Citrus Sinensis ID: 037570

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250----
MILSLLLLLLLAFVVSFHFFGLKPSTNSIELNLPPSPPRFPITGNLHQLLGTATLPHGSLQALSKKYGPLMYMHLGYSPTLVVSSAEIAREIIKNHDIVFSNRPKTTAANVFLYGCQDIGFSPYGEYWRQARKTCVLGLLNVILTVSNNIVSRSVLGRRAEEETAGKCNKFGELSRRILVQFVSFSFGDMLPYLGWLDVVTGLIGRLTASSREVDVLFDQVIEKHRISGSDDDHPNRKDLVHVYSNFKGMACLG
cHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccHHHHHHHHHHcccEEEEcccccEEEEccHHHHHHHHHHccccccccccHHHHHHHHcccccEEEccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHcccccHHHHHHHHHHHHHHcccccccccccccHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHcccccccc
cHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccEEccHHHHHHcccccHHHHHHHHHHcccEEEEEcccccEEEEccHHHHHHHHHHccHHHccccccHHHHHHHcccccEEEccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccEccccccccHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHcccccc
MILSLLLLLLLAFVVSFhffglkpstnsielnlppspprfpitgnlhqllgtatlphgslqalskkygplmymhlgysptlvVSSAEIAREIIKnhdivfsnrpkttaANVFLYgcqdigfspygeYWRQARKTCVLGLLNVILTVSNNivsrsvlgrraeeetagkcnkfgELSRRILVQFVSFsfgdmlpylgWLDVVTGLIGRLTASSREVDVLFDQVIEKhrisgsdddhpnrkdlVHVYSnfkgmaclg
MILSLLLLLLLAFVVSFHFFGLKPSTNSIELNLPPSPPRFPITGNLHQLLGTATLPHGSLQALSKKYGPLMYMHLGYSPTLVVSSAEIAREIIKNhdivfsnrpKTTAANVFLYGCQDIGFSPYGEYWRQARKTCVLGLLNVILTvsnnivsrsvlgrraeeetagkcnkfgelsRRILVQFVSFSFGDMLPYLGWLDVVTGLIGRLTASSREVDVLFDQVIEKHrisgsdddhpnrkDLVHVYSNFKGMACLG
MIlslllllllAFVVSFHFFGLKPSTNSIELNLPPSPPRFPITGNLHQLLGTATLPHGSLQALSKKYGPLMYMHLGYSPTLVVSSAEIAREIIKNHDIVFSNRPKTTAANVFLYGCQDIGFSPYGEYWRQARKTCVLGLLNVILTVSNNIVSRSVLGRRAEEETAGKCNKFGELSRRILVQFVSFSFGDMLPYLGWLDVVTGLIGRLTASSREVDVLFDQVIEKHRISGSDDDHPNRKDLVHVYSNFKGMACLG
*ILSLLLLLLLAFVVSFHFFGLKPSTNSIE*********FPITGNLHQLLGTATLPHGSLQALSKKYGPLMYMHLGYSPTLVVSSAEIAREIIKNHDIVFSNRPKTTAANVFLYGCQDIGFSPYGEYWRQARKTCVLGLLNVILTVSNNIVSRSVLGRRAEEETAGKCNKFGELSRRILVQFVSFSFGDMLPYLGWLDVVTGLIGRLTASSREVDVLFDQVI********************************
MILSLLLLLLLAFVVSFHFF******************RFPITGNLHQLLGTATLPHGSLQALSKKYGPLMYMHLGYSPTLVVSSAEIAREIIKNHDIVFSNRPKTTAANVFLYGCQDIGFSPYGEYWRQARKTCVLGLLNVILTVSNNIVSRSVLGRRAEEE**GKCNKFGELSRRILVQFVSFSFGDMLPYLGWLDVVTGLIGRLTASSREVDVLFDQVI******************VHVYSNFKGM****
MILSLLLLLLLAFVVSFHFFGLKPSTNSIELNLPPSPPRFPITGNLHQLLGTATLPHGSLQALSKKYGPLMYMHLGYSPTLVVSSAEIAREIIKNHDIVFSNRPKTTAANVFLYGCQDIGFSPYGEYWRQARKTCVLGLLNVILTVSNNIVSRSVLGRRAEEETAGKCNKFGELSRRILVQFVSFSFGDMLPYLGWLDVVTGLIGRLTASSREVDVLFDQVIEKHRISGSDDDHPNRKDLVHVYSNFKGMACLG
MILSLLLLLLLAFVVSFHFFGLKPSTNSIELNLPPSPPRFPITGNLHQLLGTATLPHGSLQALSKKYGPLMYMHLGYSPTLVVSSAEIAREIIKNHDIVFSNRPKTTAANVFLYGCQDIGFSPYGEYWRQARKTCVLGLLNVILTVSNNIVSRSVLGRRAEEETAGKCNKFGELSRRILVQFVSFSFGDMLPYLGWLDVVTGLIGRLTASSREVDVLFDQVIEKHRISG*******RKDLVHVYSNFKG*****
iHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MILSLLLLLLLAFVVSFHFFGLKPSTNSIELNLPPSPPRFPITGNLHQLLGTATLPHGSLQALSKKYGPLMYMHLGYSPTLVVSSAEIAREIIKNHDIVFSNRPKTTAANVFLYGCQDIGFSPYGEYWRQARKTCVLGLLNVILTVSNNIVSRSVLGRRAEEETAGKCNKFGELSRRILVQFVSFSFGDMLPYLGWLDVVTGLIGRLTASSREVDVLFDQVIEKHRISGSDDDHPNRKDLVHVYSNFKGMACLG
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query254 2.2.26 [Sep-21-2011]
Q9STL2 490 Cytochrome P450 71A21 OS= yes no 0.937 0.485 0.343 4e-43
P24465 502 Cytochrome P450 71A1 OS=P N/A no 0.964 0.488 0.385 4e-42
O81970 499 Cytochrome P450 71A9 OS=G no no 0.803 0.408 0.423 4e-42
P37117 507 Cytochrome P450 71A4 OS=S N/A no 0.795 0.398 0.379 2e-40
P37118 505 Cytochrome P450 71A2 OS=S N/A no 0.885 0.445 0.354 7e-40
P37119365 Cytochrome P450 71A3 (Fra N/A no 0.885 0.616 0.356 2e-39
O49340 497 Cytochrome P450 71A12 OS= no no 0.866 0.442 0.344 4e-39
Q9SAB6 497 Cytochrome P450 71A18 OS= no no 0.767 0.392 0.369 4e-39
Q9STL1 490 Cytochrome P450 71A22 OS= no no 0.826 0.428 0.338 5e-39
Q9STK8 490 Cytochrome P450 71A25 OS= no no 0.885 0.459 0.332 6e-39
>sp|Q9STL2|C71AL_ARATH Cytochrome P450 71A21 OS=Arabidopsis thaliana GN=CYP71A21 PE=2 SV=1 Back     alignment and function desciption
 Score =  174 bits (442), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 98/285 (34%), Positives = 149/285 (52%), Gaps = 47/285 (16%)

Query: 4   SLLLLLLLAFVVSFHFFGLKPSTNSIELNLPPSPPRFPITGNLHQLLGTATLPHGSLQAL 63
           S+ +++L + ++       K      + N P SPPR P+ GNLHQL      PH SL +L
Sbjct: 3   SMTMIILQSLIIFITILFFKKQKRGKKSNTPRSPPRLPLIGNLHQL---GHHPHRSLCSL 59

Query: 64  SKKYGPLMYMHLGYSPTLVVSSAEIAREIIKNHDIVFSNRPKTTAANVFLYGCQDIGFSP 123
           S +YGPLM +HLG  P LVVSSA++AR+I+K HD VF++RP++       Y  +D+ F+P
Sbjct: 60  SHRYGPLMLLHLGRVPVLVVSSADVARDILKTHDRVFASRPRSKLFEKLFYDGRDVAFAP 119

Query: 124 YGEYWRQARKTCVLGLL-NVILT---------------------------------VSNN 149
           YGEYWRQ +  CVL LL N ++T                                 ++N+
Sbjct: 120 YGEYWRQIKSVCVLRLLSNKMVTSFRNVRQEEISLMMEKIQKSSSLQVNVSELLGSLTND 179

Query: 150 IVSRSVLGRRAEEETAGKCNKFGELSRRILVQFVSFSFGDMLPYLGWLDVVTGLIGRLTA 209
           ++SR  LGR+   ET  K     EL +R+++    FS G  +P+LGW+D ++GL G+L  
Sbjct: 180 VISRIALGRKYSGETDSK-----ELMKRLMMLMGEFSVGTYVPWLGWIDWISGLDGQLNK 234

Query: 210 SSREVDVLFDQVIEKHRISGSDDDHPNRKDLVHVYSNFKGMACLG 254
           +  ++D   ++V++ H      D    R D V V    +    +G
Sbjct: 235 TGNDLDEFLEKVVQDHV-----DGDGQRTDFVDVLLRIQREKSIG 274

Arabidopsis thaliana (taxid: 3702)
EC: 1EC: .EC: 1EC: 4EC: .EC: -EC: .EC: -
>sp|P24465|C71A1_PERAE Cytochrome P450 71A1 OS=Persea americana GN=CYP71A1 PE=1 SV=2 Back     alignment and function description
>sp|O81970|C71A9_SOYBN Cytochrome P450 71A9 OS=Glycine max GN=CYP71A9 PE=2 SV=1 Back     alignment and function description
>sp|P37117|C71A4_SOLME Cytochrome P450 71A4 OS=Solanum melongena GN=CYP71A4 PE=2 SV=1 Back     alignment and function description
>sp|P37118|C71A2_SOLME Cytochrome P450 71A2 OS=Solanum melongena GN=CYP71A2 PE=2 SV=1 Back     alignment and function description
>sp|P37119|C71A3_SOLME Cytochrome P450 71A3 (Fragment) OS=Solanum melongena GN=CYP71A3 PE=2 SV=1 Back     alignment and function description
>sp|O49340|C71AC_ARATH Cytochrome P450 71A12 OS=Arabidopsis thaliana GN=CYP71A12 PE=2 SV=1 Back     alignment and function description
>sp|Q9SAB6|C71AI_ARATH Cytochrome P450 71A18 OS=Arabidopsis thaliana GN=CYP71A18 PE=2 SV=2 Back     alignment and function description
>sp|Q9STL1|C71AM_ARATH Cytochrome P450 71A22 OS=Arabidopsis thaliana GN=CYP71A22 PE=2 SV=1 Back     alignment and function description
>sp|Q9STK8|C71AP_ARATH Cytochrome P450 71A25 OS=Arabidopsis thaliana GN=CYP71A25 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query254
224139378 486 cytochrome P450 [Populus trichocarpa] gi 0.830 0.434 0.503 1e-65
224139376 486 cytochrome P450 [Populus trichocarpa] gi 0.838 0.438 0.492 7e-65
224139374 471 cytochrome P450 [Populus trichocarpa] gi 0.803 0.433 0.489 3e-60
356516619 519 PREDICTED: cytochrome P450 71A1-like [Gl 0.787 0.385 0.469 1e-57
224121846 516 cytochrome P450 [Populus trichocarpa] gi 0.917 0.451 0.415 7e-54
224135973 494 predicted protein [Populus trichocarpa] 0.814 0.419 0.456 1e-52
449469743326 PREDICTED: cytochrome P450 71A22-like [C 0.822 0.641 0.425 2e-52
449487825 528 PREDICTED: cytochrome P450 71A1-like [Cu 0.811 0.390 0.444 5e-52
356513646 478 PREDICTED: LOW QUALITY PROTEIN: cytochro 0.933 0.495 0.402 1e-51
357461739 521 Cytochrome P450 [Medicago truncatula] gi 0.901 0.439 0.398 2e-50
>gi|224139378|ref|XP_002323083.1| cytochrome P450 [Populus trichocarpa] gi|222867713|gb|EEF04844.1| cytochrome P450 [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  255 bits (652), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 127/252 (50%), Positives = 168/252 (66%), Gaps = 41/252 (16%)

Query: 26  TNSIELNLPPSPPRFPITGNLHQLLGTATLPHGSLQALSKKYGPLMYMHLGYSPTLVVSS 85
           T S +LNLPPSPP+ P+ GN+H      TLPH SLQALS+KYGPLM +H+G+ PTL+VSS
Sbjct: 11  TTSRKLNLPPSPPKLPVIGNIHHF---GTLPHRSLQALSEKYGPLMLLHMGHVPTLIVSS 67

Query: 86  AEIAREIIKNHDIVFSNRPKTTAANVFLYGCQDIGFSPYGEYWRQARKTCVLGLL----- 140
           AE A EI+K HDIVF+NRP+TTAA++F +GC D+GF+P+GEYWR+ RK  V  LL     
Sbjct: 68  AEAASEIMKTHDIVFANRPQTTAASIFFHGCVDVGFAPFGEYWRKVRKISVQELLGPKTV 127

