wpe_A* 2woi_A* 2wba_A* 1nda_A* 1gxf_A* 1bzl_A* 1aog_A* Back     alignment and structure
>1y56_A Hypothetical protein PH1363; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} Back     alignment and structure
>3dgh_A TRXR-1, thioredoxin reductase 1, mitochondrial; oxidoreductase, rossmann, flavoprotein, alternative initiati mitochondrion, NADP; HET: FAD; 1.75A {Drosophila melanogaster} PDB: 2nvk_X* 3dh9_A* Back     alignment and structure
>3qfa_A Thioredoxin reductase 1, cytoplasmic; protein-protein complex, rossmann fold, HO pyridine nucleotide disulfide oxidoreductase, electron TRAN oxidoreductase; HET: FAD; 2.20A {Homo sapiens} PDB: 3qfb_A* 2j3n_A* 2zzc_A* 2zzb_A* 2zz0_A* 2cfy_A* 1h6v_A* 3ean_A* 3eao_A* Back     alignment and structure
>1onf_A GR, grase, glutathione reductase; oxidoreductase; HET: FAD; 2.60A {Plasmodium falciparum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>1lqt_A FPRA; NADP+ derivative, oxidoreductase, structural G PSI, protein structure initiative, TB structural genomics consortium, TBSGC; HET: FAD ODP; 1.05A {Mycobacterium tuberculosis} SCOP: c.3.1.1 c.4.1.1 PDB: 1lqu_A* 2c7g_A* Back     alignment and structure
>1fec_A Trypanothione reductase; redox-active center, oxidoreductase, flavoprotein, FAD, NADP; HET: FAD; 1.70A {Crithidia fasciculata} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1fea_A* 1feb_A* 2tpr_A* 1tyt_A* 1typ_A* 2jk6_A* 2w0h_A* 2yau_A* 2x50_A* 2ve2_A* Back     alignment and structure
>1dxl_A Dihydrolipoamide dehydrogenase; oxidoreductase, multienzyme complex protein, pyruvate dehydrogenase complex, glycine decarboxylase complex; HET: FAD; 3.15A {Pisum sativum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>3dgz_A Thioredoxin reductase 2; oxidoreductase, rossmann, flavoprotein, FAD, mitochondrion, redox-active center, selenium, selenocysteine, transit PEPT; HET: FAD NA7; 2.25A {Mus musculus} PDB: 1zkq_A* 1zdl_A* Back     alignment and structure
>1ojt_A Surface protein; redox-active center, glycolysis, oxidoreductase, NAD, flavop FAD, P64K; HET: FAD; 2.75A {Neisseria meningitidis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1bhy_A* Back     alignment and structure
>2x8g_A Thioredoxin glutathione reductase; redox-active center, detoxification pathway, oxidoreductase, flavoprotein; HET: FAD PG4; 1.90A {Schistosoma mansoni} PDB: 2x8c_A* 2x8h_A* 2x99_A* 3h4k_A* 2v6o_A* Back     alignment and structure
>2a8x_A Dihydrolipoyl dehydrogenase, E3 component of alpha; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha keto acid dehydrogenase; HET: FAD; 2.40A {Mycobacterium tuberculosis} PDB: 3ii4_A* Back     alignment and structure
>1xdi_A RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno function; HET: FAD; 2.81A {Mycobacterium tuberculosis} SCOP: c.3.1.5 d.87.1.1 Back     alignment and structure
>2gag_A Heterotetrameric sarcosine oxidase alpha-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_A* 1x31_A* 1vrq_A* 3ad7_A* 3ad8_A* 3ad9_A* 3ada_A* Back     alignment and structure
>1gte_A Dihydropyrimidine dehydrogenase; electron transfer, flavin, iron-sulfur clusters, pyrimidine catabolism, 5-fluorouracil degradation, oxidoreductase; HET: FMN FAD; 1.65A {Sus scrofa} SCOP: a.1.2.2 c.1.4.1 c.3.1.1 c.4.1.1 d.58.1.5 PDB: 1gt8_A* 1gth_A* 1h7w_A* 1h7x_A* Back     alignment and structure
>3oz2_A Digeranylgeranylglycerophospholipid reductase; structural genomics, joint center for structural genomics; HET: MSE FAD OZ2; 1.60A {Thermoplasma acidophilum} Back     alignment and structure
>4dgk_A Phytoene dehydrogenase; the FAD/NAD(P)-binding rossmann fold, oxidoreductase; 2.35A {Pantoea ananatis} Back     alignment and structure
>4b1b_A TRXR, thioredoxin reductase; oxidoreductase, FAD, NADPH, thiol-mediated redox metabolism, pyridine nucleotide-disulfide oxidoreductase; HET: FAD; 2.90A {Plasmodium falciparum} Back     alignment and structure
>3v76_A Flavoprotein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: FDA; 2.51A {Sinorhizobium meliloti} Back     alignment and structure
>1k0i_A P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, hydrolase; HET: FAD PHB; 1.80A {Pseudomonas aeruginosa} SCOP: c.3.1.2 d.16.1.2 PDB: 1k0j_A* 1k0l_A* 1doc_A* 1d7l_A* 1dod_A* 1doe_A* 1ius_A* 1iut_A* 1iuu_A* 1iuv_A* 1iuw_A* 1iux_A* 1pxb_A* 1pxc_A* 1dob_A* 1ykj_A* 1pxa_A* 1pbe_A* 1pdh_A* 1phh_A* ... Back     alignment and structure
>2oln_A NIKD protein; flavoprotein, rossmann fold, oxidoreductase; HET: FAD; 1.15A {Streptomyces tendae} PDB: 2olo_A* 3hzl_A* 2q6u_A* Back     alignment and structure
>3nix_A Flavoprotein/dehydrogenase; structural genomics, PSI-2, NES protein structure initiative, northeast structural genomics consortium; HET: FAD; 2.60A {Cytophaga hutchinsonii} Back     alignment and structure
>3c4a_A Probable tryptophan hydroxylase VIOD; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.30A {Chromobacterium violaceum atcc 12472} Back     alignment and structure
>3ihm_A Styrene monooxygenase A; rossman fold, anti-parallel beta strands, dimer, cavity, oxidoreductase; 2.30A {Pseudomonas putida} Back     alignment and structure
>3dme_A Conserved exported protein; structural genomics, PSI-2, PROT structure initiative, northeast structural genomics consort NESG; HET: FAD TLA; 1.70A {Bordetella pertussis} Back     alignment and structure
>2x3n_A Probable FAD-dependent monooxygenase; oxidoreductase; HET: FAD; 1.75A {Pseudomonas aeruginosa} Back     alignment and structure
>2gqf_A Hypothetical protein HI0933; structural genomics, FAD-utilizing protein, flavoprotein, PS protein structure initiative; HET: FAD; 2.70A {Haemophilus influenzae} SCOP: c.3.1.8 e.74.1.1 Back     alignment and structure
>1ryi_A Glycine oxidase; flavoprotein, protein-inhibitor complex, oxidoreductase; HET: FAD; 1.80A {Bacillus subtilis} SCOP: c.3.1.2 d.16.1.3 PDB: 3if9_A* 1ng4_A* 1ng3_A* Back     alignment and structure
>1y56_B Sarcosine oxidase; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} Back     alignment and structure
>3atr_A Conserved archaeal protein; saturating double bonds, archaeal membrane precursor, like 2 geranylgeranylglyceryl phosphate; HET: FDA; 1.80A {Sulfolobus acidocaldarius} PDB: 3atq_A* Back     alignment and structure
>2vdc_G Glutamate synthase [NADPH] small chain; oxidoreductase, amidotransferase, ammonia assimilation, iron, zymogen; HET: OMT FMN AKG FAD; 9.50A {Azospirillum brasilense} Back     alignment and structure
>3c96_A Flavin-containing monooxygenase; FAD, oxidoreductase, PF01266, NESG, PAR240, structural genomics, PSI-2; HET: FAD; 1.90A {Pseudomonas aeruginosa PAO1} SCOP: c.3.1.2 d.16.1.2 PDB: 2rgj_A* Back     alignment and structure
>2gf3_A MSOX, monomeric sarcosine oxidase; flavoprotein oxidase, inhibitor 2-furoic acid, oxidoreductas; HET: FAD; 1.30A {Bacillus SP} SCOP: c.3.1.2 d.16.1.3 PDB: 1el7_A* 1el8_A* 1el9_A* 1eli_A* 1l9e_A* 2a89_A* 2gb0_A* 1el5_A* 3qse_A* 3qsm_A* 3qss_A* 3bhk_A* 3bhf_A* 3m12_A* 3m13_A* 3m0o_A* 1l9c_A* 1l9d_A* 1zov_A* Back     alignment and structure
>2uzz_A N-methyl-L-tryptophan oxidase; N-methyltryptophan oxidase (MTOX), oxidative demethylation of N-methyl-L-tryptophan, FAD, flavoenzyme; HET: FAD; 3.2A {Escherichia coli} Back     alignment and structure
>3ka7_A Oxidoreductase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: FAD; 1.80A {Methanosarcina mazei} Back     alignment and structure
>3nrn_A Uncharacterized protein PF1083; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: AMP; 2.10A {Pyrococcus furiosus} Back     alignment and structure
>4gde_A UDP-galactopyranose mutase; flavin adenine dinucleotide binding, nucleotide binding, MUT isomerase; HET: FDA; 2.20A {Aspergillus fumigatus} PDB: 3ute_A* 3utg_A* 3uth_A* 4gdc_A* 4gdd_A* 3utf_A* 3ukh_A* 3ukf_A* 3uka_A* 3ukl_A* 3ukk_A* 3ukq_A* 3ukp_A* Back     alignment and structure
>3k7m_X 6-hydroxy-L-nicotine oxidase; enantiomeric substrates, flavoenzymes, nicotine degradation, oxidoreductase; HET: FAD GP7; 1.95A {Arthrobacter nicotinovorans} PDB: 3k7q_X* 3ng7_X* 3ngc_X* 3nh3_X* 3nho_X* 3nk0_X* 3nk1_X* 3nk2_X* 3nn0_X* 3nn6_X* 3k7t_A* Back     alignment and structure
>2gag_B Heterotetrameric sarcosine oxidase beta-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_B* 1x31_B* 1vrq_B* 3ad7_B* 3ad8_B* 3ad9_B* 3ada_B* Back     alignment and structure
>3qj4_A Renalase; FAD/NAD(P)-binding rossmann fold superfamily, flavin contain oxidoreductase, monoamine oxidase, NAD, extracellular, oxidoreductase; HET: FAD; 2.50A {Homo sapiens} Back     alignment and structure
>1c0p_A D-amino acid oxidase; alpha-beta-alpha motif, flavin containing protein, oxidoreductase; HET: FAD; 1.20A {Rhodosporidium toruloides} SCOP: c.4.1.2 d.16.1.3 PDB: 1c0i_A* 1c0l_A* 1c0k_A* Back     alignment and structure
>3g5s_A Methylenetetrahydrofolate--tRNA-(uracil-5-)- methyltransferase TRMFO; tRNA methyltransferase FAD folate, FAD, flavoprotein; HET: MSE FAD GSH; 1.05A {Thermus thermophilus} PDB: 3g5q_A* 3g5r_A* Back     alignment and structure
>3fpz_A Thiazole biosynthetic enzyme; FAD, mitochondrion, N thiamine biosynthesis, transit peptide, biosynthetic protei; HET: AHZ; 1.82A {Saccharomyces cerevisiae} Back     alignment and structure
>2i0z_A NAD(FAD)-utilizing dehydrogenases; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: FAD; 1.84A {Bacillus cereus} SCOP: c.3.1.8 e.74.1.1 Back     alignment and structure
>2b9w_A Putative aminooxidase; isomerase, conjugated linoleic acid, FAD; HET: FAD 12P; 1.95A {Propionibacterium acnes} PDB: 2b9x_A* 2b9y_A* 2ba9_A* 2bab_A* 2bac_A* Back     alignment and structure
>2iid_A L-amino-acid oxidase; flavoenzyme, FAD binding domain, reaction mechanism, sustrat binding, oxidoreductase; HET: NAG FUC PHE FAD; 1.80A {Calloselasma rhodostoma} SCOP: c.3.1.2 d.16.1.5 PDB: 1f8s_A* 1f8r_A* 1reo_A* 1tdk_A* 1tdn_A* 1tdo_A* 3kve_A* 4e0v_A* Back     alignment and structure
>1y0p_A Fumarate reductase flavoprotein subunit; flavocytochrome, mesaconate, oxidoreductase; HET: HEM FAD; 1.50A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1qjd_A* 2b7s_A* 1jry_A* 2b7r_A* 1ksu_A* 1jrz_A* 1jrx_A* 1m64_A* 1p2h_A* 1p2e_A* 1kss_A* 1e39_A* 1q9i_A* 1lj1_A* Back     alignment and structure