Query: 141 -------------------------------NVILTVSNNIVSRSVLGRRAEEETAGKCN 169
                                           ++++VSN+IVSR V+GR+A++E  G  +
Sbjct: 128 QSFHYVREEEAAGLIDKIRFACHSGTSVNLSEMLISVSNDIVSRCVVGRKADKE--GGNS 185

Query: 170 KFGELSRRILVQFVSFSFGDMLPYLGWLDVVTGLIGRLTASSREVDVLFDQVIEKHRISG 229
           KFGEL+R ++VQ  +FSFGD+ PYLGW+D +TGLI RL A+SR +D L DQVIE+HR   
Sbjct: 186 KFGELTRTVMVQLTAFSFGDLFPYLGWMDTLTGLIPRLKATSRTLDSLLDQVIEEHRSLE 245

Query: 230 SDDDHPNRKDLV 241
           SD D   + D +
Sbjct: 246 SDGDRCAQTDFL 257

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224139376|ref|XP_002323082.1| cytochrome P450 [Populus trichocarpa] gi|222867712|gb|EEF04843.1| cytochrome P450 [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224139374|ref|XP_002323081.1| cytochrome P450 [Populus trichocarpa] gi|222867711|gb|EEF04842.1| cytochrome P450 [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356516619|ref|XP_003526991.1| PREDICTED: cytochrome P450 71A1-like [Glycine max] Back     alignment and taxonomy information
>gi|224121846|ref|XP_002318687.1| cytochrome P450 [Populus trichocarpa] gi|222859360|gb|EEE96907.1| cytochrome P450 [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224135973|ref|XP_002322207.1| predicted protein [Populus trichocarpa] gi|222869203|gb|EEF06334.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|449469743|ref|XP_004152578.1| PREDICTED: cytochrome P450 71A22-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449487825|ref|XP_004157819.1| PREDICTED: cytochrome P450 71A1-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|356513646|ref|XP_003525522.1| PREDICTED: LOW QUALITY PROTEIN: cytochrome P450 71A1-like [Glycine max] Back     alignment and taxonomy information
>gi|357461739|ref|XP_003601151.1| Cytochrome P450 [Medicago truncatula] gi|355490199|gb|AES71402.1| Cytochrome P450 [Medicago truncatula] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query254
TAIR|locus:504955642 490 CYP71A21 ""cytochrome P450, fa 0.515 0.267 0.481 2.6e-42
TAIR|locus:504955640 490 CYP71A22 ""cytochrome P450, fa 0.519 0.269 0.446 9.3e-39
TAIR|locus:504955637 490 CYP71A25 ""cytochrome P450, fa 0.523 0.271 0.482 5.4e-38
TAIR|locus:2149383 497 CYP71A14 ""cytochrome P450, fa 0.444 0.227 0.482 1.2e-35
TAIR|locus:2079306 500 CYP71B35 ""cytochrome P450, fa 0.409 0.208 0.476 1.3e-35
UNIPROTKB|Q6QNI4 494 CYP71AJ1 "Psoralen synthase" [ 0.421 0.216 0.527 4.5e-35
UNIPROTKB|Q947B7 493 Q947B7 "(+)-menthofuran syntha 0.468 0.241 0.442 5.3e-35
TAIR|locus:2165595 502 CYP71B10 ""cytochrome P450, fa 0.393 0.199 0.475 3.4e-33
TAIR|locus:2079251 500 CYP71B34 ""cytochrome P450, fa 0.413 0.21 0.5 3.6e-33
TAIR|locus:2093511 502 CYP71B19 ""cytochrome P450, fa 0.448 0.227 0.462 4.1e-31
TAIR|locus:504955642 CYP71A21 ""cytochrome P450, family 71, subfamily A, polypeptide 21"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 323 (118.8 bits), Expect = 2.6e-42, Sum P(2) = 2.6e-42
 Identities = 66/137 (48%), Positives = 88/137 (64%)

Query:    15 VSFHFFGLKPSTNSIELNLPPSPPRFPITGNLHQLLGTATLPHGSLQALSKKYGPLMYMH 74
             ++  FF  K      + N P SPPR P+ GNLHQL      PH SL +LS +YGPLM +H
Sbjct:    16 ITILFF--KKQKRGKKSNTPRSPPRLPLIGNLHQL---GHHPHRSLCSLSHRYGPLMLLH 70

Query:    75 LGYSPTLVVSSAEIAREIIKNHDIVFSNRPKTTAANVFLYGCQDIGFSPYGEYWRQARKT 134
             LG  P LVVSSA++AR+I+K HD VF++RP++       Y  +D+ F+PYGEYWRQ +  
Sbjct:    71 LGRVPVLVVSSADVARDILKTHDRVFASRPRSKLFEKLFYDGRDVAFAPYGEYWRQIKSV 130

Query:   135 CVLGLL-NVILTVSNNI 150
             CVL LL N ++T   N+
Sbjct:   131 CVLRLLSNKMVTSFRNV 147
GO:0005506 "iron ion binding" evidence=IEA
GO:0009055 "electron carrier activity" evidence=IEA
GO:0016705 "oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen" evidence=IEA
GO:0019825 "oxygen binding" evidence=ISS
GO:0020037 "heme binding" evidence=IEA
GO:0055114 "oxidation-reduction process" evidence=IEA
TAIR|locus:504955640 CYP71A22 ""cytochrome P450, family 71, subfamily A, polypeptide 22"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:504955637 CYP71A25 ""cytochrome P450, family 71, subfamily A, polypeptide 25"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2149383 CYP71A14 ""cytochrome P450, family 71, subfamily A, polypeptide 14"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2079306 CYP71B35 ""cytochrome P450, family 71, subfamily B, polypeptide 35"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q6QNI4 CYP71AJ1 "Psoralen synthase" [Ammi majus (taxid:48026)] Back     alignment and assigned GO terms
UNIPROTKB|Q947B7 Q947B7 "(+)-menthofuran synthase" [Mentha x piperita (taxid:34256)] Back     alignment and assigned GO terms
TAIR|locus:2165595 CYP71B10 ""cytochrome P450, family 71, subfamily B, polypeptide 10"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2079251 CYP71B34 ""cytochrome P450, family 71, subfamily B, polypeptide 34"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2093511 CYP71B19 ""cytochrome P450, family 71, subfamily B, polypeptide 19"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query254
PLN03112 514 PLN03112, PLN03112, cytochrome P450 family protein 1e-43
PLN02687 517 PLN02687, PLN02687, flavonoid 3'-monooxygenase 4e-36
PLN02183 516 PLN02183, PLN02183, ferulate 5-hydroxylase 1e-34
PLN00110 504 PLN00110, PLN00110, flavonoid 3',5'-hydroxylase (F 8e-33
PLN03234 499 PLN03234, PLN03234, cytochrome P450 83B1; Provisio 2e-31
PLN02966 502 PLN02966, PLN02966, cytochrome P450 83A1 2e-20
PLN02394 503 PLN02394, PLN02394, trans-cinnamate 4-monooxygenas 1e-18
pfam00067 461 pfam00067, p450, Cytochrome P450 1e-14
PTZ00404 482 PTZ00404, PTZ00404, cytochrome P450; Provisional 3e-14
PLN02655 466 PLN02655, PLN02655, ent-kaurene oxidase 1e-11
PLN00168 519 PLN00168, PLN00168, Cytochrome P450; Provisional 4e-10
PLN03018 534 PLN03018, PLN03018, homomethionine N-hydroxylase 4e-10
PLN02971 543 PLN02971, PLN02971, tryptophan N-hydroxylase 7e-09
PLN02196 463 PLN02196, PLN02196, abscisic acid 8'-hydroxylase 3e-05
>gnl|CDD|215583 PLN03112, PLN03112, cytochrome P450 family protein; Provisional Back     alignment and domain information 
 Score =  153 bits (389), Expect = 1e-43
 Identities = 80/265 (30%), Positives = 119/265 (44%), Gaps = 43/265 (16%)

Query: 1   MILSLLLLLLLAFVVSFHFFGLKPSTNSIELNLPPSPPRFPITGNLHQLLGTATLPHGSL 60
           M   LL LL    + +   +    ++    L LPP PPR+PI GNL QL     LPH  L
Sbjct: 1   MDSFLLSLLFSVLIFNVLIWRWLNASMRKSLRLPPGPPRWPIVGNLLQL---GPLPHRDL 57

Query: 61  QALSKKYGPLMYMHLGYSPTLVVSSAEIAREIIKNHDIVFSNRPKTTAANVFLYGCQDIG 120
            +L KKYGPL+Y+ LG    +     E+ REI+   D VF++RP+T AA    YGC D+ 
Sbjct: 58  ASLCKKYGPLVYLRLGSVDAITTDDPELIREILLRQDDVFASRPRTLAAVHLAYGCGDVA 117

Query: 121 FSPYGEYWRQARKTCVLGLL------------------------------------NVIL 144
            +P G +W++ R+ C+  LL                                     V+ 
Sbjct: 118 LAPLGPHWKRMRRICMEHLLTTKRLESFAKHRAEEARHLIQDVWEAAQTGKPVNLREVLG 177

Query: 145 TVSNNIVSRSVLGRR---AEEETAGKCNKFGELSRRILVQFVSFSFGDMLPYLGWLDVVT 201
             S N V+R +LG++   AE     +  +F  ++  +         GD LP   WLD   
Sbjct: 178 AFSMNNVTRMLLGKQYFGAESAGPKEAMEFMHITHELFRLLGVIYLGDYLPAWRWLD-PY 236

Query: 202 GLIGRLTASSREVDVLFDQVIEKHR 226
           G   ++    + VD   D++I++HR
Sbjct: 237 GCEKKMREVEKRVDEFHDKIIDEHR 261

Length = 514
>gnl|CDD|215371 PLN02687, PLN02687, flavonoid 3'-monooxygenase Back     alignment and domain information
>gnl|CDD|165828 PLN02183, PLN02183, ferulate 5-hydroxylase Back     alignment and domain information
>gnl|CDD|177725 PLN00110, PLN00110, flavonoid 3',5'-hydroxylase (F3'5'H); Provisional Back     alignment and domain information
>gnl|CDD|178773 PLN03234, PLN03234, cytochrome P450 83B1; Provisional Back     alignment and domain information
>gnl|CDD|178550 PLN02966, PLN02966, cytochrome P450 83A1 Back     alignment and domain information
>gnl|CDD|215221 PLN02394, PLN02394, trans-cinnamate 4-monooxygenase Back     alignment and domain information
>gnl|CDD|215689 pfam00067, p450, Cytochrome P450 Back     alignment and domain information
>gnl|CDD|173595 PTZ00404, PTZ00404, cytochrome P450; Provisional Back     alignment and domain information
>gnl|CDD|215354 PLN02655, PLN02655, ent-kaurene oxidase Back     alignment and domain information
>gnl|CDD|215086 PLN00168, PLN00168, Cytochrome P450; Provisional Back     alignment and domain information
>gnl|CDD|178592 PLN03018, PLN03018, homomethionine N-hydroxylase Back     alignment and domain information
>gnl|CDD|166612 PLN02971, PLN02971, tryptophan N-hydroxylase Back     alignment and domain information
>gnl|CDD|177847 PLN02196, PLN02196, abscisic acid 8'-hydroxylase Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 254
KOG0156 489 consensus Cytochrome P450 CYP2 subfamily [Secondar 100.0
PLN02687 517 flavonoid 3'-monooxygenase 99.97
PLN03234 499 cytochrome P450 83B1; Provisional 99.97
PLN02971 543 tryptophan N-hydroxylase 99.97
PTZ00404 482 cytochrome P450; Provisional 99.96
PLN00110 504 flavonoid 3',5'-hydroxylase (F3'5'H); Provisional 99.96
PLN03112 514 cytochrome P450 family protein; Provisional 99.96
PLN02183 516 ferulate 5-hydroxylase 99.96
PLN02966 502 cytochrome P450 83A1 99.96
PLN02655 466 ent-kaurene oxidase 99.95
PLN02290 516 cytokinin trans-hydroxylase 99.94
PLN00168 519 Cytochrome P450; Provisional 99.94
KOG0158 499 consensus Cytochrome P450 CYP3/CYP5/CYP6/CYP9 subf 99.94
PLN03018 534 homomethionine N-hydroxylase 99.94
PLN02394 503 trans-cinnamate 4-monooxygenase 99.94
KOG0157 497 consensus Cytochrome P450 CYP4/CYP19/CYP26 subfami 99.94
PLN02500 490 cytochrome P450 90B1 99.94
PLN02196 463 abscisic acid 8'-hydroxylase 99.93
PLN02987 472 Cytochrome P450, family 90, subfamily A 99.93
PF00067 463 p450: Cytochrome P450 p450 superfamily signature b 99.93
PLN02774 463 brassinosteroid-6-oxidase 99.92
PLN02169 500 fatty acid (omega-1)-hydroxylase/midchain alkane h 99.91
PLN02302 490 ent-kaurenoic acid oxidase 99.91
PLN03141 452 3-epi-6-deoxocathasterone 23-monooxygenase; Provis 99.9
PLN03195 516 fatty acid omega-hydroxylase; Provisional 99.9
PLN02738 633 carotene beta-ring hydroxylase 99.88
PLN02936 489 epsilon-ring hydroxylase 99.87
KOG0159 519 consensus Cytochrome P450 CYP11/CYP12/CYP24/CYP27 99.86
PLN02426 502 cytochrome P450, family 94, subfamily C protein 99.79
PLN02648 480 allene oxide synthase 99.66
KOG0684 486 consensus Cytochrome P450 [Secondary metabolites b 99.61
COG2124 411 CypX Cytochrome P450 [Secondary metabolites biosyn 99.18
>KOG0156 consensus Cytochrome P450 CYP2 subfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information 
Probab=100.00  E-value=4.9e-35  Score=235.84  Aligned_cols=216  Identities=38%  Similarity=0.703  Sum_probs=181.7

Q ss_pred             CCCCCCCCCCccccccccccCCCCCCchHHHHHHHhhCCeEEEEeCCcCeEEeccHHHHHHHHHHcCcccCCCCC-cchh
Q 037570           31 LNLPPSPPRFPITGNLHQLLGTATLPHGSLQALSKKYGPLMYMHLGYSPTLVVSSAEIAREIIKNHDIVFSNRPK-TTAA  109 (254)
Q Consensus        31 ~~~~pgp~~~p~~G~~~~~~~~~~~~~~~~~~~~~~yG~i~~~~~~~~~~vvv~dp~~ik~il~~~~~~~~~~~~-~~~~  109 (254)
                      .+.||||+++|++||++++ .. ..++..+.+|+++|||++.+|+|..++|||+|+++++|++++++..|++||. ....
T Consensus        25 ~~lPPGP~~lPiIGnl~~l-~~-~~~h~~~~~ls~~yGpi~tl~lG~~~~Vviss~~~akE~l~~~d~~fa~Rp~~~~~~  102 (489)
T KOG0156|consen   25 RNLPPGPPPLPIIGNLHQL-GS-LPPHRSFRKLSKKYGPVFTLRLGSVPVVVISSYEAAKEVLVKQDLEFADRPDPTATL  102 (489)
T ss_pred             CCCCcCCCCCCccccHHHc-CC-CchhHHHHHHHHHhCCeEEEEecCceEEEECCHHHHHHHHHhCCccccCCCCchhhH
Confidence            7799999999999999999 51 3499999999999999999999999999999999999999999999999997 3344


Q ss_pred             hhhccCCceeeeCCCChHHHHHHHHHHHHHHH-----------------------------------HHHHHHHHHHHHH
Q 037570          110 NVFLYGCQDIGFSPYGEYWRQARKTCVLGLLN-----------------------------------VILTVSNNIVSRS  154 (254)
Q Consensus       110 ~~~~~~~~~~~~~~~g~~w~~~R~~l~~~f~~-----------------------------------~~~~~~~dvi~~~  154 (254)
                      ..+..++.|+++++||+.||.+||+....+..                                   .+..++.+||+++
T Consensus       103 ~~~~~~~~~i~~a~yG~~Wr~~Rr~~~~~L~~~~~~~~~~~~R~~E~~~l~~~l~~~~~~~~vdl~~~l~~~~~nvI~~~  182 (489)
T KOG0156|consen  103 KYLSYGGKGIVFAPYGDYWREMRRFALTELRSFGRGKSFMEIREEEVDELVKKLSKSKKGEPVDLSELLDLLVGNVICRM  182 (489)
T ss_pred             HHhcCCCCceEeCCCcHHHHHHHHHHHHHhcChhhhhhhHHHHHHHHHHHHHHHHhcCCCceeeHHHHHHHHHHHHHHHH
Confidence            55665789999998899999999999877654                                   6678899999999


Q ss_pred             HhcccccccchhhhhHHHHHHHHHHHhcccCCcccccc-ccchhhhhccHHHHHHHHHHHHHHHHHHHHHHHHhcCCCCC
Q 037570          155 VLGRRAEEETAGKCNKFGELSRRILVQFVSFSFGDMLP-YLGWLDVVTGLIGRLTASSREVDVLFDQVIEKHRISGSDDD  233 (254)
Q Consensus       155 ~fG~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~p-~l~~l~~~~~~~~~~~~~~~~~~~~~~~~i~~~~~~~~~~~  233 (254)
                      +||.+++..++++..++.+.+.+.....+.....+++| ++.++++..+..++.+....++.++++++|++++++. .. 
T Consensus       183 ~fG~rf~~~~~~~~~~~~~l~~~~~~~~~~~~~~d~~p~~l~~~~~~~g~~~~~~~~~~~~~~~~~~~i~eh~~~~-~~-  260 (489)
T KOG0156|consen  183 LFGRRFEEEDEEEFLELKELVEESLELLGSFNLSDYFPFLLRWLDGISGLEKRLKKVSKRLDEFLERIIDEHREKI-GD-  260 (489)
T ss_pred             HhCCccccCCchHHHHHHHHHHHHHHHhCCccHHHHhhHHHHhcccccHHHHHHHHHHHHHHHHHHHHHHHHHhhh-cc-
Confidence            99999997523455568899999998888888888999 6776664446667777777789999999999998865 21 


Q ss_pred             CCCCccHHHHhhcccccc
Q 037570          234 HPNRKDLVHVYSNFKGMA  251 (254)
Q Consensus       234 ~~~~~d~l~~ll~~~~~~  251 (254)
                       ++.+|++|.||+..+++
T Consensus       261 -~~~~D~vD~lL~~~~~~  277 (489)
T KOG0156|consen  261 -EEGRDFVDALLKLMKEE  277 (489)
T ss_pred             -CCCCcHHHHHHHhhccc
Confidence             22289999999886543

>PLN02687 flavonoid 3'-monooxygenase Back     alignment and domain information
>PLN03234 cytochrome P450 83B1; Provisional Back     alignment and domain information
>PLN02971 tryptophan N-hydroxylase Back     alignment and domain information
>PTZ00404 cytochrome P450; Provisional Back     alignment and domain information
>PLN00110 flavonoid 3',5'-hydroxylase (F3'5'H); Provisional Back     alignment and domain information
>PLN03112 cytochrome P450 family protein; Provisional Back     alignment and domain information
>PLN02183 ferulate 5-hydroxylase Back     alignment and domain information
>PLN02966 cytochrome P450 83A1 Back     alignment and domain information
>PLN02655 ent-kaurene oxidase Back     alignment and domain information
>PLN02290 cytokinin trans-hydroxylase Back     alignment and domain information
>PLN00168 Cytochrome P450; Provisional Back     alignment and domain information
>KOG0158 consensus Cytochrome P450 CYP3/CYP5/CYP6/CYP9 subfamilies [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PLN03018 homomethionine N-hydroxylase Back     alignment and domain information
>PLN02394 trans-cinnamate 4-monooxygenase Back     alignment and domain information
>KOG0157 consensus Cytochrome P450 CYP4/CYP19/CYP26 subfamilies [Secondary metabolites biosynthesis, transport and catabolism; Lipid transport and metabolism] Back     alignment and domain information
>PLN02500 cytochrome P450 90B1 Back     alignment and domain information
>PLN02196 abscisic acid 8'-hydroxylase Back     alignment and domain information
>PLN02987 Cytochrome P450, family 90, subfamily A Back     alignment and domain information
>PF00067 p450: Cytochrome P450 p450 superfamily signature b-class p450 signature mitochondrial p450 signature E-class p450 group I signature E-class p450 group II signature E-class p450 group IV signature; InterPro: IPR001128 Cytochrome P450 enzymes are a superfamily of haem-containing mono-oxygenases that are found in all kingdoms of life, and which show extraordinary diversity in their reaction chemistry Back     alignment and domain information
>PLN02774 brassinosteroid-6-oxidase Back     alignment and domain information
>PLN02169 fatty acid (omega-1)-hydroxylase/midchain alkane hydroxylase Back     alignment and domain information
>PLN02302 ent-kaurenoic acid oxidase Back     alignment and domain information
>PLN03141 3-epi-6-deoxocathasterone 23-monooxygenase; Provisional Back     alignment and domain information
>PLN03195 fatty acid omega-hydroxylase; Provisional Back     alignment and domain information
>PLN02738 carotene beta-ring hydroxylase Back     alignment and domain information
>PLN02936 epsilon-ring hydroxylase Back     alignment and domain information
>KOG0159 consensus Cytochrome P450 CYP11/CYP12/CYP24/CYP27 subfamilies [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PLN02426 cytochrome P450, family 94, subfamily C protein Back     alignment and domain information
>PLN02648 allene oxide synthase Back     alignment and domain information
>KOG0684 consensus Cytochrome P450 [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>COG2124 CypX Cytochrome P450 [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query254
4i8v_A 491 Human Cytochrome P450 1a1 In Complex With Alpha-nap 2e-06
1dt6_A 473 Structure Of Mammalian Cytochrome P450 2c5 Length = 4e-06
2hi4_A 495 Crystal Structure Of Human Microsomal P450 1a2 In C 5e-06
2q6n_A 478 Structure Of Cytochrome P450 2b4 With Bound 1-(4- C 5e-06
4h1n_A 479 Crystal Structure Of P450 2b4 F297a Mutant In Compl 5e-06
3tk3_A 476 Cytochrome P450 2b4 Mutant L437a In Complex With 4- 6e-06
3ruk_A 494 Human Cytochrome P450 Cyp17a1 In Complex With Abira 6e-06
1suo_A 476 Structure Of Mammalian Cytochrome P450 2b4 With Bou 6e-06
3pm0_A 507 Structural Characterization Of The Complex Between 7e-06
1po5_A 476 Structure Of Mammalian Cytochrome P450 2b4 Length = 1e-05
1r9o_A 477 Crystal Structure Of P4502c9 With Flurbiprofen Boun 2e-05
1z10_A 476 Crystal Structure Of Human Microsomal P450 2a6 With 3e-05
2pg5_A 476 Crystal Structure Of Human Microsomal P450 2a6 N297 3e-05
2pg6_A 476 Crystal Structure Of Human Microsomal P450 2a6 L240 3e-05
3qm4_A 479 Human Cytochrome P450 (Cyp) 2d6 - Prinomastat Compl 3e-05
2pg7_A 476 Crystal Structure Of Human Microsomal P450 2a6 N297 3e-05
2f9q_A 479 Crystal Structure Of Human Cytochrome P450 2d6 Leng 3e-05
1pq2_A 476 Crystal Structure Of Human Drug Metabolizing Cytoch 3e-05
2p85_A 476 Structure Of Human Lung Cytochrome P450 2a13 With I 3e-05
3qz1_A 496 Crystal Structure Of Bovine Steroid Of 21-Hydroxyla 7e-05
3ebs_A 476 Human Cytochrome P450 2a6 I208sI300FG301AS369G IN C 7e-05
1og2_A 475 Structure Of Human Cytochrome P450 Cyp2c9 Length = 7e-05
4gqs_A 477 Structure Of Human Microsomal Cytochrome P450 (cyp) 2e-04
>pdb|4I8V|A Chain A, Human Cytochrome P450 1a1 In Complex With Alpha-naphthoflavone Length = 491 Back     alignment and structure 
Iteration: 1