>3dje_A Fructosyl amine: oxygen oxidoreductase; fructosyl-amino acid, amadoriase, deglycation, fructosamine oxidase; HET: MSE FAD FSA EPE; 1.60A {Aspergillus fumigatus} PDB: 3djd_A* Back     alignment and structure
>4b63_A L-ornithine N5 monooxygenase; oxidoreductase, siderophore, flavin; HET: FAD NAP; 1.90A {Aspergillus fumigatus} PDB: 4b64_A* 4b65_A* 4b66_A* 4b67_A* 4b68_A* 4b69_A* Back     alignment and structure
>3ihg_A RDME; flavoenzyme, anthracycline, polyketide biosynthesis, merohedral twinning, enzyme mechanism, hydroxylase, flavoprotein; HET: FAD VAK; 2.49A {Streptomyces purpurascens} Back     alignment and structure
>3nks_A Protoporphyrinogen oxidase; FAD containing protein, PPO, variegate porphyria disease, VP oxidoreductase-oxidoreductase inhibitor complex; HET: ACJ FAD; 1.90A {Homo sapiens} Back     alignment and structure
>2bcg_G Secretory pathway GDP dissociation inhibitor; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.3.1.3 c.3.1.3 d.16.1.6 PDB: 1ukv_G* 3cpi_G 3cph_G 3cpj_G* Back     alignment and structure
>2qa1_A PGAE, polyketide oxygenase PGAE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 1.80A {Streptomyces} Back     alignment and structure
>2bi7_A UDP-galactopyranose mutase; FAD, flavoprotein, isomerase, lipopolysaccharide biosynthesi; HET: FAD; 2.0A {Klebsiella pneumoniae} SCOP: c.4.1.3 d.16.1.7 PDB: 2bi8_A* 1wam_A* 3inr_A* 3gf4_A* 3int_A* 3kyb_A* Back     alignment and structure
>3k30_A Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP binding site, oxidoreductase; HET: FMN ADP; 2.70A {Pimelobacter simplex} Back     alignment and structure
>2qcu_A Aerobic glycerol-3-phosphate dehydrogenase; glycerol-3-phoshate dehydrogenase, oxidoreductase; HET: BOG FAD TAM; 1.75A {Escherichia coli} PDB: 2r45_A* 2r46_A* 2r4e_A* 2r4j_A* Back     alignment and structure
>2zxi_A TRNA uridine 5-carboxymethylaminomethyl modificat MNMG; modification, 5-carboxymethylaminomethyl uridine, WOBB uridine, FAD; HET: FAD; 2.30A {Aquifex aeolicus} PDB: 2zxh_A* 2e57_A* Back     alignment and structure
>2qa2_A CABE, polyketide oxygenase CABE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 2.70A {Streptomyces} Back     alignment and structure
>3i6d_A Protoporphyrinogen oxidase; protein-inhibitor complex, cytoplasm, FAD, flavoprotein, oxidoreductase, porphyrin biosynthesis; HET: FAD ACJ; 2.90A {Bacillus subtilis} Back     alignment and structure
>3lad_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD; 2.20A {Azotobacter vinelandii} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1lpf_A* Back     alignment and structure
>3e1t_A Halogenase; flavoprotein; HET: FAD; 2.05A {Chondromyces crocatus} Back     alignment and structure
>2r0c_A REBC; flavin adenine dinucleotide, monooxygenase, oxidoreductase; HET: FAD; 1.80A {Lechevalieria aerocolonigenes} PDB: 2r0g_A* 2r0p_A* 3ept_A* Back     alignment and structure
>3jsk_A Cypbp37 protein; octameric thiazole synthase, biosynthetic protein; HET: AHZ; 2.70A {Neurospora crassa} Back     alignment and structure
>3ces_A MNMG, tRNA uridine 5-carboxymethylaminomethyl modificat GIDA, GIDA; tRNA modification, FAD binding domain, structural genomics; 2.41A {Escherichia coli} PDB: 3cp2_A 3g05_A Back     alignment and structure
>3g3e_A D-amino-acid oxidase; FAD, flavoprotein, oxidoreductase, PER; HET: FAD G3E; 2.20A {Homo sapiens} PDB: 3cuk_A* 2e48_A* 2e49_A* 2e4a_A* 2e82_A* 2du8_A* 1ve9_A* 1dao_A* 1ddo_A* 1kif_A* 1an9_A* 1evi_A* Back     alignment and structure
>3c4n_A Uncharacterized protein DR_0571; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.40A {Deinococcus radiodurans R1} Back     alignment and structure
>2aqj_A Tryptophan halogenase, pRNA; flavin-dependent halogenase, helical bundle, sandwiched sheets, structural genomics; HET: TRP FAD; 1.80A {Pseudomonas fluorescens} PDB: 2apg_A* 2ar8_A* 2ard_A* 2jkc_A* Back     alignment and structure
>2gjc_A Thiazole biosynthetic enzyme, mitochondrial; glutathione reductase type II family, thiazole synthase, mitochondria DNA repair; HET: AHZ; 1.82A {Saccharomyces cerevisiae} PDB: 3fpz_A* Back     alignment and structure
>1s3e_A Amine oxidase [flavin-containing] B; human monoamine oxidase, inhibitor binding, rasagiline, enantioselectivity, oxidoreductase; HET: FAD RHP; 1.60A {Homo sapiens} SCOP: c.3.1.2 d.16.1.5 PDB: 1gos_A* 1oj9_A* 1ojb_A* 1ojc_A* 1ojd_A* 1s2q_A* 1s2y_A* 1oja_A* 1s3b_A* 2bk3_A* 2byb_A* 2c64_A* 2c65_A* 2c66_A* 2c67_A* 2c70_A* 2v5z_A* 2v60_A* 2v61_A* 2vrl_A* ... Back     alignment and structure
>3fmw_A Oxygenase; mithramycin, baeyer-villiger, flavin binding protein, oxidoreductase; HET: FAD; 2.89A {Streptomyces argillaceus} Back     alignment and structure
>2jae_A L-amino acid oxidase; oxidoreductase, dimerisation mode, hydride transfer mechanism, GR2-family, flavoenzyme, FAD containing; HET: FAD; 1.25A {Rhodococcus opacus} PDB: 2jb1_A* 2jb2_A* 2jb3_A* Back     alignment and structure
>3da1_A Glycerol-3-phosphate dehydrogenase; NESG BHR167 Q9KDW6 X-RAY, structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.70A {Bacillus halodurans} Back     alignment and structure
>2ivd_A PPO, PPOX, protoporphyrinogen oxidase; porphyrin biosynthesis, chlorophyll biosynthesis, oxidoreductase, HAEM biosynthesis, heme biosynthesis; HET: ACJ FAD TWN; 2.3A {Myxococcus xanthus} SCOP: c.3.1.2 d.16.1.5 PDB: 2ive_A* Back     alignment and structure
>1rsg_A FMS1 protein; FAD binding motif, oxidoreductase; HET: FAD; 1.90A {Saccharomyces cerevisiae} PDB: 1z6l_A* 3bi2_A* 3bi4_A* 3bi5_A* 3bnm_B* 3bnu_B* 3cn8_B* 3cnd_B* 3cnp_B* 3cns_A* 3cnt_B* 1yy5_A* 1xpq_A* Back     alignment and structure
>2rgh_A Alpha-glycerophosphate oxidase; flavoprotein oxidase, oxidoreductase; HET: FAD; 2.30A {Streptococcus SP} PDB: 2rgo_A* Back     alignment and structure
>3nyc_A D-arginine dehydrogenase; FAD, imino-arginine, oxidoreductas; HET: FAD IAR; 1.06A {Pseudomonas aeruginosa} PDB: 3nye_A* 3nyf_A* 3sm8_A* Back     alignment and structure
>3hdq_A UDP-galactopyranose mutase; substrate and inhibitor, isomerase; HET: GDU FAD; 2.36A {Deinococcus radiodurans} PDB: 3hdy_A* 3he3_A* 3mj4_A* Back     alignment and structure
>3ps9_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; rossmann fold, oxidase, methyl transferase, FAD; HET: FAD SAM; 2.54A {Escherichia coli} PDB: 3awi_A* Back     alignment and structure
>1v59_A Dihydrolipoamide dehydrogenase; 2-oxoacid dehydroganese complex, pyruvate dehydrogenase complex; HET: FAD NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1jeh_A* Back     alignment and structure
>3pvc_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; structural genomics, PSI-biology; HET: FAD; 2.31A {Yersinia pestis} PDB: 3sgl_A* Back     alignment and structure
>3cp8_A TRNA uridine 5-carboxymethylaminomethyl modification enzyme GIDA; rossmann fold, FAD-binding domain, dinucleotide-binding motif; HET: FAD; 3.20A {Chlorobium tepidum} Back     alignment and structure
>2yg5_A Putrescine oxidase; oxidoreductase, flavin; HET: FAD; 1.90A {Rhodococcus erythropolis} PDB: 2yg6_A* 2yg3_A* 2yg4_A* 2yg7_A* 3rha_A* Back     alignment and structure
>1qo8_A Flavocytochrome C3 fumarate reductase; oxidoreductase; HET: HEM FAD; 2.15A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 Back     alignment and structure
>1v0j_A UDP-galactopyranose mutase; flavoprotein, isomerase; HET: FAD BCN; 2.25A {Mycobacterium tuberculosis} Back     alignment and structure
>1ps9_A 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel, flavodoxin, flavin, electron transfer, hydride transfer, oxidoreductase; HET: FAD FMN NAP MDE; 2.20A {Escherichia coli} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 Back     alignment and structure
>1i8t_A UDP-galactopyranose mutase; rossman fold, FAD, contractase, isomerase; HET: FAD; 2.40A {Escherichia coli} SCOP: c.4.1.3 d.16.1.7 Back     alignment and structure
>3axb_A Putative oxidoreductase; dinucleotide-binding fold; HET: FAD; 1.92A {Aeropyrum pernix} PDB: 3vqr_A* Back     alignment and structure
>2dkh_A 3-hydroxybenzoate hydroxylase; flavoprotein, monooxygenase, complex, oxidoreductase; HET: FAD 3HB; 1.80A {Comamonas testosteroni} PDB: 2dki_A* Back     alignment and structure
>2gmh_A Electron transfer flavoprotein-ubiquinone oxidoreductase; HET: BHG FAD UQ5; 2.50A {Sus scrofa} SCOP: c.3.1.2 d.16.1.8 d.58.1.6 PDB: 2gmj_A* Back     alignment and structure
>3i3l_A Alkylhalidase CMLS; flavin-dependent halogenase, chloramphenicol biosynthesis, halogenation reaction, structural genomics; HET: FAD; 2.20A {Streptomyces venezuelae} Back     alignment and structure
>2e4g_A Tryptophan halogenase; flavin-binding, rebeccamycin biosynthesis, biosynthetic protein, flavoprotein; HET: TRP; 2.08A {Lechevalieria aerocolonigenes} PDB: 2o9z_A 2oa1_A* 2oal_A* 2oam_A Back     alignment and structure
>2e1m_A L-glutamate oxidase; L-amino acid oxidase, FAD, L-GOX, flavo oxidoreductase; HET: FAD; 2.80A {Streptomyces SP} Back     alignment and structure
>2weu_A Tryptophan 5-halogenase; regioselectivity, antifungal protei; HET: TRP; 1.70A {Streptomyces rugosporus} PDB: 2wet_A* 2wes_A* Back     alignment and structure
>1sez_A Protoporphyrinogen oxidase, mitochondrial; FAD-binding, para-hydroxy-benzoate-hydroxylase fold (PHBH- fold), monotopic membrane-binding domain; HET: FAD OMN TON; 2.90A {Nicotiana tabacum} SCOP: c.3.1.2 d.16.1.5 Back     alignment and structure
>4at0_A 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidoreductase, dehydogenase, steroid catabolism; HET: FAD; 1.60A {Rhodococcus jostii} PDB: 4at2_A* Back     alignment and structure
>1cjc_A Protein (adrenodoxin reductase); flavoenzyme, MAD analysis, electron transferase, oxidoreductase; HET: FAD; 1.70A {Bos taurus} SCOP: c.3.1.1 c.4.1.1 PDB: 1e1k_A* 1e1l_A* 1e1m_A* 1e1n_A* 1e6e_A* Back     alignment and structure
>3lov_A Protoporphyrinogen oxidase; structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: FAD; 2.06A {Exiguobacterium sibiricum} Back     alignment and structure