 Score = 48.9 bits (115), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 33/119 (27%), Positives = 56/119 (47%), Gaps = 5/119 (4%)
Query: 22  LKPSTNSIELNLPPSPPRFPITGNLHQLLGTATLPHGSLQALSKKYGPLMYMHLGYSPTL 81
           +   T+S  L  PP P  +P+ G++   L     PH +L  +S++YG ++ + +G +P +
Sbjct: 1   MAKKTSSKGLKNPPGPWGWPLIGHM---LTLGKNPHLALSRMSQQYGDVLQIRIGSTPVV 57
Query: 82  VVSSAEIAREIIKNHDIVFSNRPKTTAANVFLYGCQDIGFSP-YGEYWRQARKTCVLGL 139
           V+S  +  R+ +      F  RP      +   G Q + FSP  G  W   R+    GL
Sbjct: 58  VLSGLDTIRQALVRQGDDFKGRPDLYTFTLISNG-QSMSFSPDSGPVWAARRRLAQNGL 115
>pdb|1DT6|A Chain A, Structure Of Mammalian Cytochrome P450 2c5 Length = 473 Back     alignment and structure
>pdb|2HI4|A Chain A, Crystal Structure Of Human Microsomal P450 1a2 In Complex With Alpha-Naphthoflavone Length = 495 Back     alignment and structure
>pdb|2Q6N|A Chain A, Structure Of Cytochrome P450 2b4 With Bound 1-(4- Cholorophenyl)imidazole Length = 478 Back     alignment and structure
>pdb|4H1N|A Chain A, Crystal Structure Of P450 2b4 F297a Mutant In Complex With Anti- Platelet Drug Clopidogrel Length = 479 Back     alignment and structure
>pdb|3TK3|A Chain A, Cytochrome P450 2b4 Mutant L437a In Complex With 4-(4-Chlorophenyl) Imidazole Length = 476 Back     alignment and structure
>pdb|3RUK|A Chain A, Human Cytochrome P450 Cyp17a1 In Complex With Abiraterone Length = 494 Back     alignment and structure
>pdb|1SUO|A Chain A, Structure Of Mammalian Cytochrome P450 2b4 With Bound 4-(4- Chlorophenyl)imidazole Length = 476 Back     alignment and structure
>pdb|3PM0|A Chain A, Structural Characterization Of The Complex Between Alpha- Naphthoflavone And Human Cytochrome P450 1b1 (Cyp1b1) Length = 507 Back     alignment and structure
>pdb|1PO5|A Chain A, Structure Of Mammalian Cytochrome P450 2b4 Length = 476 Back     alignment and structure
>pdb|1R9O|A Chain A, Crystal Structure Of P4502c9 With Flurbiprofen Bound Length = 477 Back     alignment and structure
>pdb|1Z10|A Chain A, Crystal Structure Of Human Microsomal P450 2a6 With Coumarin Bound Length = 476 Back     alignment and structure
>pdb|2PG5|A Chain A, Crystal Structure Of Human Microsomal P450 2a6 N297q Length = 476 Back     alignment and structure
>pdb|2PG6|A Chain A, Crystal Structure Of Human Microsomal P450 2a6 L240cN297Q Length = 476 Back     alignment and structure
>pdb|3QM4|A Chain A, Human Cytochrome P450 (Cyp) 2d6 - Prinomastat Complex Length = 479 Back     alignment and structure
>pdb|2PG7|A Chain A, Crystal Structure Of Human Microsomal P450 2a6 N297qI300V Length = 476 Back     alignment and structure
>pdb|2F9Q|A Chain A, Crystal Structure Of Human Cytochrome P450 2d6 Length = 479 Back     alignment and structure
>pdb|1PQ2|A Chain A, Crystal Structure Of Human Drug Metabolizing Cytochrome P450 2c8 Length = 476 Back     alignment and structure
>pdb|2P85|A Chain A, Structure Of Human Lung Cytochrome P450 2a13 With Indole Bound In Two Alternate Conformations Length = 476 Back     alignment and structure
>pdb|3QZ1|A Chain A, Crystal Structure Of Bovine Steroid Of 21-Hydroxylase (P450c21) Length = 496 Back     alignment and structure
>pdb|3EBS|A Chain A, Human Cytochrome P450 2a6 I208sI300FG301AS369G IN COMPLEX With Phenacetin Length = 476 Back     alignment and structure
>pdb|1OG2|A Chain A, Structure Of Human Cytochrome P450 Cyp2c9 Length = 475 Back     alignment and structure
>pdb|4GQS|A Chain A, Structure Of Human Microsomal Cytochrome P450 (cyp) 2c19 Length = 477 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query254
3b98_A 475 Prostaglandin I2 synthase; prostacyclin synthase, 2e-45
3n9y_A 487 Cholesterol SIDE-chain cleavage enzyme; cytochrome 1e-36
3k9v_A 482 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitocho 2e-31
3qz1_A 496 Steroid 21-hydroxylase; P450 monooxygenase, oxidor 5e-29
3dax_A 491 Cytochrome P450 7A1; cholesterol, cholesterol 7-al 3e-28
3swz_A 494 Steroid 17-alpha-hydroxylase/17,20 lyase; cytochro 8e-27
3czh_A 481 Cytochrome P450 2R1; vitamin D, vitamin S 25-hydro 1e-25
3b6h_A 498 Prostacyclin synthase; enzyme-inhibitor complex, C 4e-24
3pm0_A 507 Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase 4e-24
3tbg_A 479 Cytochrome P450 2D6; monooxygenase, thioridazine, 6e-23
2hi4_A 495 Cytochrome P450 1A2; CYP1A2, monooxygenase, drug m 8e-23
1po5_A 476 Cytochrome P450 2B4; oxidoreductase, membrane prot 6e-21
1r9o_A 477 Cytochrome P450 2C9; monooxygenase, drug metaboliz 1e-19
3e6i_A 476 CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, mono 1e-19
2fdv_A 476 Cytochrome P450 2A6; CYP2A6, monooxygenase, drug m 4e-19
1izo_A 417 P450bsbeta, cytochrome P450 152A1; heme protein, p 2e-15
2cib_A 455 Cytochrome P450 51; heme, heme lipid synthesis, me 1e-14
3s79_A 503 Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD 4e-14
3awm_A 415 Fatty acid alpha-hydroxylase; cytochrome P450, per 7e-12
2ve3_A 444 Putative cytochrome P450 120; oxidoreductase, mono 6e-11
3dbg_A 467 Putative cytochrome P450; cytochrome P450 oxidored 6e-11
3i3k_A 461 Lanosterol 14-alpha demethylase; cytochrome P450, 2e-10
3gw9_A 450 Sterol 14alpha-demethylase; CYP51, cytochrome P450 4e-10
2ij2_A 470 Cytochrome P450 BM3; monoxygenase, heme binding pr 2e-09
3mdm_A 456 Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, th 2e-04
3nxu_A 485 Cytochrome P450 3A4; alpha beta protein, cytochrom 3e-04
>3b98_A Prostaglandin I2 synthase; prostacyclin synthase, cytochrome P450 8A1, CYP8A1, isomerase; HET: HEM; 2.08A {Danio rerio} PDB: 3b99_A* Length = 475 Back     alignment and structure
 Score =  157 bits (399), Expect = 2e-45
 Identities = 27/269 (10%), Positives = 64/269 (23%), Gaps = 66/269 (24%)

Query: 11  LAFVVSFHFFGLKPSTNSIELNLPPSPP-RFPITGNLHQLLGTATLPHGSLQALSKKYGP 69
           +A   S   +G +        N PP      P  G+  +           L  + +K+G 
Sbjct: 1   MAKKTSSVLYGRRTRR----RNEPPLDKGMIPWLGHALEF---GKDAAKFLTRMKEKHGD 53

Query: 70  LMYMHLGYSPTLVVSSAEIAREIIKNHDIVFSNRPKTTAANVFLYGCQDIGFSPYGEYWR 129
           +  +        V+  +     ++ +      +  +T+ A V +    ++    +     
Sbjct: 54  IFTVRAAGLYITVLLDSNCYDAVLSDVA----SLDQTSYAQVLMKRIFNMILPSHNPESE 109

Query: 130 QARKTCVL-----------------------------------GLLNVILTVSNNIVSRS 154
           + R                                        GL N+  ++       +
Sbjct: 110 KKRAEMHFQGASLTQLSNSMQNNLRLLMTPSEMGLKTSEWKKDGLFNLCYSLLFKTGYLT 169

Query: 155 VLGRRAEEETAGKCNKFGELSRRILVQFVSFSFGDMLPYLGWLDVVTGLIGRLTASSREV 214
           V G                   +I  +F    F  +LP L        +       +   
Sbjct: 170 VFGAENNNS---------AALTQIYEEF--RRFDKLLPKLARTT----VNKEEKQIASAA 214

Query: 215 DVLFDQVIEKHRISGSDDDHPNRKDLVHV 243
                + +    +          +  +  
Sbjct: 215 REKLWKWLTPSGLDRKP----REQSWLGS 239
>3n9y_A Cholesterol SIDE-chain cleavage enzyme; cytochrome P450, cholesterol SIDE chain cleavage, structural genomics, structural genomics consortium, SGC; HET: HEM CLR; 2.10A {Homo sapiens} PDB: 3n9z_A* 3na1_A* 3na0_A* 3mzs_A* Length = 487 Back     alignment and structure
>3k9v_A 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial; mitochondrial cytochrome P450, monotopic membrane protein, monooxygenase; HET: HEM CPS; 2.50A {Rattus norvegicus} PDB: 3k9y_A* Length = 482 Back     alignment and structure
>3qz1_A Steroid 21-hydroxylase; P450 monooxygenase, oxidoreductase; HET: HEM 3QZ; 3.00A {Bos taurus} Length = 496 Back     alignment and structure
>3dax_A Cytochrome P450 7A1; cholesterol, cholesterol 7-alpha hydroxylase, structural genomics, structural genomics consortium, SGC, cholesterol metabolism; HET: HEM; 2.15A {Homo sapiens} PDB: 3sn5_A* Length = 491 Back     alignment and structure
>3swz_A Steroid 17-alpha-hydroxylase/17,20 lyase; cytochrome P450, CYP17A1, P450C17, P450 17A1, monooxyg 17A-hydroxylase, heme protein; HET: HEM TOK; 2.40A {Homo sapiens} PDB: 3ruk_A* Length = 494 Back     alignment and structure
>3czh_A Cytochrome P450 2R1; vitamin D, vitamin S 25-hydroxylase, drug metabolism, structural genomics, structural genomics consortium, SGC; HET: BCD HEM D2V; 2.30A {Homo sapiens} SCOP: a.104.1.1 PDB: 2ojd_A* 3c6g_A* 3dl9_A* Length = 481 Back     alignment and structure
>3b6h_A Prostacyclin synthase; enzyme-inhibitor complex, CYP8A1, cytochrome P450, endoplasmic reticulum, fatty acid biosynthesis, heme, iron, isomerase; HET: BOG MXD HEM; 1.62A {Homo sapiens} PDB: 2iag_A* Length = 498 Back     alignment and structure
>3pm0_A Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase, alpha-naphthoflavone, 17BETA-estradiol, oxidoreductase; HET: HEM BHF; 2.70A {Homo sapiens} Length = 507 Back     alignment and structure
>3tbg_A Cytochrome P450 2D6; monooxygenase, thioridazine, oxidoreductase; HET: RTZ HEM; 2.10A {Homo sapiens} PDB: 3qm4_A* 2f9q_A* Length = 479 Back     alignment and structure
>2hi4_A Cytochrome P450 1A2; CYP1A2, monooxygenase, drug metabolizing enzyme, alpha-naphthoflavone, benzo(H)flavone, 7,8- benzoflavone, oxidoreductase; HET: HEM BHF; 1.95A {Homo sapiens} Length = 495 Back     alignment and structure
>1po5_A Cytochrome P450 2B4; oxidoreductase, membrane protein, CYP 2B4, CYP LM2, cytochro monooxygenase; HET: HEM; 1.60A {Oryctolagus cuniculus} SCOP: a.104.1.1 PDB: 3mvr_A* 2bdm_A* 3g5n_A* 3g93_A* 3kw4_A* 3me6_A* 1suo_A* 3r1a_A* 3r1b_A* 2q6n_A* 3tk3_A* 3ibd_A* 3qoa_A* 3qu8_A* Length = 476 Back     alignment and structure
>1r9o_A Cytochrome P450 2C9; monooxygenase, drug metabolizing enzyme, oxidoreductas; HET: HEM FLP; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1og5_A* 1og2_A* 2nnj_A* 1pq2_A* 2nni_A* 2nnh_A* 2vn0_A* 1nr6_A* 1dt6_A* 1n6b_A* Length = 477 Back     alignment and structure
>3e6i_A CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, monooxygenase, acetaminophen, oxidoreductase, heme, endoplasmic reticulum, iron, membrane; HET: HEM; 2.20A {Homo sapiens} PDB: 3e4e_A* 3gph_A* 3koh_A* 3lc4_A* 3t3z_A* Length = 476 Back     alignment and structure
>2fdv_A Cytochrome P450 2A6; CYP2A6, monooxygenase, drug metabolizing enzyme, coumarin 7-hydroxylase, nicotine oxidase, oxidoreductase; HET: HEM D2G; 1.65A {Homo sapiens} PDB: 1z11_A* 1z10_A* 2fdu_A* 2fdw_A* 2fdy_A* 3t3r_A* 2pg5_A* 2pg7_A* 2pg6_A* 3t3q_A* 3ebs_A* 2p85_A* 3t3s_A* Length = 476 Back     alignment and structure
>1izo_A P450bsbeta, cytochrome P450 152A1; heme protein, protein-fatty acid complex, riken structural genomics/proteomics initiative, RSGI; HET: HEM PAM; 2.10A {Bacillus subtilis} SCOP: a.104.1.1 PDB: 2zqj_A* 2zqx_A* Length = 417 Back     alignment and structure
>2cib_A Cytochrome P450 51; heme, heme lipid synthesis, metal-binding, monooxygenase, NADP, oxidoreductase, protein-inhibitor complex; HET: HEM CM6; 1.50A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 2bz9_A* 1x8v_A* 2ci0_A* 2vku_A* 2w09_A* 2w0b_A* 2w0a_A* 1h5z_A* 1ea1_A* 1e9x_A* 1u13_A* Length = 455 Back     alignment and structure
>3s79_A Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD; 2.75A {Homo sapiens} PDB: 3eqm_A* 3s7s_A* Length = 503 Back     alignment and structure
>3awm_A Fatty acid alpha-hydroxylase; cytochrome P450, peroxygenase, oxidoreductase; HET: HEM PLM; 1.65A {Sphingomonas paucimobilis} PDB: 3awq_A* 3awp_A* Length = 415 Back     alignment and structure
>2ve3_A Putative cytochrome P450 120; oxidoreductase, monooxygenase, metal-binding, heme, iron; HET: HEM REA; 2.10A {Synechocystis SP} PDB: 2ve4_A* Length = 444 Back     alignment and structure
>3dbg_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP170A1, molecular mechanism, heme, iron, metal-binding, monooxygenase; HET: HEM; 2.60A {Streptomyces coelicolor A3} PDB: 3el3_A* Length = 467 Back     alignment and structure
>3gw9_A Sterol 14alpha-demethylase; CYP51, cytochrome P450, heme, oxidoreductase, monooxygenase, sterol biosynthesis, lipids, endoplasmic reticulum; HET: HEM VNI; 1.87A {Trypanosoma brucei} PDB: 3g1q_A* 3p99_A* 2wv2_A* 2x2n_A* 3khm_A* 3k1o_A* 3ksw_A* 2wx2_A* 2wuz_A* 3l4d_A* Length = 450 Back     alignment and structure
>2ij2_A Cytochrome P450 BM3; monoxygenase, heme binding protein, atomic resolution, oxidoreductase; HET: HEM; 1.20A {Bacillus megaterium} SCOP: a.104.1.1 PDB: 2hpd_A* 1fag_A* 1jpz_A* 1zo9_A* 1zo4_A* 1zoa_A* 3m4v_A* 3ekb_A* 3ben_A* 1fah_A* 2nnb_A* 3kx3_A* 3ekd_A* 3ekf_A* 1smi_A* 1smj_A* 3kx4_A* 2ij3_A* 2ij4_A* 3hf2_A* ... Length = 470 Back     alignment and structure
>3mdm_A Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, thioperamide, monooxygenase, metab enzyme, oxidoreductase, heme, cholesterol metabolism; HET: HEM FJZ; 1.60A {Homo sapiens} PDB: 2q9g_A* 2q9f_A* 3mdr_A* 3mdt_A* 3mdv_A* Length = 456 Back     alignment and structure
>3nxu_A Cytochrome P450 3A4; alpha beta protein, cytochrome P450 fold, hemoprotein, monoo cytochrome P450 reductase, endoplasmic reticulum; HET: HEM RIT; 2.00A {Homo sapiens} PDB: 1w0e_A* 1w0g_A* 2j0d_A* 2v0m_A* 1w0f_A* 1tqn_A* 3ua1_A* 3tjs_A* Length = 485 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query254
3swz_A 494 Steroid 17-alpha-hydroxylase/17,20 lyase; cytochro 99.97
3pm0_A 507 Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase 99.96
3e6i_A 476 CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, mono 99.96
2hi4_A 495 Cytochrome P450 1A2; CYP1A2, monooxygenase, drug m 99.96
3qz1_A 496 Steroid 21-hydroxylase; P450 monooxygenase, oxidor 99.96
3tbg_A 479 Cytochrome P450 2D6; monooxygenase, thioridazine, 99.95
3czh_A 481 Cytochrome P450 2R1; vitamin D, vitamin S 25-hydro 99.95
2fdv_A 476 Cytochrome P450 2A6; CYP2A6, monooxygenase, drug m 99.94
1po5_A 476 Cytochrome P450 2B4; oxidoreductase, membrane prot 99.94
3k9v_A 482 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitocho 99.94
3s79_A 503 Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD 99.94
1r9o_A 477 Cytochrome P450 2C9; monooxygenase, drug metaboliz 99.94
3nxu_A 485 Cytochrome P450 3A4; alpha beta protein, cytochrom 99.94
3gw9_A 450 Sterol 14alpha-demethylase; CYP51, cytochrome P450 99.93
3ld6_A 461 Lanosterol 14-alpha demethylase; cytochrome P450, 99.93
2ij2_A 470 Cytochrome P450 BM3; monoxygenase, heme binding pr 99.92
2cib_A 455 Cytochrome P450 51; heme, heme lipid synthesis, me 99.91
3i3k_A 461 Lanosterol 14-alpha demethylase; cytochrome P450, 99.9
3dbg_A 467 Putative cytochrome P450; cytochrome P450 oxidored 99.9
2ve3_A 444 Putative cytochrome P450 120; oxidoreductase, mono 99.9
3n9y_A 487 Cholesterol SIDE-chain cleavage enzyme; cytochrome 99.89
3v8d_A 491 Cholesterol 7-alpha-monooxygenase; cytochrome, oxi 99.84
3mdm_A 456 Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, th 99.83
2cd8_A 436 Cytochrome P450 monooxygenase; oxidoreductase, PIK 99.81
1izo_A 417 P450bsbeta, cytochrome P450 152A1; heme protein, p 99.81
3awm_A 415 Fatty acid alpha-hydroxylase; cytochrome P450, per 99.8
1n97_A 389 CYP175A1; electron transport; HET: SRT HEM; 1.80A 99.75
3dax_A 491 Cytochrome P450 7A1; cholesterol, cholesterol 7-al 99.75
3b6h_A 498 Prostacyclin synthase; enzyme-inhibitor complex, C 99.74
1jfb_A 404 Nitric-oxide reductase cytochrome P450 55A1; cytoc 99.73
1ued_A 406 P450 OXYC, P450 monooxygenase; cytochrome P450 van 99.72
2zbx_A 412 Cytochrome P450-SU1; beta prism, heme, iron, metal 99.71
1cpt_A 428 Cytochrome P450-TERP; oxidoreductase(oxygenase); H 99.69
3b98_A 475 Prostaglandin I2 synthase; prostacyclin synthase, 99.68
1s1f_A 406 Putative cytochrome P450; cytochrome P450 oxidored 99.67
2zwu_A 415 Camphor 5-monooxygenase; P450CAM, camphor-hydroxyl 99.67
2jjn_A 411 Cytochrome P450 113A1; oxidoreductase, iron, heme, 99.66
4fb2_A 398 P450CIN; heme, monooxygenase, cindoxin, oxidoreduc 99.65
3oo3_A 384 OXY protein; cytochrome P450, monooxygenase, PCD-t 99.65
3ejb_B 404 Biotin biosynthesis cytochrome P450-like enzyme; p 99.65
3dsk_A 495 Cytochrome P450 74A, chloroplast; P450 fold, fatty 99.64
3ivy_A 433 Cytochrome P450 CYP125; cholesterol, monooxygenase 99.63
2wm5_A 435 CYP124, putative cytochrome P450 124; metal-bindin 99.62
3aba_A 403 Cytochrome P450; oxidoreductase, heme, monooxygena 99.62
3tyw_A 417 Putative cytochrome P450; P450 monooxygenase, oxid 99.61
3tkt_A 450 Cytochrome P450; aromatic hydrocarbon binding of P 99.61
3lxh_A 421 Cytochrome P450; heme, iron, metal-binding, monoox 99.6
3a4g_A 411 Vitamin D hydroxylase; cytochrome P450, hemoprotei 99.6
3abb_A 408 CYP105D6, cytochrome P450 hydroxylase; oxidoreduct 99.59
2xkr_A 398 CYP142, putative cytochrome P450 142; oxidoreducta 99.59
1z8o_A 404 6-deoxyerythronolide B hydroxylase; heme, CYP, ery 99.59
2y5n_A 417 MYCG, P-450-like protein; oxidoreductase, mycinami 99.58
1q5d_A 419 P450 epoxidase; cytochrome P450, epothilone, oxydo 99.58
3nc3_A 441 Cytochrome P450 CYPX; cytochrome P450 oxidase, HAE 99.57
2z3t_A 425 Cytochrome P450; monoxygenase, oxydoreductase, hem 99.56
3r9b_A 418 Cytochrome P450 164A2; monooxygenase, oxidoreducta 99.55
2z36_A 413 MOXA, cytochrome P450 type compactin 3'',4''- hydr 99.55
3dan_A 473 Cytochrome P450 74A2; AOS heme cytochrome P450 str 99.54
3oft_A 396 Cytochrome P450, CYP101C1; oxidoreductase; HET: HE 99.52
3buj_A 397 CALO2; heme, iron, metal-binding, monooxygenase, o 99.52
1odo_A 408 Putative cytochrome P450 154A1; P450 monooxygenase 99.52
2dkk_A 411 Cytochrome P450; CYP158A1, INHI oxidoreductase; HE 99.5
2xbk_A 404 PIMD protein; epoxidation, oxidoreductase; HET: HE 99.5
1gwi_A 411 CYP154C1, cytochrome P450 154C1; oxidoreductase, m 99.49
2uuq_A 414 CYP130, cytochrome P450 130; iron, heme, monooxyge 99.49
3mgx_A 415 Putative P450 monooxygenase; cytochrome P450 oxida 99.45
1lfk_A 398 OXYB, P450 monooxygenase; oxidative phenol couplin 99.41
3rwl_A 426 Cytochrome P450 alkane hydroxylase 1 CYP153A7; P45 99.39
3b4x_A 367 367AA long hypothetical cytochrome P450; HEM prote 99.29
1n40_A 396 P450 MT2, cytochrome P450 121; heme binding, oxyge 99.28
2wiy_A 394 XPLA-heme, cytochrome P450-like protein XPLA; CYT- 99.27
3p3o_A 416 Cytochrome P450; monooxygenase, oxidoreductase; HE 99.27
2rfb_A 343 Cytochrome P450; heme, iron, metal-binding, monoox 99.18
1io7_A 368 Cytochrome P450 CYP119; thermophilic, cytochromo P 99.14
4dnj_A 412 Putative cytochrome P450; oxidoreductase; HET: HEM 98.57
4dxy_A 417 Cytochrome P450, CYP101D2; cytochrome P450 mutant, 98.52
2yjn_B 381 Erycii, DTDP-4-keto-6-deoxy-hexose 3,4-isomerase; 95.34
1s79_A103 Lupus LA protein; RRM, alpha/beta, RNA binding pro 81.43
>3swz_A Steroid 17-alpha-hydroxylase/17,20 lyase; cytochrome P450, CYP17A1, P450C17, P450 17A1, monooxyg 17A-hydroxylase, heme protein; HET: HEM TOK; 2.40A {Homo sapiens} PDB: 3ruk_A* Back     alignment and structure
Probab=99.97  E-value=2.8e-30  Score=212.40  Aligned_cols=213  Identities=18%  Similarity=0.321  Sum_probs=162.0

Q ss_pred             CCCCCCCCCCCCccccccccccCCCCCCchHHHHHHHhhCCeEEEEeCCcCeEEeccHHHHHHHHHHcCcccCCCCCcch
Q 037570           29 IELNLPPSPPRFPITGNLHQLLGTATLPHGSLQALSKKYGPLMYMHLGYSPTLVVSSAEIAREIIKNHDIVFSNRPKTTA  108 (254)
Q Consensus        29 ~~~~~~pgp~~~p~~G~~~~~~~~~~~~~~~~~~~~~~yG~i~~~~~~~~~~vvv~dp~~ik~il~~~~~~~~~~~~~~~  108 (254)
                      +..+.||||+++|++||++.+ ...+.++..+.+|+++||++|++++|+.++|+|+||+++++|+.+++..|++++....
T Consensus         5 ~~~~~PPgP~~lPliGnl~~l-~~~~~~~~~~~~~~~kYG~i~~~~~g~~~~vvv~~p~~~k~il~~~~~~f~~rp~~~~   83 (494)
T 3swz_A            5 TGAKYPKSLLSLPLVGSLPFL-PRHGHMHNNFFKLQKKYGPIYSVRMGTKTTVIVGHHQLAKEVLIKKGKDFSGRPQMAT   83 (494)
T ss_dssp             -------CCBCCCEEEEESSC-TTSSCHHHHHHHTHHHHCSEEEEEETTEEEEEECSHHHHHHHHTTTTTTTBBCCCCHH
T ss_pred             CCCCCCCCCCCCCeEcchHHh-CCCCchhHHHHHHHHHcCCEEEEEeCCCCEEEECCHHHHHHHHHhCcHhhCCCCCcHH
Confidence            346689999999999999988 3113567889999999999999999999999999999999999999889998887665