>2pyx_A Tryptophan halogenase; structural genomics, JOI for structural genomics, JCSG, protein structure initiative biosynthetic protein; HET: MSE TLA PG4; 1.50A {Shewanella frigidimarina} Back     alignment and structure
>2e5v_A L-aspartate oxidase; archaea, oxidoreductase; HET: FAD; 2.09A {Sulfolobus tokodaii} Back     alignment and structure
>1d4d_A Flavocytochrome C fumarate reductase; oxidoreductase; HET: HEM FAD; 2.50A {Shewanella oneidensis} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1d4e_A* 1d4c_A* Back     alignment and structure
>2vvm_A Monoamine oxidase N; FAD, peroxisome, flavoprotein, oxidoreductase, enantioselectivity, directed evolution variant; HET: FAD; 1.85A {Aspergillus niger} PDB: 2vvl_A* 2vvl_G* Back     alignment and structure
>1pn0_A Phenol 2-monooxygenase; two dimers, TLS refinement, oxidoreductase; HET: FAD; 1.70A {Trichosporon cutaneum} SCOP: c.3.1.2 c.47.1.10 d.16.1.2 PDB: 1foh_A* Back     alignment and structure
>4dsg_A UDP-galactopyranose mutase; rossmann fold, flavin adenine dinucleotide, isomerase; HET: FAD UDP; 2.25A {Trypanosoma cruzi} PDB: 4dsh_A* Back     alignment and structure
>1chu_A Protein (L-aspartate oxidase); flavoenzyme, NAD biosynthesis, FAD, oxidoreductase; 2.20A {Escherichia coli} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1knr_A* 1knp_A* Back     alignment and structure
>3dfz_A SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase, cobalamin biosynthesis, NAD, oxidoreducta porphyrin biosynthesis; 2.30A {Bacillus megaterium} Back     alignment and structure
>1pj5_A N,N-dimethylglycine oxidase; channelling, FAD binding, folate binding, amine oxidase, oxidoreductase; HET: FAD; 1.61A {Arthrobacter globiformis} SCOP: b.44.2.1 c.3.1.2 d.16.1.5 d.250.1.1 PDB: 1pj6_A* 1pj7_A* 3gsi_A* Back     alignment and structure
>2wdq_A Succinate dehydrogenase flavoprotein subunit; succinate dehydrogenase activity, cell inner membrane, trica acid cycle; HET: FAD HEM CBE; 2.40A {Escherichia coli} PDB: 1nen_A* 2acz_A* 1nek_A* 2wdr_A* 2wdv_A* 2wp9_A* 2ws3_A* 2wu2_A* 2wu5_A* Back     alignment and structure
>1id1_A Putative potassium channel protein; RCK domain, E.coli potassium channel, BK channel, rossmann fold, membrane protein; 2.40A {Escherichia coli} SCOP: c.2.1.9 Back     alignment and structure
>1lss_A TRK system potassium uptake protein TRKA homolog; KTN domain, NAD, RCK domain, potassium transport, potassium channel, KTRA; HET: NAD; 2.30A {Methanocaldococcus jannaschii} SCOP: c.2.1.9 Back     alignment and structure
>3p1w_A Rabgdi protein; GDI RAB, malaria, structural genomics consortium, SGC, trans PF10_0345, protein transport; 1.85A {Plasmodium falciparum 3D7} Back     alignment and structure
>2g1u_A Hypothetical protein TM1088A; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.50A {Thermotoga maritima} PDB: 3l4b_A* Back     alignment and structure
>2bs2_A Quinol-fumarate reductase flavoprotein subunit A; 2Fe-2S, 3Fe-4S, 4Fe-4S, citric acid cycle, dihaem cytochrome B; HET: FAD HEM LMT; 1.78A {Wolinella succinogenes} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 2bs3_A* 1e7p_A* 2bs4_A* 1qlb_A* Back     alignment and structure
>1d5t_A Guanine nucleotide dissociation inhibitor; ultra-high resolution, hydrolase inhibitor; 1.04A {Bos taurus} SCOP: c.3.1.3 d.16.1.6 PDB: 1lv0_A* 1gnd_A Back     alignment and structure
>1kf6_A Fumarate reductase flavoprotein; respiration, fumarate reductace, succinate dehydrogenase, CO quinol, quinone, oxidoreductase; HET: FAD HQO CE1 1PE; 2.70A {Escherichia coli} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1kfy_A* 1l0v_A* 2b76_A* 3cir_A* 3p4p_A* 3p4q_A* 3p4r_A* 3p4s_A* Back     alignment and structure
>3pl8_A Pyranose 2-oxidase; substrate complex, H167A mutant, homotetramer, GMC oxidoredu PHBH fold, rossmann domain, oxidoreductase; HET: FAD MES G3F; 1.35A {Trametes ochracea} PDB: 2igo_A* 3lsm_A* 2ign_A* 3k4c_A* 1tt0_A* 2igk_A* 3k4b_A* 3lsk_A* 3bg6_A* 3lsh_A* 3lsi_A* 2igm_A* 3k4j_A* 3k4m_A* 3bg7_A* 3k4k_A* 3k4l_A* 3bly_A* 1tzl_A* 3fdy_A* ... Back     alignment and structure
>3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi} Back     alignment and structure
>2h88_A Succinate dehydrogenase flavoprotein subunit; complex II, membrane protein, heme protein, iron sulfur PROT cytochrome B, oxidoreductase; HET: FAD BHG HEM UNL; 1.74A {Gallus gallus} PDB: 1yq4_A* 1yq3_A* 2fbw_A* 2h89_A* 2wqy_A* 1zoy_A* 1zp0_A* 3abv_A* 3ae1_A* 3ae2_A* 3ae3_A* 3ae4_A* 3ae5_A* 3ae6_A* 3ae7_A* 3ae8_A* 3ae9_A* 3aea_A* 3aeb_A* 3aec_A* ... Back     alignment and structure
>3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12} Back     alignment and structure
>1kyq_A Met8P, siroheme biosynthesis protein Met8; homodimer, oxidoreductase, lyase; HET: NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.2.1.11 e.37.1.1 Back     alignment and structure
>3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} Back     alignment and structure
>2z3y_A Lysine-specific histone demethylase 1; chromatin, nucleosome, transcription, LSD1, alternative splicing, chromatin regulator, coiled coil; HET: F2N; 2.25A {Homo sapiens} SCOP: a.4.1.18 c.3.1.2 d.16.1.5 PDB: 2ejr_A* 2z5u_A* 3abt_A* 3abu_A* 2y48_A* 2v1d_A* 2h94_A* 2iw5_A* 2uxn_A* 2uxx_A* 2hko_A* 2dw4_A* 2x0l_A* 2l3d_A Back     alignment and structure
>1jnr_A Adenylylsulfate reductase; oxidoreductase; HET: FAD; 1.60A {Archaeoglobus fulgidus dsm 4304} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1jnz_A* 2fjb_A* 2fja_A* 2fjd_A* 2fje_A* Back     alignment and structure
>1b37_A Protein (polyamine oxidase); flavin-dependent amine oxidase, oxidoreductase; HET: NAG FCA MAN FAD; 1.90A {Zea mays} SCOP: c.3.1.2 d.16.1.5 PDB: 1b5q_A* 1h81_A* 1h82_A* 1h83_A* 1h84_A* 1h86_A* 3kpf_A* 3ku9_A* 3l1r_A* Back     alignment and structure
>2xag_A Lysine-specific histone demethylase 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_A* 2xah_A* 2xaj_A* 2xaq_A* 2xas_A* 2com_A Back     alignment and structure
>4gut_A Lysine-specific histone demethylase 1B; histone demethylase; HET: FAD PGE; 2.00A {Homo sapiens} PDB: 4gur_A* 4gus_A* 4guu_A* 4fwe_A* 4fwf_A* 4fwj_A* 4gu1_A* Back     alignment and structure
>3gyx_A Adenylylsulfate reductase; oxidoreductase; HET: FAD; 3.20A {Desulfovibrio gigas} Back     alignment and structure
>1ju2_A HydroxynitrIle lyase; flavin, GMC oxidoreductase, almond, cyanogenesis; HET: NAG NDG FUC BMA MAN FAD; 1.47A {Prunus dulcis} SCOP: c.3.1.2 d.16.1.1 PDB: 3gdp_A* 3gdn_A* Back     alignment and structure
>2hmt_A YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane protein, ION transporter, symporter, transport protein; HET: NAI; 2.20A {Bacillus subtilis} SCOP: c.2.1.9 PDB: 2hms_A* 2hmu_A* 2hmv_A* 2hmw_A* 1lsu_A* Back     alignment and structure
>3t37_A Probable dehydrogenase; BET alpha beta fold, ADP binding, oxidoreductase; HET: FAD; 2.19A {Mesorhizobium loti} Back     alignment and structure
>1kdg_A CDH, cellobiose dehydrogenase; GMC oxidoreductase, PHBH fold, alpha/beta structure, rossman 6-hydroxylated FAD, oxidoreductase; HET: NAG MAN 6FA EMT; 1.50A {Phanerochaete chrysosporium} SCOP: c.3.1.2 d.16.1.1 PDB: 1naa_A* Back     alignment and structure
>3c85_A Putative glutathione-regulated potassium-efflux S protein KEFB; TRKA domain; HET: AMP; 1.90A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3hn2_A 2-dehydropantoate 2-reductase; PSI-2, NYSGXRC, structural GE protein structure initiative; 2.50A {Geobacter metallireducens} Back     alignment and structure
>3l4b_C TRKA K+ channel protien TM1088B; potassium channel, ring-gating complex, structural GEN PSI-2-2, protein structure initiative; HET: AMP; 3.45A {Thermotoga maritima} Back     alignment and structure
>3ayj_A Pro-enzyme of L-phenylalanine oxidase; amino acid oxidase, flavoenzyme, L- binding, oxidoreductase; HET: FAD PHE; 1.10A {Pseudomonas} PDB: 2yr4_A* 2yr6_A* 3ayi_A* 2yr5_A* 3ayl_A* Back     alignment and structure
>1n4w_A CHOD, cholesterol oxidase; flavoenzyme, steroid metabolism, oxidoreductase, atomic RESO; HET: FAD; 0.92A {Streptomyces SP} SCOP: c.3.1.2 d.16.1.1 PDB: 1b4v_A* 1n1p_A* 1n4u_A* 1n4v_A* 1mxt_A* 2gew_A* 1b8s_A* 3gyi_A* 1cc2_A* 3gyj_A* 1ijh_A* 1cbo_A* 3b3r_A* 3b6d_A* 3cnj_A* Back     alignment and structure
>3i83_A 2-dehydropantoate 2-reductase; structural genomics, oxidoreductase, NADP, pantothenate BIOS PSI-2, protein structure initiative; 1.90A {Methylococcus capsulatus} Back     alignment and structure
>1coy_A Cholesterol oxidase; oxidoreductase(oxygen receptor); HET: AND FAD; 1.80A {Brevibacterium sterolicum} SCOP: c.3.1.2 d.16.1.1 PDB: 3cox_A* Back     alignment and structure
>3q9t_A Choline dehydrogenase and related flavoproteins; glucose-methanol-choline oxidoreductase family, formate OXID formyl-FAD, oxidoreductase; HET: FAY; 2.24A {Aspergillus oryzae} Back     alignment and structure
>1pjq_A CYSG, siroheme synthase; rossman fold, nucleotide binding motif, SAM, NAD, phosphoserine, transferase/oxidoreductase/lyase complex; HET: SEP PGE SAH; 2.21A {Salmonella typhimurium} SCOP: c.2.1.11 c.90.1.1 e.37.1.1 PDB: 1pjs_A* 1pjt_A* Back     alignment and structure
>1ks9_A KPA reductase;, 2-dehydropantoate 2-reductase; PANE, APBA, ketopantoate reductase, rossman fold, monomer, APO, oxidoreductase; 1.70A {Escherichia coli} SCOP: a.100.1.7 c.2.1.6 PDB: 1yon_A* 1yjq_A* 2ofp_A* Back     alignment and structure
>1gpe_A Protein (glucose oxidase); oxidoreductase(flavoprotein); HET: NAG BMA MAN FAD; 1.80A {Penicillium amagasakiense} SCOP: c.3.1.2 d.16.1.1 Back     alignment and structure
>2jbv_A Choline oxidase; alcohol oxidation, flavoenyzme oxidase, covalently linked FAD, C4A-adduct, flavoprotein, oxidoreductase; HET: FAO; 1.86A {Arthrobacter globiformis} PDB: 3nne_A* 3ljp_A* Back     alignment and structure
>2raf_A Putative dinucleotide-binding oxidoreductase; NP_786167.1, NADP oxidoreductase coenzyme F420-dependent, structural genomics; HET: MSE NAP; 1.60A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>4e12_A Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1.93A {Acinetobacter baylyi} PDB: 4dyd_A* 4e13_A* Back     alignment and structure