Q ss_pred             hhhhccCCceeeeCCCChHHHHHHHHHHHHHHH-----------------------------------HHHHHHHHHHHH
Q 037570          109 ANVFLYGCQDIGFSPYGEYWRQARKTCVLGLLN-----------------------------------VILTVSNNIVSR  153 (254)
Q Consensus       109 ~~~~~~~~~~~~~~~~g~~w~~~R~~l~~~f~~-----------------------------------~~~~~~~dvi~~  153 (254)
                      .......+.|++++++|+.|+++||++.++|+.                                   .+..+++|+|+.
T Consensus        84 ~~~~~~~~~gl~~~~~g~~wr~~Rr~~~~~f~~~~~~~~~~~~~i~~~~~~l~~~l~~~~~~~vd~~~~~~~~t~dvi~~  163 (494)
T 3swz_A           84 LDIASNNRKGIAFADSGAHWQLHRRLAMATFALFKDGDQKLEKIICQEISTLCDMLATHNGQSIDISFPVFVAVTNVISL  163 (494)
T ss_dssp             HHHHTTTTCSSSSSCSSHHHHHHHHHHHHHTTTTSSSTTCHHHHHHHHHHHHHHHHHHTTTEEECCHHHHHHHHHHHHHH
T ss_pred             HHHhccCCCCeEeCCCCHHHHHHHHHHHHHHHHhcchHHHHHHHHHHHHHHHHHHHHHcCCCcccHHHHHHHHHHHHHHH
Confidence            555544567888887799999999999999852                                   678899999999


Q ss_pred             HHhcccccccchhhhhHHHHHHHHHHHhcccCCccccccccchhhhhccHHHHHHHHHHHHHHHHHHHHHHHHhcCCCCC
Q 037570          154 SVLGRRAEEETAGKCNKFGELSRRILVQFVSFSFGDMLPYLGWLDVVTGLIGRLTASSREVDVLFDQVIEKHRISGSDDD  233 (254)
Q Consensus       154 ~~fG~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~p~l~~l~~~~~~~~~~~~~~~~~~~~~~~~i~~~~~~~~~~~  233 (254)
                      ++||.+++.. ++....+.+..+.+........+.+++|++.+++.  ...++.++..+.+.++++++++++++..+.  
T Consensus       164 ~~fG~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~P~l~~~p~--~~~~~~~~~~~~~~~~~~~~i~~~~~~~~~--  238 (494)
T 3swz_A          164 ICFNTSYKNG-DPELNVIQNYNEGIIDNLSKDSLVDLVPWLKIFPN--KTLEKLKSHVKIRNDLLNKILENYKEKFRS--  238 (494)
T ss_dssp             HHHSCCCCTT-CTHHHHHHHHHHHHHHHHCSSSSCCSSCGGGTSCC--SHHHHHHHHHHHHHHHHHHHHHHHTTTCCT--
T ss_pred             HHcCCcCCCC-CHHHHHHHHHHHHHHHhcccchHHHHHHHHHHcCc--HHHHHHHHHHHHHHHHHHHHHHHHHHhhcc--
Confidence            9999998754 33333334444444444444455677888877652  345667778888899999999988776543  