>3ado_A Lambda-crystallin; L-gulonate 3-dehydrogenase, structural genomics, riken struc genomics/proteomics initiative, RSGI, acetylation; 1.70A {Oryctolagus cuniculus} PDB: 3adp_A* 3f3s_A* Back     alignment and structure
>2ew2_A 2-dehydropantoate 2-reductase, putative; alpha-structure, alpha-beta structure, structural genomics, protein structure initiative; HET: MSE; 2.00A {Enterococcus faecalis} Back     alignment and structure
>3g17_A Similar to 2-dehydropantoate 2-reductase; structural genomics, putative 2-dehydropantoate 2-reductase, protein structure initiative; 2.30A {Staphylococcus aureus subsp} Back     alignment and structure
>1f0y_A HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive ternary complex, oxidoreductase; HET: CAA NAD; 1.80A {Homo sapiens} SCOP: a.100.1.3 c.2.1.6 PDB: 3rqs_A 1lsj_A* 1il0_A* 1lso_A* 1m76_A* 1m75_A* 1f14_A 1f12_A 1f17_A* 3had_A* 2hdh_A* 3hdh_A* Back     alignment and structure
>2vns_A Metalloreductase steap3; metal-binding, transmembrane, rossmann fold, transport, cell cycle, transferrin, flavoprotein, alternative splicing; HET: CIT; 2.0A {Homo sapiens} PDB: 2vq3_A* Back     alignment and structure
>2x5o_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; ATP-binding, cell cycle, cell division, cell shape, cell WAL biogenesis/degradation; HET: KCX VSV; 1.46A {Escherichia coli} PDB: 2wjp_A* 2xpc_A* 2y1o_A* 2jff_A* 2jfh_A* 2uuo_A* 2uup_A* 2vtd_A* 2vte_A* 2jfg_A* 2y66_A* 2y67_A* 2y68_A* 4uag_A* 1e0d_A* 1uag_A* 1eeh_A* 3uag_A* 2uag_A* Back     alignment and structure
>3oj0_A Glutr, glutamyl-tRNA reductase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE SO4; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>3fim_B ARYL-alcohol oxidase; AAO, lignin degradation, oxidoreductase, flavoprotein; HET: FAD; 2.55A {Pleurotus eryngii} Back     alignment and structure
>1jay_A Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossman fold, structural genomics; HET: NAP F42; 1.65A {Archaeoglobus fulgidus} SCOP: c.2.1.6 PDB: 1jax_A* Back     alignment and structure
>3ghy_A Ketopantoate reductase protein; oxidoreductase, NAD-binding domain, PSI-2, NYSGXRC, structur genomics, protein structure initiative; 2.00A {Ralstonia solanacearum} Back     alignment and structure
>3lk7_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; agalacitae, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: MSE; 1.50A {Streptococcus agalactiae} Back     alignment and structure
>1jw9_B Molybdopterin biosynthesis MOEB protein; MOEB: modified rossmann fold, (2) Cys-X-X-Cys zinc-binding M MOAD: ubiquitin-like fold; 1.70A {Escherichia coli} SCOP: c.111.1.1 PDB: 1jwa_B* 1jwb_B* Back     alignment and structure
>3ius_A Uncharacterized conserved protein; APC63810, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.66A {Ruegeria pomeroyi dss-3} Back     alignment and structure
>3k7m_X 6-hydroxy-L-nicotine oxidase; enantiomeric substrates, flavoenzymes, nicotine degradation, oxidoreductase; HET: FAD GP7; 1.95A {Arthrobacter nicotinovorans} PDB: 3k7q_X* 3ng7_X* 3ngc_X* 3nh3_X* 3nho_X* 3nk0_X* 3nk1_X* 3nk2_X* 3nn0_X* 3nn6_X* 3k7t_A* Back     alignment and structure
>3ew7_A LMO0794 protein; Q8Y8U8_lismo, putative NAD-dependent epimerase/dehydratase, LMR162, NESG, structural genomics, PSI-2; 2.73A {Listeria monocytogenes} Back     alignment and structure
>1vg0_A RAB proteins geranylgeranyltransferase component A 1; RAB prenylation, post-translational modification, protein binding/protein transport complex; HET: GER GDP PG4; 2.20A {Rattus norvegicus} SCOP: c.3.1.3 d.16.1.6 PDB: 1vg9_A* 1ltx_R* Back     alignment and structure
>3qvp_A Glucose oxidase; oxidoreductase; HET: NAG BMA MAN FAD; 1.20A {Aspergillus niger} PDB: 1gal_A* 1cf3_A* 3qvr_A* Back     alignment and structure
>1bg6_A N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L) stereospecific opine dehydrogenase, oxidoreductase; 1.80A {Arthrobacter SP} SCOP: a.100.1.5 c.2.1.6 Back     alignment and structure
>3gpi_A NAD-dependent epimerase/dehydratase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.44A {Methylobacillus flagellatus KT} Back     alignment and structure
>1lld_A L-lactate dehydrogenase; oxidoreductase(CHOH (D)-NAD (A)); HET: NAD; 2.00A {Bifidobacterium longum subsp} SCOP: c.2.1.5 d.162.1.1 PDB: 1lth_T* Back     alignment and structure
>1hdo_A Biliverdin IX beta reductase; foetal metabolism, HAEM degradation, flavin reductase, diaphorase, green HAEM binding protein; HET: NAP; 1.15A {Homo sapiens} SCOP: c.2.1.2 PDB: 1he2_A* 1he3_A* 1he4_A* 1he5_A* Back     alignment and structure
>3ego_A Probable 2-dehydropantoate 2-reductase; structural genomics, PANE, unknown function, cytoplasm, NADP, oxidoreductase; 1.90A {Bacillus subtilis} Back     alignment and structure
>3hwr_A 2-dehydropantoate 2-reductase; YP_299159.1, PANE/APBA family ketopantoate reductase, struct genomics, joint center for structural genomics; HET: NDP BCN; 2.15A {Ralstonia eutropha} Back     alignment and structure
>3h2s_A Putative NADH-flavin reductase; Q03B84, NESG, LCR19, structural genomics, PSI-2, protein structure initiative; HET: NDP; 1.78A {Lactobacillus casei atcc 334} Back     alignment and structure
>3qha_A Putative oxidoreductase; seattle structural genomics center for infectious disease, S mycobacterium avium 104, rossmann fold; 2.25A {Mycobacterium avium} Back     alignment and structure
>2cvz_A Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase; valine catabolism, NADP+, structural GEN riken structural genomics/proteomics initiative; HET: NDP; 1.80A {Thermus thermophilus} SCOP: a.100.1.1 c.2.1.6 PDB: 1wp4_A* Back     alignment and structure
>3pdu_A 3-hydroxyisobutyrate dehydrogenase family protein; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R glyoxylate metabolism; HET: NAP; 1.89A {Geobacter sulfurreducens} Back     alignment and structure
>3k96_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA, IDP01976, oxidoreductase, phospholipid biosynthesis; HET: EPE; 2.10A {Coxiella burnetii} Back     alignment and structure
>1b0a_A Protein (fold bifunctional protein); folate, dehydrogenase, cyclcohydrolase, channeling, oxidoreductase,hydrolase; 2.56A {Escherichia coli K12} SCOP: c.2.1.7 c.58.1.2 Back     alignment and structure
>2gf2_A Hibadh, 3-hydroxyisobutyrate dehydrogenase; structural genomics, structural genomics consortium, SGC, oxidoreductase; 2.38A {Homo sapiens} PDB: 2i9p_A* Back     alignment and structure
>3phh_A Shikimate dehydrogenase; shikimate pathway, helicobacter PYL oxidoreductase, alpha/beta domain, rossmann fold; HET: SKM; 1.42A {Helicobacter pylori} PDB: 3phg_A* 3phi_A* 3phj_A* 4foo_A 4fpx_A 4fos_A* 4fr5_A* 4fq8_A* Back     alignment and structure
>1nyt_A Shikimate 5-dehydrogenase; alpha/beta domains, WIDE cleft separation, oxidoreductase; HET: NAP; 1.50A {Escherichia coli} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>3e8x_A Putative NAD-dependent epimerase/dehydratase; structural genomics, APC7755, NADP, P protein structure initiative; HET: MSE NAP; 2.10A {Bacillus halodurans} Back     alignment and structure
>1txg_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; oxidoreductase; 1.70A {Archaeoglobus fulgidus} SCOP: a.100.1.6 c.2.1.6 Back     alignment and structure
>2aef_A Calcium-gated potassium channel MTHK; rossmann fold, helix-turn-helix, Ca2+ binding, flexible interface; 1.70A {Methanothermobacterthermautotrophicus} PDB: 2aej_A 2aem_A 3rbx_A 2ogu_A 2fy8_A 3kxd_A Back     alignment and structure
>1a4i_A Methylenetetrahydrofolate dehydrogenase / methenyltetrahydrofolate cyclohydrolase...; THF, bifunctional, oxidoreductase; HET: NDP; 1.50A {Homo sapiens} SCOP: c.2.1.7 c.58.1.2 PDB: 1dia_A* 1dib_A* 1dig_A* Back     alignment and structure
>2uyy_A N-PAC protein; long-chain dehydrogenase, cytokine; HET: NA7; 2.5A {Homo sapiens} Back     alignment and structure
>3pef_A 6-phosphogluconate dehydrogenase, NAD-binding; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R geobacter metallireducens; HET: NAP; 2.07A {Geobacter metallireducens} Back     alignment and structure
>1yqg_A Pyrroline-5-carboxylate reductase; structural genomics, PSI, structure initiative, midwest center for structural genomic oxidoreductase; 1.90A {Neisseria meningitidis} SCOP: a.100.1.10 c.2.1.6 PDB: 2ag8_A* Back     alignment and structure
>4b4o_A Epimerase family protein SDR39U1; isomerase; HET: NDP PE4; 2.70A {Homo sapiens} Back     alignment and structure
>3dtt_A NADP oxidoreductase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: NAP; 1.70A {Arthrobacter SP} Back     alignment and structure
>1guz_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle, NAD; HET: NAD; 2.0A {Chlorobium vibrioforme} SCOP: c.2.1.5 d.162.1.1 PDB: 1gv1_A 1gv0_A* Back     alignment and structure
>2c2x_A Methylenetetrahydrofolate dehydrogenase- methenyltetrahydrofolate cyclohydrolase; NADP; 2.0A {Mycobacterium tuberculosis} PDB: 2c2y_A Back     alignment and structure
>4huj_A Uncharacterized protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, dinucleotide-binding; 1.77A {Sinorhizobium meliloti} Back     alignment and structure
>3aw8_A PURK, phosphoribosylaminoimidazole carboxylase, ATPase; structural genomics, riken structural genomics/proteomics in RSGI, ATP grAsp; HET: AMP; 2.60A {Thermus thermophilus} Back     alignment and structure
>4g65_A TRK system potassium uptake protein TRKA; structural genomics, center for structural genomics of infec diseases, csgid, niaid; HET: MSE; 2.09A {Vibrio vulnificus} Back     alignment and structure
>2f1k_A Prephenate dehydrogenase; tyrosine synthesis, X-RA crystallography structure, oxidoreductase; HET: OMT NAP; 1.55A {Synechocystis SP} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>3i6i_A Putative leucoanthocyanidin reductase 1; rossmann fold, short chain dehydrogenase reductase, flavonoi oxidoreductase; HET: NDP; 1.75A {Vitis vinifera} PDB: 3i5m_A 3i52_A* 3i6q_A* Back     alignment and structure
>1vpd_A Tartronate semialdehyde reductase; structural genomics, MCSG, protein structure initiative, PSI, midwest center for structural genomics; HET: MSE TLA; 1.65A {Salmonella typhimurium} SCOP: a.100.1.1 c.2.1.6 Back     alignment and structure
>3doj_A AT3G25530, dehydrogenase-like protein; gamma-hydroxybutyrate dehydrogenase, 4-hydroxybutyrate dehydrogenase; 2.10A {Arabidopsis thaliana} Back     alignment and structure
>4ffl_A PYLC; amino acid, biosynthesis of pyrrolysine, isopeptide bond for ATP-grAsp fold, ligase, ATP-binding, L-lysine and 3R-methyl ornithine; HET: LYS ADP ATP; 1.50A {Methanosarcina barkeri} PDB: 4ffm_A* 4ffn_A* 4ffo_A* 4ffp_A* 4ffr_A* Back     alignment and structure
>4dll_A 2-hydroxy-3-oxopropionate reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.11A {Polaromonas SP} Back     alignment and structure
>3dqp_A Oxidoreductase YLBE; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 1.40A {Lactococcus lactis subsp} Back     alignment and structure
>1mv8_A GMD, GDP-mannose 6-dehydrogenase; rossman fold, domain-swapped dimer, enzyme complex with COFA product, oxidoreductase; HET: SUC NAD GDX; 1.55A {Pseudomonas aeruginosa} SCOP: a.100.1.4 c.2.1.6 c.26.3.1 PDB: 1mfz_A* 1muu_A* Back     alignment and structure
>3l9w_A Glutathione-regulated potassium-efflux system Pro linker, ancillary protein KEFF; potassium channel regulation, domains, antiport; HET: FMN AMP GSH; 1.75A {Escherichia coli} PDB: 3eyw_A* 3l9x_A* Back     alignment and structure
>3eag_A UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME diaminopimelate ligase; UDP-N-acetylmuramate:L-alanyl-G glutamyl-MESO-diaminopimelate ligase; 2.55A {Neisseria meningitidis MC58} Back     alignment and structure
>2v6b_A L-LDH, L-lactate dehydrogenase; oxidoreductase, radioresistance, NAD, cytoplasm, mesophilic, glycolysis; 2.50A {Deinococcus radiodurans} Back     alignment and structure
>3cky_A 2-hydroxymethyl glutarate dehydrogenase; rossmann fold, two domain enzyme, oxidoreductase; 2.30A {Eubacterium barkeri} Back     alignment and structure
>1hyh_A L-hicdh, L-2-hydroxyisocaproate dehydrogenase; L-2-hydroxycarboxylate dehydrogenase, L-lactate dehydrogenas oxidoreductase (CHOH(D)-NAD+(A)); HET: NAD; 2.20A {Weissella confusa} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>2rir_A Dipicolinate synthase, A chain; structural genomics, APC1343, PSI-2, structure initiative; HET: MSE NAP; 2.79A {Bacillus subtilis} Back     alignment and structure
>2pv7_A T-protein [includes: chorismate mutase (EC 5.4.99 and prephenate dehydrogenase (EC...; 1574749, chorismate mutase type II; HET: MSE TYR NAD; 2.00A {Haemophilus influenzae} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>3d4o_A Dipicolinate synthase subunit A; NP_243269.1, structural GEN joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: MSE TAR; 2.10A {Bacillus halodurans} Back     alignment and structure
>1p77_A Shikimate 5-dehydrogenase; NADPH, oxidoreductase; HET: ATR; 1.95A {Haemophilus influenzae} SCOP: c.2.1.7 c.58.1.5 PDB: 1p74_A* Back     alignment and structure
>1z82_A Glycerol-3-phosphate dehydrogenase; TM0378, structural genom joint center for structural genomics, JCSG, protein structu initiative, PSI; HET: MSE NDP G3H G3P; 2.00A {Thermotoga maritima} Back     alignment and structure
>1yj8_A Glycerol-3-phosphate dehydrogenase; SGPP, structural genomics, PSI; 2.85A {Plasmodium falciparum} Back     alignment and structure
>2rcy_A Pyrroline carboxylate reductase; malaria, structural genomics, pyrroline reductase, oxidoredu structural genomics consortium, SGC; HET: NAP; 2.30A {Plasmodium falciparum} Back     alignment and structure
>2ewd_A Lactate dehydrogenase,; protein-substrate_cofactor analog complex, oxidoreductase; HET: A3D; 2.00A {Cryptosporidium parvum} PDB: 2frm_A 2fn7_A* 2fnz_A* 2fm3_A Back     alignment and structure
>1hdg_O Holo-D-glyceraldehyde-3-phosphate dehydrogenase; oxidoreductase (aldehy(D)-NAD(A)); HET: NAD; 2.50A {Thermotoga maritima} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>1zud_1 Adenylyltransferase THIF; thiamin, thiazole, protein-protein complex, THIF, TRAN biosynthetic protein complex; 1.98A {Escherichia coli} PDB: 1zfn_A* 1zkm_A Back     alignment and structure
>3dhn_A NAD-dependent epimerase/dehydratase; reductase, PF01370, Q89Z24_bactn, NESG, BTR310, structural genomics, PSI-2; 2.00A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1qyc_A Phenylcoumaran benzylic ether reductase PT1; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.20A {Pinus taeda} SCOP: c.2.1.2 Back     alignment and structure
>3c24_A Putative oxidoreductase; YP_511008.1, structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.62A {Jannaschia SP} Back     alignment and structure
>2r6j_A Eugenol synthase 1; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, plant protein; HET: NDP; 1.50A {Ocimum basilicum} PDB: 2qys_A 2qx7_A* 2qzz_A* 2r2g_A* 3c3x_A* 2qw8_A* Back     alignment and structure
>1evy_A Glycerol-3-phosphate dehydrogenase; rossmann fold, oxidoreductase; HET: MYS; 1.75A {Leishmania mexicana} SCOP: a.100.1.6 c.2.1.6 PDB: 1evz_A* 1jdj_A* 1m66_A* 1m67_A* 1n1e_A* 1n1g_A* Back     alignment and structure
>4dio_A NAD(P) transhydrogenase subunit alpha PART 1; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.60A {Sinorhizobium meliloti} Back     alignment and structure
>1nvt_A Shikimate 5'-dehydrogenase; structural genomics, PSI, protein structure initiative; HET: NAP; 2.35A {Methanocaldococcus jannaschii} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>2gas_A Isoflavone reductase; NADPH-dependent reductase, oxidoreductase; 1.60A {Medicago sativa} Back     alignment and structure
>3c1o_A Eugenol synthase; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, oxidoreductase; HET: NAP; 1.80A {Clarkia breweri} Back     alignment and structure
>1zcj_A Peroxisomal bifunctional enzyme; peroxisomal multifunctional enzyme type 1, L-bifunction enzyme, MFE-1, fatty acid beta oxidation; 1.90A {Rattus norvegicus} Back     alignment and structure
>1edz_A 5,10-methylenetetrahydrofolate dehydrogenase; nucleotide-binding domain, monofunctional, oxidoreductase; 2.80A {Saccharomyces cerevisiae} SCOP: c.2.1.7 c.58.1.2 PDB: 1ee9_A* Back     alignment and structure
>4ina_A Saccharopine dehydrogenase; structural genomics, PSI-biology, northeast structural genom consortium, NESG, oxidoreductas; 2.49A {Wolinella succinogenes} Back     alignment and structure
>3p2y_A Alanine dehydrogenase/pyridine nucleotide transhy; seattle structural genomics center for infectious disease, S tuberculosis; 1.82A {Mycobacterium smegmatis str} Back     alignment and structure
>3g0o_A 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine catabolism, tartaric acid, target 11128H, NYSGXRC, PSI-2, structural genomics; HET: TLA; 1.80A {Salmonella typhimurium} Back     alignment and structure
>2ahr_A Putative pyrroline carboxylate reductase; pyrroline reductase, proline biosynthesis, NAD(P protein, rossmann fold, doain swapping; HET: NAP; 2.15A {Streptococcus pyogenes} SCOP: a.100.1.10 c.2.1.6 PDB: 2amf_A Back     alignment and structure
>1x0v_A GPD-C, GPDH-C, glycerol-3-phosphate dehydrogenase [NAD+], cytoplasmic; two independent domains, GXGXXG motif, oxidoreductase; 2.30A {Homo sapiens} PDB: 1x0x_A* 1wpq_A* 2pla_A* Back     alignment and structure
>3u62_A Shikimate dehydrogenase; shikimate pathway, oxidoreductase; 1.45A {Thermotoga maritima} Back     alignment and structure
>1vl6_A Malate oxidoreductase; TM0542, NAD-dependent malic enzyme, structural genomics, JCS protein structure initiative, PSI; 2.61A {Thermotoga maritima} SCOP: c.2.1.7 c.58.1.3 PDB: 2hae_A* Back     alignment and structure
>3g79_A NDP-N-acetyl-D-galactosaminuronic acid dehydrogen; structural genomics, protein structure initiative; 2.40A {Methanosarcina mazei GO1} Back     alignment and structure
>2d5c_A AROE, shikimate 5-dehydrogenase; substrate, dimer, structural genomics, NPPSFA, Na project on protein structural and functional analyses; HET: SKM; 1.65A {Thermus thermophilus} PDB: 1wxd_A* 2cy0_A* 2ev9_A* Back     alignment and structure
>2qyt_A 2-dehydropantoate 2-reductase; APC81190, porphyromonas gingi W83, structural genomics, PSI-2; HET: MSE; 2.15A {Porphyromonas gingivalis} Back     alignment and structure
>3gg2_A Sugar dehydrogenase, UDP-glucose/GDP-mannose dehydrogenase family; structural genomics, oxidoreductase, PSI-2; HET: UGA; 1.70A {Porphyromonas gingivalis} Back     alignment and structure
>3vps_A TUNA, NAD-dependent epimerase/dehydratase; tunicamycins, biosynthesis, EXO-glycal, rossman transferase; HET: UD1 NAD; 1.90A {Streptomyces chartreusis} Back     alignment and structure
>2egg_A AROE, shikimate 5-dehydrogenase; dimer, X-RAY diffraction, structural genomics, NPPSFA; 2.25A {Geobacillus kaustophilus} Back     alignment and structure
>1a5z_A L-lactate dehydrogenase; oxidoreductase, glycolysis, hyperthermophiles, thermotoga MA protein stability; HET: FBP NAD; 2.10A {Thermotoga maritima} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>3gt0_A Pyrroline-5-carboxylate reductase; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG; 2.00A {Bacillus cereus atcc 14579} Back     alignment and structure
>4ezb_A Uncharacterized conserved protein; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 2.10A {Sinorhizobium meliloti} Back     alignment and structure
>3d1l_A Putative NADP oxidoreductase BF3122; structural genomics, PSI-2, protein structure initiative, M center for structural genomics, MCSG; 2.19A {Bacteroides fragilis} Back     alignment and structure
>1x13_A NAD(P) transhydrogenase subunit alpha; NAD(H)-binding domain, rossmann fold, oxidoreductase; 1.90A {Escherichia coli} PDB: 1x14_A* 1x15_A* 2bru_A* Back     alignment and structure
>3o8q_A Shikimate 5-dehydrogenase I alpha; structural genomics, center for structural genomics of infec diseases, csgid; HET: EPE; 1.45A {Vibrio cholerae biovar el tor} PDB: 3sef_A* 3pgj_A* 3o8q_B* Back     alignment and structure
>1pzg_A LDH, lactate dehydrogenase; apicomplexa, APAD, tetramer, rossmann fold, oxidoreductase; HET: CME A3D; 1.60A {Toxoplasma gondii} SCOP: c.2.1.5 d.162.1.1 PDB: 1pzf_A* 1pze_A* 1pzh_A* 3om9_A* 1sov_A 1sow_A* 3czm_A* Back     alignment and structure