Q ss_pred             CCCCccHHHHhhccc
Q 037570          234 HPNRKDLVHVYSNFK  248 (254)
Q Consensus       234 ~~~~~d~l~~ll~~~  248 (254)
                       +...|+++.|+++.
T Consensus       239 -~~~~d~l~~ll~~~  252 (494)
T 3swz_A          239 -DSITNMLDTLMQAK  252 (494)
T ss_dssp             -TCCCSHHHHHHHHH
T ss_pred             -cchhHHHHHHHHHH
Confidence             45679999999753
>3pm0_A Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase, alpha-naphthoflavone, 17BETA-estradiol, oxidoreductase; HET: HEM BHF; 2.70A {Homo sapiens} Back     alignment and structure
>3e6i_A CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, monooxygenase, acetaminophen, oxidoreductase, heme, endoplasmic reticulum, iron, membrane; HET: HEM; 2.20A {Homo sapiens} PDB: 3e4e_A* 3gph_A* 3koh_A* 3lc4_A* 3t3z_A* Back     alignment and structure
>2hi4_A Cytochrome P450 1A2; CYP1A2, monooxygenase, drug metabolizing enzyme, alpha-naphthoflavone, benzo(H)flavone, 7,8- benzoflavone, oxidoreductase; HET: HEM BHF; 1.95A {Homo sapiens} Back     alignment and structure
>3qz1_A Steroid 21-hydroxylase; P450 monooxygenase, oxidoreductase; HET: HEM 3QZ; 3.00A {Bos taurus} Back     alignment and structure
>3tbg_A Cytochrome P450 2D6; monooxygenase, thioridazine, oxidoreductase; HET: RTZ HEM; 2.10A {Homo sapiens} PDB: 3qm4_A* 2f9q_A* Back     alignment and structure
>3czh_A Cytochrome P450 2R1; vitamin D, vitamin S 25-hydroxylase, drug metabolism, structural genomics, structural genomics consortium, SGC; HET: BCD HEM D2V; 2.30A {Homo sapiens} SCOP: a.104.1.1 PDB: 2ojd_A* 3c6g_A* 3dl9_A* Back     alignment and structure
>2fdv_A Cytochrome P450 2A6; CYP2A6, monooxygenase, drug metabolizing enzyme, coumarin 7-hydroxylase, nicotine oxidase, oxidoreductase; HET: HEM D2G; 1.65A {Homo sapiens} PDB: 1z11_A* 1z10_A* 2fdu_A* 2fdw_A* 2fdy_A* 3t3r_A* 2pg5_A* 2pg7_A* 2pg6_A* 3t3q_A* 3ebs_A* 2p85_A* 3t3s_A* Back     alignment and structure
>1po5_A Cytochrome P450 2B4; oxidoreductase, membrane protein, CYP 2B4, CYP LM2, cytochro monooxygenase; HET: HEM; 1.60A {Oryctolagus cuniculus} SCOP: a.104.1.1 PDB: 3mvr_A* 2bdm_A* 3g5n_A* 3g93_A* 3kw4_A* 3me6_A* 1suo_A* 3r1a_A* 3r1b_A* 2q6n_A* 3tk3_A* 3ibd_A* 3qoa_A* 3qu8_A* Back     alignment and structure
>3k9v_A 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial; mitochondrial cytochrome P450, monotopic membrane protein, monooxygenase; HET: HEM CPS; 2.50A {Rattus norvegicus} PDB: 3k9y_A* Back     alignment and structure
>3s79_A Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD; 2.75A {Homo sapiens} PDB: 3eqm_A* 3s7s_A* 4gl5_A* 4gl7_A* Back     alignment and structure
>1r9o_A Cytochrome P450 2C9; monooxygenase, drug metabolizing enzyme, oxidoreductas; HET: HEM FLP; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1og5_A* 1og2_A* 2nnj_A* 1pq2_A* 2nni_A* 2nnh_A* 2vn0_A* 1nr6_A* 1dt6_A* 1n6b_A* Back     alignment and structure
>3nxu_A Cytochrome P450 3A4; alpha beta protein, cytochrome P450 fold, hemoprotein, monoo cytochrome P450 reductase, endoplasmic reticulum; HET: HEM RIT; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1w0e_A* 1w0g_A* 2j0d_A* 2v0m_A* 1w0f_A* 1tqn_A* 3ua1_A* 3tjs_A* Back     alignment and structure
>3gw9_A Sterol 14alpha-demethylase; CYP51, cytochrome P450, heme, oxidoreductase, monooxygenase, sterol biosynthesis, lipids, endoplasmic reticulum; HET: HEM VNI; 1.87A {Trypanosoma brucei} PDB: 3tik_A* 3g1q_A* 3p99_A* 2wv2_A* 2x2n_A* 3khm_A* 3k1o_A* 3ksw_A* 2wx2_A* 2wuz_A* 3l4d_A* Back     alignment and structure
>3ld6_A Lanosterol 14-alpha demethylase; cytochrome P450, ketoconazole, S genomics, structural genomics consortium, SGC; HET: HEM KKK BCD; 2.80A {Homo sapiens} PDB: 3juv_A* 3jus_A* Back     alignment and structure
>2ij2_A Cytochrome P450 BM3; monoxygenase, heme binding protein, atomic resolution, oxidoreductase; HET: HEM; 1.20A {Bacillus megaterium} SCOP: a.104.1.1 PDB: 2hpd_A* 1fag_A* 1jpz_A* 1zo9_A* 1zo4_A* 1zoa_A* 3m4v_A* 3ekb_A* 3ben_A* 1fah_A* 2nnb_A* 3kx3_A* 3ekd_A* 3ekf_A* 1smi_A* 1smj_A* 3kx4_A* 2ij3_A* 2ij4_A* 3hf2_A* ... Back     alignment and structure
>2cib_A Cytochrome P450 51; heme, heme lipid synthesis, metal-binding, monooxygenase, NADP, oxidoreductase, protein-inhibitor complex; HET: HEM CM6; 1.50A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 2bz9_A* 1x8v_A* 2ci0_A* 2vku_A* 2w09_A* 2w0b_A* 2w0a_A* 1h5z_A* 1ea1_A* 1e9x_A* 1u13_A* Back     alignment and structure
>3dbg_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP170A1, molecular mechanism, heme, iron, metal-binding, monooxygenase; HET: HEM; 2.60A {Streptomyces coelicolor A3} PDB: 3el3_A* Back     alignment and structure
>2ve3_A Putative cytochrome P450 120; oxidoreductase, monooxygenase, metal-binding, heme, iron; HET: HEM REA; 2.10A {Synechocystis SP} PDB: 2ve4_A* Back     alignment and structure
>3n9y_A Cholesterol SIDE-chain cleavage enzyme; cytochrome P450, cholesterol SIDE chain cleavage, structural genomics, structural genomics consortium, SGC; HET: HEM CLR; 2.10A {Homo sapiens} PDB: 3n9z_A* 3na1_A* 3na0_A* 3mzs_A* Back     alignment and structure
>3v8d_A Cholesterol 7-alpha-monooxygenase; cytochrome, oxidoreductase; HET: HEM 0GV; 1.90A {Homo sapiens} PDB: 3sn5_A* 3dax_A* Back     alignment and structure
>3mdm_A Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, thioperamide, monooxygenase, metab enzyme, oxidoreductase, heme, cholesterol metabolism; HET: HEM FJZ; 1.60A {Homo sapiens} PDB: 2q9g_A* 2q9f_A* 3mdr_A* 3mdt_A* 3mdv_A* 4enh_A* 4fia_A* Back     alignment and structure
>2cd8_A Cytochrome P450 monooxygenase; oxidoreductase, PIKC, macrolide monooxygenase, antibiotic biosynthesis, heme, iron, metal-binding; HET: HEM PXI; 1.7A {Streptomyces venezuelae} PDB: 2c6h_A* 2bvj_A* 2ca0_A* 2c7x_A* 2vzm_A* 2vz7_A* 2vsj_A* 2wi9_A* 2whw_A* Back     alignment and structure
>1izo_A P450bsbeta, cytochrome P450 152A1; heme protein, protein-fatty acid complex, riken structural genomics/proteomics initiative, RSGI; HET: HEM PAM; 2.10A {Bacillus subtilis} SCOP: a.104.1.1 PDB: 2zqj_A* 2zqx_A* Back     alignment and structure
>3awm_A Fatty acid alpha-hydroxylase; cytochrome P450, peroxygenase, oxidoreductase; HET: HEM PLM; 1.65A {Sphingomonas paucimobilis} PDB: 3awq_A* 3awp_A* Back     alignment and structure
>1n97_A CYP175A1; electron transport; HET: SRT HEM; 1.80A {Thermus thermophilus} SCOP: a.104.1.1 PDB: 1wiy_A* Back     alignment and structure
>3dax_A Cytochrome P450 7A1; cholesterol, cholesterol 7-alpha hydroxylase, structural genomics, structural genomics consortium, SGC, cholesterol metabolism; HET: HEM; 2.15A {Homo sapiens} PDB: 3sn5_A* Back     alignment and structure
>3b6h_A Prostacyclin synthase; enzyme-inhibitor complex, CYP8A1, cytochrome P450, endoplasmic reticulum, fatty acid biosynthesis, heme, iron, isomerase; HET: BOG MXD HEM; 1.62A {Homo sapiens} PDB: 2iag_A* Back     alignment and structure
>1jfb_A Nitric-oxide reductase cytochrome P450 55A1; cytochrome P450NOR, atomic resolutio structural genomics/proteomics initiative, RSGI; HET: HEM; 1.00A {Fusarium oxysporum} SCOP: a.104.1.1 PDB: 1jfc_A* 1gej_A* 1ged_A* 1ehe_A* 1gei_A* 1rom_A* 2rom_A* 1ehf_A* 1cl6_A* 1ehg_A* 1cmj_A* 1f25_A* 1f24_A* 1xqd_A* 1f26_A* 1cmn_A* 1ulw_A* Back     alignment and structure
>1ued_A P450 OXYC, P450 monooxygenase; cytochrome P450 vancomycin biosynthesis, oxidoreductase; HET: HEM PG4; 1.90A {Amycolatopsis orientalis} SCOP: a.104.1.1 Back     alignment and structure
>2zbx_A Cytochrome P450-SU1; beta prism, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.50A {Streptomyces griseolus} PDB: 2zby_A* 2zbz_A* 3cv8_A* 3cv9_A* Back     alignment and structure
>1cpt_A Cytochrome P450-TERP; oxidoreductase(oxygenase); HET: HEM; 2.30A {Pseudomonas SP} SCOP: a.104.1.1 Back     alignment and structure
>3b98_A Prostaglandin I2 synthase; prostacyclin synthase, cytochrome P450 8A1, CYP8A1, isomerase; HET: HEM; 2.08A {Danio rerio} PDB: 3b99_A* Back     alignment and structure
>1s1f_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP158A2, anti biosynthesis, oxidoreductase; HET: HEM PIM; 1.50A {Streptomyces coelicolor} SCOP: a.104.1.1 PDB: 1se6_A* 2d0e_A* 1t93_A* 2d09_A* 3tzo_A* Back     alignment and structure
>2zwu_A Camphor 5-monooxygenase; P450CAM, camphor-hydroxylase, heme, iron, metal-binding, oxidoreductase, substrate-soaking, cytoplasm; HET: HEM CAM; 1.30A {Pseudomonas putida} PDB: 1gem_A* 1iwi_A* 2l8m_A* 2z97_A* 1gek_A* 2zax_A* 2zaw_A* 2zwt_A* 1rf9_A* 1lwl_A* 1iwk_A* 1iwj_A* 2zui_A* 2fe6_A* 1geb_A* 1yrc_A* 1noo_A* 1cp4_A* 1pha_A* 1phc_A* ... Back     alignment and structure
>2jjn_A Cytochrome P450 113A1; oxidoreductase, iron, heme, monooxygenase, metal-binding, AN biosynthesis, TIE-ROD mechanism of action; HET: HEM; 1.59A {Saccharopolyspora erythraea} PDB: 2jjo_A* 2jjp_A* 2xfh_A* 2wio_A* 2vrv_A* Back     alignment and structure
>4fb2_A P450CIN; heme, monooxygenase, cindoxin, oxidoreductase; HET: HEM EDO; 1.37A {Citrobacter braakii} PDB: 4fmx_A* 4fyz_A* 1t2b_A* 3bdz_A* 3be0_A* Back     alignment and structure
>3oo3_A OXY protein; cytochrome P450, monooxygenase, PCD-teicoplanin aglycone, oxidoreductase; HET: HEM; 2.20A {Actinoplanes teichomyceticus} SCOP: a.104.1.0 PDB: 3o1a_A* Back     alignment and structure
>3ejb_B Biotin biosynthesis cytochrome P450-like enzyme; protein-protein complex, cytochrome P450 fold, carrier protein, 4-helix bundle, cytoplasm; HET: ZMP HTG HEM; 2.00A {Bacillus subtilis} SCOP: a.104.1.0 PDB: 3ejd_B* 3eje_B* Back     alignment and structure
>3dsk_A Cytochrome P450 74A, chloroplast; P450 fold, fatty acid biosynthesis, heme, iron, synthesis, lyase, metal-binding, oxylipin biosynthesis; HET: HEM T25; 1.55A {Arabidopsis thaliana} PDB: 2rcm_A* 3dsj_A* 3dsi_A* 2rcl_A* 2rch_A* 3cli_A* Back     alignment and structure
>3ivy_A Cytochrome P450 CYP125; cholesterol, monooxygenase, H iron, metal-binding, oxidoreductase; HET: HEM; 1.35A {Mycobacterium tuberculosis} PDB: 3iw0_A* 3iw1_A* 3iw2_A* 2x5w_A* 2x5l_A* 2xc3_A* 2xn8_A* Back     alignment and structure
>2wm5_A CYP124, putative cytochrome P450 124; metal-binding, oxidoreductase, omega-hydroxylation, iron, heme, fatty acid, monooxygenase; HET: HEM; 1.50A {Mycobacterium tuberculosis} PDB: 2wm4_A* Back     alignment and structure
>3aba_A Cytochrome P450; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding, oxidoreductase-antibiotic complex; HET: HEM FLI; 1.80A {Streptomyces avermitilis} PDB: 3e5j_A* 3e5k_A* 3e5l_A* Back     alignment and structure
>3tyw_A Putative cytochrome P450; P450 monooxygenase, oxidoreductase; HET: HEM; 2.90A {Streptomyces coelicolor} PDB: 4fxb_A* Back     alignment and structure
>3tkt_A Cytochrome P450; aromatic hydrocarbon binding of P450 E oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} Back     alignment and structure
>3lxh_A Cytochrome P450; heme, iron, metal-binding, monooxygena oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} SCOP: a.104.1.0 PDB: 3lxi_A* Back     alignment and structure
>3a4g_A Vitamin D hydroxylase; cytochrome P450, hemoprotein, monoox oxidoreductase; HET: HEM; 1.75A {Pseudonocardia autotrophica} PDB: 3a4h_A* 3a51_A* 3a4z_A* 3a50_A* Back     alignment and structure
>3abb_A CYP105D6, cytochrome P450 hydroxylase; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding; HET: HEM; 2.30A {Streptomyces avermitilis} Back     alignment and structure
>2xkr_A CYP142, putative cytochrome P450 142; oxidoreductase; HET: HEM; 1.60A {Mycobacterium tuberculosis} Back     alignment and structure
>1z8o_A 6-deoxyerythronolide B hydroxylase; heme, CYP, erythromycin, oxidoreductase; HET: HEM DEB; 1.70A {Saccharopolyspora erythraea} SCOP: a.104.1.1 PDB: 1z8p_A* 1z8q_A* 1jio_A* 1jip_A* 1eup_A* 1egy_A* 1jin_A* 1oxa_A* Back     alignment and structure
>2y5n_A MYCG, P-450-like protein; oxidoreductase, mycinamicin biosynthesis; HET: HEM MYV; 1.62A {Micromonospora griseorubida} PDB: 2y46_A* 2y5z_A* 2y98_A* 2yca_A* 2ygx_A* Back     alignment and structure
>1q5d_A P450 epoxidase; cytochrome P450, epothilone, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM EPB; 1.93A {Sorangium cellulosum} SCOP: a.104.1.1 PDB: 1q5e_A* 1pkf_A* Back     alignment and structure
>3nc3_A Cytochrome P450 CYPX; cytochrome P450 oxidase, HAEM protein, oxidoreductase; HET: HEM; 2.66A {Bacillus subtilis} PDB: 3nc5_A* 3nc6_A* 3nc7_A* Back     alignment and structure
>2z3t_A Cytochrome P450; monoxygenase, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM; 1.90A {Streptomyces SP} PDB: 2z3u_A* 3a1l_A* Back     alignment and structure
>3r9b_A Cytochrome P450 164A2; monooxygenase, oxidoreductase; HET: HEM D12; 1.89A {Mycobacterium smegmatis} PDB: 3r9c_A* Back     alignment and structure
>2z36_A MOXA, cytochrome P450 type compactin 3'',4''- hydroxylase; CYP105, oxidoreductase; HET: HEM MES; 2.80A {Nonomuraea recticatena} Back     alignment and structure
>3dan_A Cytochrome P450 74A2; AOS heme cytochrome P450 structure, fatty acid biosynthesis, heme, iron, lipid synthesis, lyase, metal-binding; HET: HEM; 1.80A {Parthenium argentatum} PDB: 3dam_A* 3dbm_A* Back     alignment and structure
>3oft_A Cytochrome P450, CYP101C1; oxidoreductase; HET: HEM; 1.90A {Novosphingobium aromaticivorans} PDB: 3ofu_A* Back     alignment and structure
>3buj_A CALO2; heme, iron, metal-binding, monooxygenase, oxidoreducta binding protein; HET: HEM; 2.47A {Micromonospora echinospora} Back     alignment and structure
>1odo_A Putative cytochrome P450 154A1; P450 monooxygenase, oxidoreductase; HET: HEM PIM; 1.85A {Streptomyces coelicolor} SCOP: a.104.1.1 Back     alignment and structure
>2dkk_A Cytochrome P450; CYP158A1, INHI oxidoreductase; HET: HEM; 1.97A {Streptomyces coelicolor} PDB: 2nz5_A* 2nza_A* Back     alignment and structure
>2xbk_A PIMD protein; epoxidation, oxidoreductase; HET: HEM XBK; 1.95A {Streptomyces natalensis} PDB: 2x9p_A* Back     alignment and structure
>1gwi_A CYP154C1, cytochrome P450 154C1; oxidoreductase, macrolide antibiotics, 12- and 14- carbon macrolactone monooxygenase, heme; HET: HEM; 1.92A {Streptomyces coelicolor} SCOP: a.104.1.1 Back     alignment and structure
>2uuq_A CYP130, cytochrome P450 130; iron, heme, monooxygenase, metal-binding, oxidoreductase, hypothetical protein; HET: HEM; 1.46A {Mycobacterium tuberculosis} PDB: 2uvn_A* 2whf_A* 2wh8_A* 2wgy_A* Back     alignment and structure
>3mgx_A Putative P450 monooxygenase; cytochrome P450 oxidase, HAEM protein, vancomycin biosynthes carrier protein, oxidoreductase; HET: HEM; 2.10A {Amycolatopsis balhimycina} Back     alignment and structure
>1lfk_A OXYB, P450 monooxygenase; oxidative phenol coupling reaction P450 vancomycin, oxidoreductase; HET: HEM; 1.70A {Amycolatopsis orientalis} SCOP: a.104.1.1 PDB: 1lg9_A* 1lgf_A* Back     alignment and structure
>3rwl_A Cytochrome P450 alkane hydroxylase 1 CYP153A7; P450 monooxygenase, oxidoreductase; HET: HEM; 2.00A {Sphingopyxis macrogoltabida} Back     alignment and structure
>3b4x_A 367AA long hypothetical cytochrome P450; HEM protein, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.94A {Sulfolobus tokodaii} PDB: 1ue8_A* Back     alignment and structure
>1n40_A P450 MT2, cytochrome P450 121; heme binding, oxygen binding, P450 fold, structural genomics, PSI, protein structure initiative; HET: HEM; 1.06A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 1n4g_A* 2ij5_A* 2ij7_A* 3g5f_A* 3g5h_A* 3cy0_A* 3cy1_A* 3cxv_A* 3cxx_A* 3cxz_A* 3cxy_A* Back     alignment and structure
>2wiy_A XPLA-heme, cytochrome P450-like protein XPLA; CYT-P450, RDX, bioremediation, electron transport; HET: HEM; 1.49A {Rhodococcus} PDB: 2wiv_A* Back     alignment and structure
>3p3o_A Cytochrome P450; monooxygenase, oxidoreductase; HET: HEM; 1.54A {Streptomyces thioluteus} PDB: 3p3x_A* 3p3z_A* 3p3l_A* Back     alignment and structure
>2rfb_A Cytochrome P450; heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 2.50A {Picrophilus torridus} PDB: 2rfc_A* Back     alignment and structure
>1io7_A Cytochrome P450 CYP119; thermophilic, cytochromo P450, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: HEM; 1.50A {Sulfolobus solfataricus} SCOP: a.104.1.1 PDB: 1f4u_A* 1f4t_A* 1io9_A* 1io8_A* Back     alignment and structure
>4dnj_A Putative cytochrome P450; oxidoreductase; HET: HEM ANN; 1.80A {Rhodopseudomonas palustris} PDB: 2fr7_A* 4do1_A* 4dnz_A* Back     alignment and structure
>4dxy_A Cytochrome P450, CYP101D2; cytochrome P450 mutant, HAEM-dependent, mono-oxygenases, oxidoreductase; HET: HEM; 2.00A {Novosphingobium aromaticivorans} PDB: 3nv6_A* 3nv5_A* Back     alignment and structure
>2yjn_B Erycii, DTDP-4-keto-6-deoxy-hexose 3,4-isomerase; transferase, cytochrome P450; 3.09A {Saccharopolyspora erythraea} Back     alignment and structure
>1s79_A Lupus LA protein; RRM, alpha/beta, RNA binding protein, translation; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 254
d1po5a_ 465 a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabb 4e-29
d3czha1 463 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2 4e-28
d1r9oa_ 467 a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Huma 2e-27
d2ciba1 445 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-stero 3e-22
d2ij2a1 453 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus 7e-22
d1tqna_ 472 a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Huma 3e-19
d1n97a_ 385 a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [Tax 1e-14
d1izoa_ 411 a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Ba 8e-13
d1odoa_ 401 a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyce 9e-12
d1ueda_ 403 a.104.1.1 (A:) p450 monoxygenase OxyC {Amycolatops 5e-05
d1gwia_ 403 a.104.1.1 (A:) Cyp154c1 monooxygenase {Streptomyce 0.001
d1z8oa1 402 a.104.1.1 (A:3-404) Cytochrome P450-ERYF {Saccharo 0.003
d1re9a_ 404 a.104.1.1 (A:) Cytochrome P450-CAM {Pseudomonas pu 0.004
>d1po5a_ a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 465 Back     information, alignment and structure

class: All alpha proteins
fold: Cytochrome P450
superfamily: Cytochrome P450
family: Cytochrome P450
domain: Mammalian cytochrome p450 2b4
species: Rabbit (Oryctolagus cuniculus) [TaxId: 9986]