>1npy_A Hypothetical shikimate 5-dehydrogenase-like protein HI0607; structural genomics, PSI, protein structure initiative; 1.75A {Haemophilus influenzae} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>2eez_A Alanine dehydrogenase; TTHA0216, structural genomic NPPSFA, national project on protein structural and function analyses; 2.71A {Thermus thermophilus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 182
d2gv8a1335 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monox 2e-15
d2gv8a2107 c.3.1.5 (A:181-287) Flavin-dependent monoxygenase 1e-09
>d2gv8a1 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Length = 335 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: FAD/NAD(P)-binding domain
superfamily: FAD/NAD(P)-binding domain
family: FAD/NAD-linked reductases, N-terminal and central domains
domain: Flavin-dependent monoxygenase SPBP16F5.08c
species: Schizosaccharomyces pombe [TaxId: 4896]
 Score = 70.8 bits (172), Expect = 2e-15
 Identities = 31/147 (21%), Positives = 53/147 (36%), Gaps = 11/147 (7%)

Query: 44  DNMWLHSMIESAHDNGAVVFRNGHTVHADVILHCTGYKYHF--------PFLETNGIVTM 95
           D  W+ +   +   +             +         Y +                +  
Sbjct: 143 DGSWVVTYKGTKAGSPISKDIFDAVSICNGHYEVPYTGYLYSVPFPSLAKLKSPETKLID 202

Query: 96  DDNRVGPLYKHVFPPVLAPWLSFVGLPWKVIPFPLCEYQSKWIAGVLSGQIVLPSQEEMM 155
           D + V  +Y+H+F     P L+FVGL   V+PFP  + Q+ ++A V SG++ LPS+EE +
Sbjct: 203 DGSHVHNVYQHIFYIP-DPTLAFVGLALHVVPFPTSQAQAAFLARVWSGRLKLPSKEEQL 261

Query: 156 EDTKAFYSTLEASGTPKRYTHNMGDYQ 182
           +           SG    Y        
Sbjct: 262 KWQDELMF--SLSGANNMYHSLDYPKD 286


>d2gv8a2 c.3.1.5 (A:181-287) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Length = 107 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query182
d2gv8a1335 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 99.83
d1xhca1167 NADH oxidase /nitrite reductase {Pyrococcus furios 99.5
d2gv8a2107 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 99.49
d1d7ya1183 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 99.46
d1w4xa1298 Phenylacetone monooxygenase {Thermobifida fusca [T 99.43
d1q1ra1185 Putidaredoxin reductase {Pseudomonas putida [TaxId 99.38
d1fcda1186 Flavocytochrome c sulfide dehydrogenase, FCSD, fla 99.35
d1gesa2116 Glutathione reductase {Escherichia coli [TaxId: 56 99.33
d1d7ya2121 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 99.32
d1m6ia1213 Apoptosis-inducing factor (AIF) {Human (Homo sapie 99.25
d1feca2117 Trypanothione reductase {Crithidia fasciculata [Ta 99.24
d1nhpa1198 NADH peroxidase {Enterococcus faecalis [TaxId: 135 99.23
d1fl2a2126 Alkyl hydroperoxide reductase subunit F (AhpF), C- 99.23
d1trba2126 Thioredoxin reductase {Escherichia coli [TaxId: 56 99.22
d1vdca2130 Thioredoxin reductase {Mouse-ear cress (Arabidopsi 99.19
d1xhca2122 NADH oxidase /nitrite reductase {Pyrococcus furios 99.18
d1w4xa2235 Phenylacetone monooxygenase {Thermobifida fusca [T 99.16
d1q1ra2133 Putidaredoxin reductase {Pseudomonas putida [TaxId 99.16
d1onfa2117 Glutathione reductase {Plasmodium falciparum [TaxI 99.12
d1lvla2115 Dihydrolipoamide dehydrogenase {Pseudomonas putida 99.1
d1m6ia2137 Apoptosis-inducing factor (AIF) {Human (Homo sapie 99.07
d1mo9a2121 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 99.07
d3lada2119 Dihydrolipoamide dehydrogenase {Azotobacter vinela 99.04
d1mo9a1261 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 99.02
d1aoga2117 Trypanothione reductase {Trypanosoma cruzi [TaxId: 99.01
d1nhpa2123 NADH peroxidase {Enterococcus faecalis [TaxId: 135 98.99
d1dxla1221 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 98.91
d3grsa2125 Glutathione reductase {Human (Homo sapiens) [TaxId 98.87
d1ojta2125 Dihydrolipoamide dehydrogenase {Neisseria meningit 98.83
d1ebda2117 Dihydrolipoamide dehydrogenase {Bacillus stearothe 98.83
d1v59a2122 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 98.77
d1h6va2122 Mammalian thioredoxin reductase {Rat (Rattus norve 98.74
d1gtea3153 Dihydropyrimidine dehydrogenase, domain 3 {Pig (Su 98.74
d1lvla1220 Dihydrolipoamide dehydrogenase {Pseudomonas putida 98.73
d1dxla2123 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 98.67
d1vdca1192 Thioredoxin reductase {Mouse-ear cress (Arabidopsi 98.66
d1ebda1223 Dihydrolipoamide dehydrogenase {Bacillus stearothe 98.62
d1trba1190 Thioredoxin reductase {Escherichia coli [TaxId: 56 98.6
d1ps9a2162 2,4-dienoyl-CoA reductase, C-terminal domain {Esch 98.57
d3lada1229 Dihydrolipoamide dehydrogenase {Azotobacter vinela 98.44
d1xdia1233 Dihydrolipoamide dehydrogenase {Mycobacterium tube 98.38
d1fl2a1184 Alkyl hydroperoxide reductase subunit F (AhpF), C- 98.29
d2gqfa1253 Hypothetical protein HI0933 {Haemophilus influenza 98.28
d3grsa1221 Glutathione reductase {Human (Homo sapiens) [TaxId 98.28
d1lqta1216 Ferredoxin:NADP reductase FprA {Mycobacterium tube 98.28
d1ps9a3179 2,4-dienoyl-CoA reductase, middle domain {Escheric 98.15
d2voua1265 Dihydroxypyridine hydroxylase DhpH {Arthrobacter n 98.13
d1gesa1217 Glutathione reductase {Escherichia coli [TaxId: 56 98.12
d1ojta1229 Dihydrolipoamide dehydrogenase {Neisseria meningit 98.07
d2cula1230 GidA-related protein TTHA1897 {Thermus thermophilu 98.06
d1h6va1235 Mammalian thioredoxin reductase {Rat (Rattus norve 98.04
d1feca1240 Trypanothione reductase {Crithidia fasciculata [Ta 98.0
d2i0za1251 Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396] 97.96
d1gtea4196 Dihydropyrimidine dehydrogenase, domain 2 {Pig (Su 97.83
d1djqa3233 Trimethylamine dehydrogenase, middle domain {Methy 97.75
d1djqa2156 Trimethylamine dehydrogenase, C-terminal domain {M 97.61
d1cjca1225 Adrenodoxin reductase of mitochondrial p450 system 97.55
d1b5qa1 347 Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} 97.37
d2ivda1 347 Protoporphyrinogen oxidase {Myxococcus xanthus [Ta 97.26
d1seza1 373 Protoporphyrinogen oxidase {Tobacco (Nicotiana tab 97.25
d2bcgg1 297 Guanine nucleotide dissociation inhibitor, GDI {Ba 97.25
d1aoga1238 Trypanothione reductase {Trypanosoma cruzi [TaxId: 97.22
d1d5ta1 336 Guanine nucleotide dissociation inhibitor, GDI {Co 97.18
d2dw4a2 449 Lysine-specific histone demethylase 1, LSD1 {Human 97.06
d2iida1 370 L-aminoacid oxidase {Malayan pit viper (Calloselas 97.05
d1i8ta1 298 UDP-galactopyranose mutase, N-terminal domain {Esc 96.99
d2bi7a1 314 UDP-galactopyranose mutase, N-terminal domain {Kle 96.96
d1c0pa1268 D-aminoacid oxidase, N-terminal domain {Rhodotorul 96.95
d1v59a1233 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 96.85
d1k0ia1 292 p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas a 96.81
d2v5za1 383 Monoamine oxidase B {Human (Homo sapiens) [TaxId: 96.75
d1cjca2230 Adrenodoxin reductase of mitochondrial p450 system 96.69
d1lqta2239 Ferredoxin:NADP reductase FprA {Mycobacterium tube 96.66
d3c96a1 288 Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 96.65
d1ryia1276 Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} 96.63
d1rp0a1278 Thiazole biosynthetic enzyme Thi4 {Thale cress(Ara 96.56
d1pj5a2 305 N,N-dimethylglycine oxidase {Arthrobacter globifor 96.46
d2gf3a1281 Sarcosine oxidase {Bacillus sp., strain b0618 [Tax 96.37
d1y0pa2 308 Flavocytochrome c3 (respiratory fumarate reductase 96.36
d1d4ca2 322 Flavocytochrome c3 (respiratory fumarate reductase 96.21
d2bs2a2 336 Fumarate reductase {Wolinella succinogenes [TaxId: 96.1
d1onfa1259 Glutathione reductase {Plasmodium falciparum [TaxI 96.09
d2f5va1 379 Pyranose 2-oxidase {White-rot fungus (Peniophora s 96.06
d3coxa1 370 Cholesterol oxidase of GMC family {Brevibacterium 96.0
d1kyqa1150 Bifunctional dehydrogenase/ferrochelatase Met8p, N 95.96
d1n4wa1 367 Cholesterol oxidase of GMC family {Streptomyces sp 95.95
d2gmha1 380 Electron transfer flavoprotein-ubiquinone oxidored 95.83
d1qo8a2 317 Flavocytochrome c3 (respiratory fumarate reductase 95.81
d1pjqa1113 Siroheme synthase CysG, domain 1 {Salmonella typhi 95.77
d2jfga193 UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 95.72
d1pn0a1 360 Phenol hydroxylase {Soil-living yeast (Trichosporo 95.63
d2gjca1311 Thiazole biosynthetic enzyme Thi4 {Baker's yeast ( 95.6
d1e5qa1182 Saccharopine reductase {Rice blast fungus (Magnapo 95.5
d1ks9a2167 Ketopantoate reductase PanE {Escherichia coli [Tax 95.45
d1neka2 330 Succinate dehydogenase {Escherichia coli [TaxId: 5 95.35
d1bg6a2184 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A 95.13
d1kdga1 360 Flavoprotein domain of flavocytochrome cellobiose 95.1
d1chua2 305 L-aspartate oxidase {Escherichia coli [TaxId: 562] 94.6
d1jnra2 356 Adenylylsulfate reductase A subunit {Archaeon Arch 94.48
d1ju2a1 351 Hydroxynitrile lyase {Almond (Prunus dulcis) [TaxI 94.38
d1gpea1 391 Glucose oxidase {Penicillium amagasakiense [TaxId: 94.36
d1lssa_132 Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax 94.25
d1kifa1246 D-aminoacid oxidase, N-terminal domain {Pig (Sus s 94.21
d1f0ya2192 Short chain L-3-hydroxyacyl CoA dehydrogenase {Hum 94.17
d1wdka3186 Fatty oxidation complex alpha subunit, middle doma 93.94
d1cf3a1 385 Glucose oxidase {Aspergillus niger [TaxId: 5061]} 93.26
d1jaya_212 Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archae 93.01
d1n1ea2189 Glycerol-3- phosphate dehydrogenase {Trypanosome ( 92.74
d1kf6a2 311 Fumarate reductase {Escherichia coli [TaxId: 562]} 92.55
d2hmva1134 Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} 92.53
d1txga2180 Glycerol-3- phosphate dehydrogenase {Archaeoglobus 92.33
d1pjca1168 L-alanine dehydrogenase {Phormidium lapideum [TaxI 90.86
d2f1ka2165 Prephenate dehydrogenase TyrA {Synechocystis sp. p 90.83
d1qyda_ 312 Pinoresinol-lariciresinol reductase {Giant arborvi 90.07
d1l7da1183 Nicotinamide nucleotide transhydrogenase dI compon 90.03
d1npya1167 Shikimate 5-dehydrogenase-like protein HI0607 {Hae 89.59
d2ivda1347 Protoporphyrinogen oxidase {Myxococcus xanthus [Ta 89.52
d1d5ta1336 Guanine nucleotide dissociation inhibitor, GDI {Co 89.39
d1gpja2159 Glutamyl tRNA-reductase middle domain {Archaeon Me 89.15
d1ez4a1146 Lactate dehydrogenase {Lactobacillus pentosus [Tax 89.14
d1nyta1170 Shikimate 5-dehydrogenase AroE {Escherichia coli [ 88.81
d1id1a_153 Rck domain from putative potassium channel Kch {Es 88.63
d1y6ja1142 Lactate dehydrogenase {Clostridium thermocellum [T 88.43
d1qyca_ 307 Phenylcoumaran benzylic ether reductase {Loblolly 88.18
d1p77a1171 Shikimate 5-dehydrogenase AroE {Haemophilus influe 87.51
d1hdoa_205 Biliverdin IX beta reductase {Human (Homo sapiens) 87.13
d1ldna1148 Lactate dehydrogenase {Bacillus stearothermophilus 87.08
d1guza1142 Malate dehydrogenase {Chlorobium vibrioforme [TaxI 87.03
d2pv7a2152 Prephenate dehydrogenase TyrA {Haemophilus influen 86.9
d1mv8a2202 GDP-mannose 6-dehydrogenase {Pseudomonas aeruginos 86.33
d1nvta1177 Shikimate 5-dehydrogenase AroE {Archaeon Methanoco 86.21
d1vi2a1182 Putative shikimate dehydrogenase YdiB {Escherichia 86.09
d2ahra2152 Pyrroline-5-carboxylate reductase ProC {Streptococ 86.0
d1kjqa2111 Glycinamide ribonucleotide transformylase PurT, N- 85.34
d1llda1143 Lactate dehydrogenase {Bifidobacterium longum, str 85.2
d1hyea1145 MJ0490, lactate/malate dehydrogenase {Archaeon Met 85.19
d2ldxa1159 Lactate dehydrogenase {Mouse (Mus musculus) [TaxId 85.07
d1jw9b_247 Molybdenum cofactor biosynthesis protein MoeB {Esc 84.83
d1ojua1142 Malate dehydrogenase {Archaeon Archaeoglobus fulgi 84.77
d1hyha1146 L-2-hydroxyisocapronate dehydrogenase, L-HICDH {La 84.62
d1vpda2161 Hydroxyisobutyrate dehydrogenase {Salmonella typhi 84.32
d1i0za1160 Lactate dehydrogenase {Human (Homo sapiens), heart 84.15
d1a5za1140 Lactate dehydrogenase {Thermotoga maritima [TaxId: 83.77
d1mlda1144 Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 83.35
d1yovb1 426 UBA3 {Human (Homo sapiens) [TaxId: 9606]} 82.94
d3cuma2162 Hydroxyisobutyrate dehydrogenase {Pseudomonas aeru 82.93
d1i36a2152 Conserved hypothetical protein MTH1747 {Archaeon M 82.83
d1yqga2152 Pyrroline-5-carboxylate reductase ProC {Neisseria 82.49
d1qp8a1181 Putative formate dehydrogenase {Archaeon Pyrobacul 82.47
d1v59a1233 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 82.08
d1seza1373 Protoporphyrinogen oxidase {Tobacco (Nicotiana tab 81.92
d1xgka_ 350 Negative transcriptional regulator NmrA {Aspergill 81.77
d1dxya1199 D-2-hydroxyisocaproate dehydrogenase {Lactobacillu 81.57
d2naca1188 Formate dehydrogenase {Pseudomonas sp., strain 101 81.5
d1j4aa1197 D-lactate dehydrogenase {Lactobacillus helveticus 80.56
>d2gv8a1 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: FAD/NAD(P)-binding domain
superfamily: FAD/NAD(P)-binding domain
family: FAD/NAD-linked reductases, N-terminal and central domains
domain: Flavin-dependent monoxygenase SPBP16F5.08c
species: Schizosaccharomyces pombe [TaxId: 4896]
Probab=99.83  E-value=1.5e-19  Score=145.46  Aligned_cols=175  Identities=25%  Similarity=0.381  Sum_probs=119.7

Q ss_pred             CEEEEcCCccHHHHHHHHhccC--CeEEEEeccCCC----CCC-----------------------------------CC
Q 037525            1 VIILVGSSASAVDICRDLAGVA--KEVHLVSRSVAD----GTY-----------------------------------EK   39 (182)
Q Consensus         1 ~V~VVG~G~sg~d~A~~l~~~a--~~V~l~~r~~~~----~~~-----------------------------------~~   39 (182)
                      ||+|||+|+||+-.|..|++..  .+|++++|+...    ...                                   ..
T Consensus         6 rVaIIGaG~sGl~~A~~L~~~~~~~~v~vfEk~~~iGG~W~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~s~~y~~   85 (335)
T d2gv8a1           6 KIAIIGAGPSGLVTAKALLAEKAFDQVTLFERRGSPGGVWNYTSTLSNKLPVPSTNPILTTEPIVGPAALPVYPSPLYRD   85 (335)
T ss_dssp             EEEEECCSHHHHHHHHHHHTTTCCSEEEEECSSSSSSTTCSCCSCCCSCCCSSBCCTTCCCCCBCCSSSCCBCCCCCCTT
T ss_pred             eEEEECcCHHHHHHHHHHHHhCCCCCEEEEECCCCCCCcccccCCCCcccCCcccccccccccccccccccccccccchh
Confidence            5999999999999999998754  489999988532    000                                   00


Q ss_pred             C----------------C----CC------------------CCeEEcceeEEeeC-CC--eEEEcCC---c---EEecC
Q 037525           40 Q----------------P----GF------------------DNMWLHSMIESAHD-NG--AVVFRNG---H---TVHAD   72 (182)
Q Consensus        40 ~----------------~----~~------------------~~i~~~~~v~~~~~-~~--~v~~~dg---~---~~~~D   72 (182)
                      +                +    .+                  .+|..+..|+++.. ++  .|++.++   +   ...+|
T Consensus        86 l~~~~~~~~~~~~~~~~~~~~~~f~~~~~~~~yl~~~~~~~~~~I~~~t~V~~v~~~~~~w~Vt~~~~~~~~~~~~~~~d  165 (335)
T d2gv8a1          86 LQTNTPIELMGYCDQSFKPQTLQFPHRHTIQEYQRIYAQPLLPFIKLATDVLDIEKKDGSWVVTYKGTKAGSPISKDIFD  165 (335)
T ss_dssp             CBCSSCHHHHSCTTCCCCTTCCSSCBHHHHHHHHHHHHGGGGGGEECSEEEEEEEEETTEEEEEEEESSTTCCEEEEEES
T ss_pred             hhcCCcHhhhhhhhhcCCcccccCCchHHHHHHHHHHHHHhhhcccCceEEEEEEecCCEEEEEEEecCCCCeEEEEEee
Confidence            0                0    00                  13455666776653 22  3666542   2   24589


Q ss_pred             EEEEecccccC--CCCCCCC------------CceecCCCccccccccccCCCCCCCEEEEeccCCcccccHHHHHHHHH
Q 037525           73 VILHCTGYKYH--FPFLETN------------GIVTMDDNRVGPLYKHVFPPVLAPWLSFVGLPWKVIPFPLCEYQSKWI  138 (182)
Q Consensus        73 ~vi~atG~~~~--~~~l~~~------------~~~~~~~~~~~~ly~~~~~~~~~p~l~~iG~~~~~~~~~~~e~qa~~i  138 (182)
                      .||+|||....  .+.+...            ..+..++..+.++|+|++.+. +|+|+|+|.+....+++.+|.||.|+
T Consensus       166 ~VI~AtG~~s~p~~~~~~~~~~p~~~~f~~~~~~~~~~~~~~~~ly~~~~~~~-~p~l~f~G~~~~v~~~~~~e~Qa~~~  244 (335)
T d2gv8a1         166 AVSICNGHYEVPYTGYLYSVPFPSLAKLKSPETKLIDDGSHVHNVYQHIFYIP-DPTLAFVGLALHVVPFPTSQAQAAFL  244 (335)
T ss_dssp             EEEECCCSSSSBCCCBCCCCCCHHHHSCCSTTTCCCSSSSSCCSEETTTEETT-CTTEEESSCCBSSCHHHHHHHHHHHH
T ss_pred             EEEEcccccccceecccccCCCCcchhcccCccceeccccceeeeecccccCC-CCceEEeeeEEEEecCCchHHHHHHH
Confidence            99999997532  2222110            011113345557999999998 79999999988777899999999999


Q ss_pred             HHHHcCCCCCCCHHHHHHHHHHHHHHHHHcCCCCcceecCC
Q 037525          139 AGVLSGQIVLPSQEEMMEDTKAFYSTLEASGTPKRYTHNMG  179 (182)
Q Consensus       139 a~~l~g~~~lP~~~~m~~~~~~~~~~~~~~~~~~~~~~~~~  179 (182)
                      +++++|+..||++++|.+|..++...  .++.+. .+|.++
T Consensus       245 a~~~~g~~~Lps~~~m~~~~~~~~~~--~~~~~~-~~~~~~  282 (335)
T d2gv8a1         245 ARVWSGRLKLPSKEEQLKWQDELMFS--LSGANN-MYHSLD  282 (335)
T ss_dssp             HHHHTTSSCCCCHHHHHHHHHHHHHH--HTTCGG-GTTBCT
T ss_pred             HHHHcCCccCCCcchhhhhhHHHHHh--hcccCc-cceecC
Confidence            99999999999999999998764332  344334 556654



>d1xhca1 c.3.1.5 (A:1-103,A:226-289) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2gv8a2 c.3.1.5 (A:181-287) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d1d7ya1 c.3.1.5 (A:5-115,A:237-308) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1w4xa1 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Back     information, alignment and structure
>d1q1ra1 c.3.1.5 (A:2-114,A:248-319) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1fcda1 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]} Back     information, alignment and structure
>d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1m6ia1 c.3.1.5 (A:128-263,A:401-477) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1feca2 c.3.1.5 (A:170-286) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d1nhpa1 c.3.1.5 (A:1-119,A:243-321) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1fl2a2 c.3.1.5 (A:326-451) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1trba2 c.3.1.5 (A:119-244) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vdca2 c.3.1.5 (A:118-243) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1w4xa2 c.3.1.5 (A:155-389) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Back     information, alignment and structure
>d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1m6ia2 c.3.1.5 (A:264-400) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mo9a2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1mo9a1 c.3.1.5 (A:2-192,A:314-383) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d1aoga2 c.3.1.5 (A:170-286) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1dxla1 c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ojta2 c.3.1.5 (A:276-400) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1gtea3 c.3.1.1 (A:288-440) Dihydropyrimidine dehydrogenase, domain 3 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1lvla1 c.3.1.5 (A:1-150,A:266-335) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1dxla2 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1vdca1 c.3.1.5 (A:1-117,A:244-316) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1ebda1 c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1trba1 c.3.1.5 (A:1-118,A:245-316) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ps9a2 c.3.1.1 (A:466-627) 2,4-dienoyl-CoA reductase, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3lada1 c.3.1.5 (A:1-158,A:278-348) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1xdia1 c.3.1.5 (A:2-161,A:276-348) Dihydrolipoamide dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1fl2a1 c.3.1.5 (A:212-325,A:452-521) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gqfa1 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein HI0933 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d3grsa1 c.3.1.5 (A:18-165,A:291-363) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lqta1 c.3.1.1 (A:109-324) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ps9a3 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA reductase, middle domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d1gesa1 c.3.1.5 (A:3-146,A:263-335) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ojta1 c.3.1.5 (A:117-275,A:401-470) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d2cula1 c.3.1.7 (A:2-231) GidA-related protein TTHA1897 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1h6va1 c.3.1.5 (A:10-170,A:293-366) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1feca1 c.3.1.5 (A:1-169,A:287-357) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d2i0za1 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1gtea4 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1djqa3 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1djqa2 c.3.1.1 (A:490-645) Trimethylamine dehydrogenase, C-terminal domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1cjca1 c.3.1.1 (A:107-331) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} Back     information, alignment and structure
>d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1aoga1 c.3.1.5 (A:3-169,A:287-357) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Back     information, alignment and structure
>d1i8ta1 c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mutase, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bi7a1 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mutase, N-terminal domain {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]} Back     information, alignment and structure
>d1v59a1 c.3.1.5 (A:1-160,A:283-355) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1k0ia1 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2v5za1 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cjca2 c.4.1.1 (A:6-106,A:332-460) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1lqta2 c.4.1.1 (A:2-108,A:325-456) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d3c96a1 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} Back     information, alignment and structure
>d1rp0a1 c.3.1.6 (A:7-284) Thiazole biosynthetic enzyme Thi4 {Thale cress(Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1pj5a2 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine oxidase {Arthrobacter globiformis [TaxId: 1665]} Back     information, alignment and structure
>d2gf3a1 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]} Back     information, alignment and structure
>d1y0pa2 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d1d4ca2 c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella putrefaciens [TaxId: 24]} Back     information, alignment and structure
>d2bs2a2 c.3.1.4 (A:1-250,A:372-457) Fumarate reductase {Wolinella succinogenes [TaxId: 844]} Back     information, alignment and structure
>d1onfa1 c.3.1.5 (A:1-153,A:271-376) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d2f5va1 c.3.1.2 (A:43-354,A:553-619) Pyranose 2-oxidase {White-rot fungus (Peniophora sp. SG) [TaxId: 204723]} Back     information, alignment and structure
>d3coxa1 c.3.1.2 (A:5-318,A:451-506) Cholesterol oxidase of GMC family {Brevibacterium sterolicum [TaxId: 1702]} Back     information, alignment and structure
>d1kyqa1 c.2.1.11 (A:1-150) Bifunctional dehydrogenase/ferrochelatase Met8p, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1n4wa1 c.3.1.2 (A:9-318,A:451-507) Cholesterol oxidase of GMC family {Streptomyces sp. [TaxId: 1931]} Back     information, alignment and structure
>d2gmha1 c.3.1.2 (A:4-236,A:336-482) Electron transfer flavoprotein-ubiquinone oxidoreductase, EFT-QO {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1qo8a2 c.3.1.4 (A:103-359,A:506-565) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d1pjqa1 c.2.1.11 (A:1-113) Siroheme synthase CysG, domain 1 {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pn0a1 c.3.1.2 (A:1-240,A:342-461) Phenol hydroxylase {Soil-living yeast (Trichosporon cutaneum) [TaxId: 5554]} Back     information, alignment and structure
>d2gjca1 c.3.1.6 (A:16-326) Thiazole biosynthetic enzyme Thi4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1ks9a2 c.2.1.6 (A:1-167) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1neka2 c.3.1.4 (A:1-235,A:356-450) Succinate dehydogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} Back     information, alignment and structure
>d1kdga1 c.3.1.2 (A:215-512,A:694-755) Flavoprotein domain of flavocytochrome cellobiose dehydrogenase (CDH), FAD-binding domain {Fungus (Phanerochaete chrysosporium) [TaxId: 5306]} Back     information, alignment and structure
>d1chua2 c.3.1.4 (A:2-237,A:354-422) L-aspartate oxidase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jnra2 c.3.1.4 (A:2-256,A:402-502) Adenylylsulfate reductase A subunit {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1ju2a1 c.3.1.2 (A:1-293,A:464-521) Hydroxynitrile lyase {Almond (Prunus dulcis) [TaxId: 3755]} Back     information, alignment and structure
>d1gpea1 c.3.1.2 (A:1-328,A:525-587) Glucose oxidase {Penicillium amagasakiense [TaxId: 63559]} Back     information, alignment and structure
>d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1kifa1 c.4.1.2 (A:1-194,A:288-339) D-aminoacid oxidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1f0ya2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wdka3 c.2.1.6 (A:311-496) Fatty oxidation complex alpha subunit, middle domain {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1cf3a1 c.3.1.2 (A:3-324,A:521-583) Glucose oxidase {Aspergillus niger [TaxId: 5061]} Back     information, alignment and structure
>d1jaya_ c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1n1ea2 c.2.1.6 (A:9-197) Glycerol-3- phosphate dehydrogenase {Trypanosome (Leishmania mexicana) [TaxId: 5665]} Back     information, alignment and structure
>d1kf6a2 c.3.1.4 (A:0-225,A:358-442) Fumarate reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1txga2 c.2.1.6 (A:1-180) Glycerol-3- phosphate dehydrogenase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1pjca1 c.2.1.4 (A:136-303) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]} Back     information, alignment and structure
>d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} Back     information, alignment and structure
>d1qyda_ c.2.1.2 (A:) Pinoresinol-lariciresinol reductase {Giant arborvitae (Thuja plicata) [TaxId: 3316]} Back     information, alignment and structure
>d1l7da1 c.2.1.4 (A:144-326) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]} Back     information, alignment and structure
>d1npya1 c.2.1.7 (A:103-269) Shikimate 5-dehydrogenase-like protein HI0607 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} Back     information, alignment and structure
>d1gpja2 c.2.1.7 (A:144-302) Glutamyl tRNA-reductase middle domain {Archaeon Methanopyrus kandleri [TaxId: 2320]} Back     information, alignment and structure
>d1ez4a1 c.2.1.5 (A:16-162) Lactate dehydrogenase {Lactobacillus pentosus [TaxId: 1589]} Back     information, alignment and structure
>d1nyta1 c.2.1.7 (A:102-271) Shikimate 5-dehydrogenase AroE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1id1a_ c.2.1.9 (A:) Rck domain from putative potassium channel Kch {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1y6ja1 c.2.1.5 (A:7-148) Lactate dehydrogenase {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1qyca_ c.2.1.2 (A:) Phenylcoumaran benzylic ether reductase {Loblolly pine (Pinus taeda) [TaxId: 3352]} Back     information, alignment and structure
>d1p77a1 c.2.1.7 (A:102-272) Shikimate 5-dehydrogenase AroE {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ldna1 c.2.1.5 (A:15-162) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1guza1 c.2.1.5 (A:1-142) Malate dehydrogenase {Chlorobium vibrioforme [TaxId: 1098]} Back     information, alignment and structure
>d2pv7a2 c.2.1.6 (A:92-243) Prephenate dehydrogenase TyrA {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1mv8a2 c.2.1.6 (A:1-202) GDP-mannose 6-dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1nvta1 c.2.1.7 (A:111-287) Shikimate 5-dehydrogenase AroE {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1vi2a1 c.2.1.7 (A:107-288) Putative shikimate dehydrogenase YdiB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ahra2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1kjqa2 c.30.1.1 (A:2-112) Glycinamide ribonucleotide transformylase PurT, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1llda1 c.2.1.5 (A:7-149) Lactate dehydrogenase {Bifidobacterium longum, strain am101-2 [TaxId: 216816]} Back     information, alignment and structure
>d1hyea1 c.2.1.5 (A:1-145) MJ0490, lactate/malate dehydrogenase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2ldxa1 c.2.1.5 (A:1-159) Lactate dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jw9b_ c.111.1.1 (B:) Molybdenum cofactor biosynthesis protein MoeB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ojua1 c.2.1.5 (A:22-163) Malate dehydrogenase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1hyha1 c.2.1.5 (A:21-166) L-2-hydroxyisocapronate dehydrogenase, L-HICDH {Lactobacillus confusus [TaxId: 1583]} Back     information, alignment and structure
>d1vpda2 c.2.1.6 (A:3-163) Hydroxyisobutyrate dehydrogenase {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1i0za1 c.2.1.5 (A:1-160) Lactate dehydrogenase {Human (Homo sapiens), heart isoform (H chain) [TaxId: 9606]} Back     information, alignment and structure
>d1a5za1 c.2.1.5 (A:22-163) Lactate dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1mlda1 c.2.1.5 (A:1-144) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1yovb1 c.111.1.2 (B:12-437) UBA3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3cuma2 c.2.1.6 (A:1-162) Hydroxyisobutyrate dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1i36a2 c.2.1.6 (A:1-152) Conserved hypothetical protein MTH1747 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1yqga2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Neisseria meningitidis, serogroup B [TaxId: 487]} Back     information, alignment and structure
>d1qp8a1 c.2.1.4 (A:83-263) Putative formate dehydrogenase {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1v59a1 c.3.1.5 (A:1-160,A:283-355) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1xgka_ c.2.1.2 (A:) Negative transcriptional regulator NmrA {Aspergillus nidulans [TaxId: 162425]} Back     information, alignment and structure
>d1dxya1 c.2.1.4 (A:101-299) D-2-hydroxyisocaproate dehydrogenase {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d2naca1 c.2.1.4 (A:148-335) Formate dehydrogenase {Pseudomonas sp., strain 101 [TaxId: 306]} Back     information, alignment and structure
>d1j4aa1 c.2.1.4 (A:104-300) D-lactate dehydrogenase {Lactobacillus helveticus [TaxId: 1587]} Back     information, alignment and structure