 Score =  112 bits (279), Expect = 4e-29
 Identities = 49/245 (20%), Positives = 90/245 (36%), Gaps = 40/245 (16%)

Query: 33  LPPSPPRFPITGNLHQLLGTATLPHGSLQALSKKYGPLMYMHLGYSPTLVVSSAEIAREI 92
           LPP P   P+ GNL Q+         S   L +KYG +  ++LG  P +V+   +  RE 
Sbjct: 3   LPPGPSPLPVLGNLLQMDRKG--LLRSFLRLREKYGDVFTVYLGSRPVVVLCGTDAIREA 60

Query: 93  IKNHDIVFSNRPKTTAANVFLYGCQDIGFSPYGEYWRQARKTCVLGLLN----------- 141
           + +    FS R K    +    G         GE WR  R+  +  + +           
Sbjct: 61  LVDQAEAFSGRGKIAVVDPIFQGYGV--IFANGERWRALRRFSLATMRDFGMGKRSVEER 118

Query: 142 ------------------------VILTVSNNIVSRSVLGRRAEEETAGKCNKFGELSRR 177
                                   +  ++++NI+   V G+R + +      +  +L  +
Sbjct: 119 IQEEARCLVEELRKSKGALLDNTLLFHSITSNIICSIVFGKRFDYKDP-VFLRLLDLFFQ 177

Query: 178 ILVQFVSFSFGDMLPYLGWLDVVTGLIGRLTASSREVDVLFDQVIEKHRISGSDDDHPNR 237
                 SFS      + G+L    G   ++  + +E++    Q +EKHR +    +  + 
Sbjct: 178 SFSLISSFSSQVFELFSGFLKHFPGTHRQIYRNLQEINTFIGQSVEKHRATLDPSNPRDF 237

Query: 238 KDLVH 242
            D+  
Sbjct: 238 IDVYL 242
>d3czha1 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapiens) [TaxId: 9606]} Length = 463 Back     information, alignment and structure
>d1r9oa_ a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Human (Homo sapiens) [TaxId: 9606]} Length = 467 Back     information, alignment and structure
>d2ciba1 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-sterol demethylase (cyp51) {Mycobacterium tuberculosis [TaxId: 1773]} Length = 445 Back     information, alignment and structure
>d2ij2a1 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 1404]} Length = 453 Back     information, alignment and structure
>d1tqna_ a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Human (Homo sapiens) [TaxId: 9606]} Length = 472 Back     information, alignment and structure
>d1n97a_ a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [TaxId: 274]} Length = 385 Back     information, alignment and structure
>d1izoa_ a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis [TaxId: 1423]} Length = 411 Back     information, alignment and structure
>d1odoa_ a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Length = 401 Back     information, alignment and structure
>d1ueda_ a.104.1.1 (A:) p450 monoxygenase OxyC {Amycolatopsis orientalis [TaxId: 31958]} Length = 403 Back     information, alignment and structure
>d1gwia_ a.104.1.1 (A:) Cyp154c1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Length = 403 Back     information, alignment and structure
>d1z8oa1 a.104.1.1 (A:3-404) Cytochrome P450-ERYF {Saccharopolyspora erythraea [TaxId: 1836]} Length = 402 Back     information, alignment and structure
>d1re9a_ a.104.1.1 (A:) Cytochrome P450-CAM {Pseudomonas putida [TaxId: 303]} Length = 404 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query254
d2ij2a1 453 Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 99.95
d1r9oa_ 467 Mammalian cytochrome p450 2c9 {Human (Homo sapiens 99.94
d1po5a_ 465 Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus 99.93
d2ciba1 445 Cytochrome p450 14 alpha-sterol demethylase (cyp51 99.93
d3czha1 463 Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapie 99.92
d1tqna_ 472 Mammalian cytochrome P450 3a4 {Human (Homo sapiens 99.92
d1izoa_ 411 Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis 99.76
d1n97a_ 385 Cyp175a1 {Thermus thermophilus [TaxId: 274]} 99.64
d1z8oa1 402 Cytochrome P450-ERYF {Saccharopolyspora erythraea 99.22
d1odoa_ 401 Cyp154a1 monooxygenase {Streptomyces coelicolor [T 99.22
d1gwia_ 403 Cyp154c1 monooxygenase {Streptomyces coelicolor [T 99.13
d1ueda_ 403 p450 monoxygenase OxyC {Amycolatopsis orientalis [ 99.12
d1q5da_ 401 Cytochrome P450epok {Sorangium cellulosum [TaxId: 99.08
d1jfba_ 399 Cytochrome P450-NOR, nitric reductase {Fungus (Fus 99.07
d1re9a_ 404 Cytochrome P450-CAM {Pseudomonas putida [TaxId: 30 98.83
d1s1fa_ 399 Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]} 98.78
d1cpta_ 428 Cytochrome P450-TERP {Pseudomonas sp. [TaxId: 306] 98.68
d1lfka_ 394 p450 monoxygenase OxyB {Amycolatopsis orientalis [ 98.34
d1n40a_ 395 Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tub 98.06
d1io7a_ 366 Cyp119 {Archaeon Sulfolobus solfataricus [TaxId: 2 97.47
d1ue8a_ 367 Cyp119 {Archaeon Sulfolobus tokodaii [TaxId: 11195 97.19
d2f9da1114 Pre-mRNA branch site protein p14 {Human (Homo sapi 82.94
>d2ij2a1 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
class: All alpha proteins
fold: Cytochrome P450
superfamily: Cytochrome P450
family: Cytochrome P450
domain: Cytochrome P450 bm-3
species: Bacillus megaterium [TaxId: 1404]

Probab=99.95  E-value=1.3e-27  Score=192.64  Aligned_cols=205  Identities=15%  Similarity=0.117  Sum_probs=146.8

Q ss_pred             CCCCCCCCCccccccccccCCCCCCchHHHHHHHhhCCeEEEEeCCcCeEEeccHHHHHHHHHHcCcccCCCCCcchhhh
Q 037570           32 NLPPSPPRFPITGNLHQLLGTATLPHGSLQALSKKYGPLMYMHLGYSPTLVVSSAEIAREIIKNHDIVFSNRPKTTAANV  111 (254)
Q Consensus        32 ~~~pgp~~~p~~G~~~~~~~~~~~~~~~~~~~~~~yG~i~~~~~~~~~~vvv~dp~~ik~il~~~~~~~~~~~~~~~~~~  111 (254)
                      +.+|||+++|++||++.+..  .+++.++.+|+++|||||++++++.++|+++||+++++++.++...+..+........
T Consensus         1 r~iPGP~~~p~lG~l~~l~~--~~~~~~~~~~~~kyG~if~~~~~~~~~vvl~~~~~i~~v~~~~~~~~~~~~~~~~~~~   78 (453)
T d2ij2a1           1 KEMPQPKTFGELKNLPLLNT--DKPVQALMKIADELGEIFKFEAPGRVTRYLSSQRLIKEACDESRFDKNLSQALKFVRD   78 (453)
T ss_dssp             CCCCCCCCCGGGTTGGGGCS--SCHHHHHHHHHHHHCSEEEEEETTEEEEEECCHHHHHHHTCTTTEEECCCHHHHHHHH
T ss_pred             CCCccCCCcchhhCHHHhCC--CCHHHHHHHHHHHhCCEEEEEeCCceEEEECCHHHHHHHHhcCCcccccccHhHHHHH
Confidence            35899999999999998844  7789999999999999999999999999999999999999766555544333223333


Q ss_pred             hccCCceeeeC-CCChHHHHHHHHHHHHHHH----------------------------------HHHHHHHHHHHHHHh
Q 037570          112 FLYGCQDIGFS-PYGEYWRQARKTCVLGLLN----------------------------------VILTVSNNIVSRSVL  156 (254)
Q Consensus       112 ~~~~~~~~~~~-~~g~~w~~~R~~l~~~f~~----------------------------------~~~~~~~dvi~~~~f  156 (254)
                      +.  |+|++++ .+|+.|+++|+++.++|+.                                  ++.++++|++++++|
T Consensus        79 ~~--g~~~~~~~~~g~~wk~~Rk~l~~~fs~~~l~~~~~~i~~~~~~li~~l~~~~~~~~idl~~~~~~~~~~~i~~~~f  156 (453)
T d2ij2a1          79 FA--GDGLFTSWTHEKNWKKAHNILLPSFSQQAMKGYHAMMVDIAVQLVQKWERLNADEHIEVPEDMTRLTLDTIGLCGF  156 (453)
T ss_dssp             HH--TTSGGGSCTTSHHHHHHHHHHGGGGSTTTHHHHHHHHHHHHHHHHHHHHTCCTTCCEEHHHHHHHHHHHHHHHHHH
T ss_pred             hc--CCcEEecCCChHHHHHHHHHHHHHhhhhhhhhhhhhHHHHHHHHHHHhhhcCCCCccchHHHHHHHhhhcchhccc
Confidence            33  5677653 3499999999999988754                                  889999999999999


Q ss_pred             cccccccchhhhhHHH-HHHHHHHHhcccCCccccccccchhhhhccHHHHHHHHHHHHHHHHHHHHHHHHhcCCCCCCC
Q 037570          157 GRRAEEETAGKCNKFG-ELSRRILVQFVSFSFGDMLPYLGWLDVVTGLIGRLTASSREVDVLFDQVIEKHRISGSDDDHP  235 (254)
Q Consensus       157 G~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~p~l~~l~~~~~~~~~~~~~~~~~~~~~~~~i~~~~~~~~~~~~~  235 (254)
                      |.+++....+...+.. +....+.......  ....|+...   .....+...+..+.++++++++++++++..     +
T Consensus       157 G~~~~~~~~~~~~~~~~~~~~~~~~~~~~~--~~~~~~~~~---~~~~~~~~~~~~~~~~~~~~~~i~~r~~~~-----~  226 (453)
T d2ij2a1         157 NYRFNSFYRDQPHPFITSMVRALDEAMNKL--QRANPDDPA---YDENKRQFQEDIKVMNDLVDKIIADRKASG-----E  226 (453)
T ss_dssp             SCCCCGGGCSSCCHHHHHHHHHHHHHHHTC-----CTTSGG---GHHHHHHHHHHHHHHHHHHHHHHHHHHHHC-----C
T ss_pred             ccccchhhhccchHHHHhhhhccchhhhhh--hhccccccc---chhhHHHHHHHHHHHHHHHHHHHhhhcccc-----c
Confidence            9998754222223333 2222222222211  112232221   134456777888889999999999888763     4


Q ss_pred             CCccHHHHhhccccc
Q 037570          236 NRKDLVHVYSNFKGM  250 (254)
Q Consensus       236 ~~~d~l~~ll~~~~~  250 (254)
                      ...|+++.++++.+.
T Consensus       227 ~~~d~l~~ll~~~~~  241 (453)
T d2ij2a1         227 QSDDLLTHMLNGKDP  241 (453)
T ss_dssp             CCSSHHHHHHHCCCT
T ss_pred             cccchhhhhhhhccc
Confidence            467999999977643
>d1r9oa_ a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1po5a_ a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d2ciba1 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-sterol demethylase (cyp51) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d3czha1 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tqna_ a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1izoa_ a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1n97a_ a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1z8oa1 a.104.1.1 (A:3-404) Cytochrome P450-ERYF {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1odoa_ a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1gwia_ a.104.1.1 (A:) Cyp154c1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1ueda_ a.104.1.1 (A:) p450 monoxygenase OxyC {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d1q5da_ a.104.1.1 (A:) Cytochrome P450epok {Sorangium cellulosum [TaxId: 56]} Back     information, alignment and structure
>d1jfba_ a.104.1.1 (A:) Cytochrome P450-NOR, nitric reductase {Fungus (Fusarium oxysporum) [TaxId: 5507]} Back     information, alignment and structure
>d1re9a_ a.104.1.1 (A:) Cytochrome P450-CAM {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1s1fa_ a.104.1.1 (A:) Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1cpta_ a.104.1.1 (A:) Cytochrome P450-TERP {Pseudomonas sp. [TaxId: 306]} Back     information, alignment and structure
>d1lfka_ a.104.1.1 (A:) p450 monoxygenase OxyB {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d1n40a_ a.104.1.1 (A:) Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1io7a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1ue8a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure