Citrus Sinensis ID: 037577

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-
MATTQSPALTCAIGVTLLTYALTLSSALVPQNPTIRQVTDNPSHLLLGSATENNFKIFMQKYEKSYATREEYVHRLGIFAKNMIRAAEHQLLDPTAVHGVTPFSDLSEEEFESMYTGMKGGPPVMDSGGLESGSVKMMEIDGFPENFDWREKGAVTEVKMQ
ccccccHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHcccccEEEcccccccccHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccc
ccccccHHHHHHHHHHHHHHHHHHHHHcccccccHEEEcccccccccHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEcccccccHHHHHHHHcccccccccccccccccccccccccccccccEEcccccccccccEc
mattqspaltCAIGVTLLTYALTLssalvpqnptirqvtdnpshlllgsatenNFKIFMQKYEKSYATREEYVHRLGIFAKNMIRAAEhqlldptavhgvtpfsdlseeEFESMYtgmkggppvmdsgglesgsvkmmeidgfpenfdwrekgaVTEVKMQ
mattqspaltcAIGVTLLTYALTLSSALVPQNPTIRQVTDNPSHLLLGSATENNFKIFMQKYEKSYATREEYVHRLGIFAKNMIRAAEHQLLDPTAVHGVTPFSDLSEEEFESMYTGMKGGPPVMDSGGLESGSVKMMEIDGfpenfdwrekGAVTEVKMQ
MATTQSPALTCAIGVtlltyaltlssalVPQNPTIRQVTDNPSHLLLGSATENNFKIFMQKYEKSYATREEYVHRLGIFAKNMIRAAEHQLLDPTAVHGVTPFSDLSEEEFESMYTGMKGGPPVMDSGGLESGSVKMMEIDGFPENFDWREKGAVTEVKMQ
*******ALTCAIGVTLLTYALTLSSALVPQNPTIRQVTDNPSHLLLGSATENNFKIFMQKYEKSYATREEYVHRLGIFAKNMIRAAEHQLLDPTAVHGVTPF**********************************************************
**********CAIGVTLLTYALTLSSALVPQNPTIRQV********L*SATENNFKIFMQKYEKSYATREEYVHRLGIFAKNMIRAAEHQLLDPTAVHGVTPFSDLSEEEFESMYTG*********************EIDGFPENFDWREKGAVTEVKMQ
MATTQSPALTCAIGVTLLTYALTLSSALVPQNPTIRQVTDNPSHLLLGSATENNFKIFMQKYEKSYATREEYVHRLGIFAKNMIRAAEHQLLDPTAVHGVTPFSDLSEEEFESMYTGMKGGPPVMDSGGLESGSVKMMEIDGFPENFDWREKGAVTEVKMQ
*****SPALTCAIGVTLLTYALTLSSALVPQNPTIRQVTDNPSHLLLGSATENNFKIFMQKYEKSYATREEYVHRLGIFAKNMIRAAEHQLLDPTAVHGVTPFSDLSEEEFESMYTGMKG***************KMMEIDGFPENFDWREKGAVTEVKMQ
iiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MATTQSPALTCAIGVTLLTYALTLSSALVPQNPTIRQVTDNPSHLLLGSATENNFKIFMQKYEKSYATREEYVHRLGIFAKNMIRAAEHQLLDPTAVHGVTPFSDLSEEEFESMYTGMKGGPPVMDSGGLESGSVKMMEIDGFPENFDWREKGAVTEVKMQ
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query161 2.2.26 [Sep-21-2011]
P25804 363 Cysteine proteinase 15A O N/A no 0.751 0.333 0.448 1e-23
P43295 361 Probable cysteine protein no no 0.857 0.382 0.375 1e-22
Q10716 371 Cysteine proteinase 1 OS= N/A no 0.813 0.353 0.409 2e-22
P43296 368 Cysteine proteinase RD19a no no 0.751 0.328 0.401 4e-21
Q9R013 462 Cathepsin F OS=Mus muscul yes no 0.633 0.220 0.472 4e-18
Q9UBX1 484 Cathepsin F OS=Homo sapie yes no 0.621 0.206 0.436 3e-14
Q9TST1 374 Cathepsin W OS=Felis catu N/A no 0.850 0.366 0.369 2e-13
P25779 467 Cruzipain OS=Trypanosoma N/A no 0.658 0.226 0.376 7e-13
Q26534 319 Cathepsin L OS=Schistosom N/A no 0.621 0.313 0.4 2e-12
P56202 376 Cathepsin W OS=Homo sapie no no 0.633 0.271 0.423 3e-11
>sp|P25804|CYSP_PEA Cysteine proteinase 15A OS=Pisum sativum PE=2 SV=1 Back     alignment and function desciption
 Score =  108 bits (270), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 57/127 (44%), Positives = 76/127 (59%), Gaps = 6/127 (4%)

Query: 35  IRQVTDNPSHLLLGSATENNFKIFMQKYEKSYATREEYVHRLGIFAKNMIRAAEHQLLDP 94
           IRQV DN    LL +  E++F  F  K+ KSYAT+EE+ +R G+F  N+I+A  HQ  DP
Sbjct: 30  IRQVVDNEEDHLLNA--EHHFTSFKSKFSKSYATKEEHDYRFGVFKSNLIKAKLHQNRDP 87

Query: 95  TAVHGVTPFSDLSEEEFESMYTGMKGGPPVMDSGGLESGSVKMMEIDGFPENFDWREKGA 154
           TA HG+T FSDL+  EF   + G+K    +       +    ++     PE+FDWREKGA
Sbjct: 88  TAEHGITKFSDLTASEFRRQFLGLKKRLRLP----AHAQKAPILPTTNLPEDFDWREKGA 143

Query: 155 VTEVKMQ 161
           VT VK Q
Sbjct: 144 VTPVKDQ 150

Pisum sativum (taxid: 3888)
EC: 3EC: .EC: 4EC: .EC: 2EC: 2EC: .EC: -
>sp|P43295|A494_ARATH Probable cysteine proteinase A494 OS=Arabidopsis thaliana GN=At2g21430 PE=2 SV=2 Back     alignment and function description
>sp|Q10716|CYSP1_MAIZE Cysteine proteinase 1 OS=Zea mays GN=CCP1 PE=2 SV=1 Back     alignment and function description
>sp|P43296|RD19A_ARATH Cysteine proteinase RD19a OS=Arabidopsis thaliana GN=RD19A PE=2 SV=1 Back     alignment and function description
>sp|Q9R013|CATF_MOUSE Cathepsin F OS=Mus musculus GN=Ctsf PE=2 SV=1 Back     alignment and function description
>sp|Q9UBX1|CATF_HUMAN Cathepsin F OS=Homo sapiens GN=CTSF PE=1 SV=1 Back     alignment and function description
>sp|Q9TST1|CATW_FELCA Cathepsin W OS=Felis catus GN=CTSW PE=2 SV=2 Back     alignment and function description
>sp|P25779|CYSP_TRYCR Cruzipain OS=Trypanosoma cruzi PE=1 SV=1 Back     alignment and function description
>sp|Q26534|CATL_SCHMA Cathepsin L OS=Schistosoma mansoni GN=CL1 PE=2 SV=1 Back     alignment and function description
>sp|P56202|CATW_HUMAN Cathepsin W OS=Homo sapiens GN=CTSW PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query161
225448924 375 PREDICTED: cysteine proteinase 15A-like 0.937 0.402 0.585 2e-44
351726954 380 cysteine proteinase precursor [Glycine m 0.956 0.405 0.551 7e-40
4678299 363 cysteine proteinase precursor-like prote 0.776 0.344 0.586 1e-39
240255643 367 Papain family cysteine protease [Arabido 0.776 0.340 0.586 2e-39
297816790 368 hypothetical protein ARALYDRAFT_485911 [ 0.776 0.339 0.586 5e-39
2414683 379 cysteine proteinase precursor [Vicia sat 0.962 0.408 0.536 5e-39
351629613 397 cysteine proteinase CP1 [Coffea canephor 1.0 0.405 0.502 7e-39
255585361 381 cysteine protease, putative [Ricinus com 0.795 0.335 0.610 2e-38
356576257 374 PREDICTED: LOW QUALITY PROTEIN: cysteine 0.925 0.398 0.521 1e-37
147809367 321 hypothetical protein VITISV_015725 [Viti 0.664 0.333 0.690 1e-37
>gi|225448924|ref|XP_002266821.1| PREDICTED: cysteine proteinase 15A-like [Vitis vinifera] Back     alignment and taxonomy information
 Score =  184 bits (466), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 96/164 (58%), Positives = 114/164 (69%), Gaps = 13/164 (7%)

Query: 8   ALTCAIGVTLLTYA------LTLSSALVPQNPTIRQVTDNPSHLLLGS----ATENNFKI 57
            LTCA+GV  L         ++L     P +P I QVTD  SH   G      TE  F++
Sbjct: 4   GLTCALGVAALLTCALAASAISLHEHDTPWDPNIVQVTDGHSHRKFGVDGVLGTEKEFRM 63

Query: 58  FMQKYEKSYATREEYVHRLGIFAKNMIRAAEHQLLDPTAVHGVTPFSDLSEEEFESMYTG 117
           FM+KY K Y++REEYVHRLGIFAKNM+RAAEHQ LDPTA+HGVTPFSDLSEEEFE M+TG
Sbjct: 64  FMEKYGKEYSSREEYVHRLGIFAKNMVRAAEHQALDPTALHGVTPFSDLSEEEFERMFTG 123

Query: 118 MKGGPPVMDSGGLESGSVKMMEIDGFPENFDWREKGAVTEVKMQ 161
           +  G P M  G  E+ +   +E+DG PE+FDWREKGAVTEVKMQ
Sbjct: 124 VV-GRPHMKGGVAETAAA--LEVDGLPESFDWREKGAVTEVKMQ 164

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|351726954|ref|NP_001236888.1| cysteine proteinase precursor [Glycine max] gi|479060|emb|CAA83673.1| cysteine proteinase [Glycine max] gi|300507422|gb|ADK24076.1| cysteine proteinase [Glycine max] gi|300507425|gb|ADK24077.1| cysteine proteinase [Glycine max] gi|1096153|prf||2111244A Cys protease Back     alignment and taxonomy information
>gi|4678299|emb|CAB41090.1| cysteine proteinase precursor-like protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|240255643|ref|NP_567010.5| Papain family cysteine protease [Arabidopsis thaliana] gi|17979125|gb|AAL49820.1| putative cysteine proteinase [Arabidopsis thaliana] gi|332645795|gb|AEE79316.1| Papain family cysteine protease [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297816790|ref|XP_002876278.1| hypothetical protein ARALYDRAFT_485911 [Arabidopsis lyrata subsp. lyrata] gi|297322116|gb|EFH52537.1| hypothetical protein ARALYDRAFT_485911 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|2414683|emb|CAB16316.1| cysteine proteinase precursor [Vicia sativa] Back     alignment and taxonomy information
>gi|351629613|gb|AEQ54770.1| cysteine proteinase CP1 [Coffea canephora] Back     alignment and taxonomy information
>gi|255585361|ref|XP_002533377.1| cysteine protease, putative [Ricinus communis] gi|223526784|gb|EEF29008.1| cysteine protease, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|356576257|ref|XP_003556249.1| PREDICTED: LOW QUALITY PROTEIN: cysteine proteinase 15A-like [Glycine max] Back     alignment and taxonomy information
>gi|147809367|emb|CAN64491.1| hypothetical protein VITISV_015725 [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query161
TAIR|locus:2082687 367 AT3G54940 [Arabidopsis thalian 0.770 0.337 0.593 3e-37
TAIR|locus:2050145 361 AT2G21430 [Arabidopsis thalian 0.751 0.335 0.409 9e-22
TAIR|locus:2130180 373 AT4G16190 [Arabidopsis thalian 0.776 0.335 0.438 1.1e-21
TAIR|locus:2120222 368 RD19 "RESPONSIVE TO DEHYDRATIO 0.751 0.328 0.401 1.5e-20
MGI|MGI:1861434 462 Ctsf "cathepsin F" [Mus muscul 0.633 0.220 0.472 1.8e-17
RGD|1308181 462 Ctsf "cathepsin F" [Rattus nor 0.621 0.216 0.472 4.8e-17
UNIPROTKB|E2RR02 460 CTSF "Uncharacterized protein" 0.639 0.223 0.416 9.8e-16
UNIPROTKB|F1RU48 460 CTSF "Uncharacterized protein" 0.633 0.221 0.444 2.7e-15
UNIPROTKB|Q0VCU3 460 CTSF "Uncharacterized protein" 0.633 0.221 0.435 7.3e-15
WB|WBGene00007055 477 tag-196 [Caenorhabditis elegan 0.670 0.226 0.401 5.9e-14
TAIR|locus:2082687 AT3G54940 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 400 (145.9 bits), Expect = 3.0e-37, P = 3.0e-37
 Identities = 79/133 (59%), Positives = 100/133 (75%)

Query:    34 TIRQVTDNPSHL---LLGSATENNFKIFMQKYEKSYATREEYVHRLGIFAKNMIRAAEHQ 90
             TIRQVT +   +   LLG+ TE+ F++FM  Y K+Y+TREEY+HRLGIFAKN+++AAEHQ
Sbjct:    27 TIRQVTADNRRIRPNLLGTHTESKFRLFMSDYGKNYSTREEYIHRLGIFAKNVLKAAEHQ 86

Query:    91 LLDPTAVHGVTPFSDLSEEEFESMYTGMK--GGPPVMDSGGLESGSVKMMEIDGFPENFD 148
             ++DP+AVHGVT FSDL+EEEF+ MYTG+   GG      GG       M+E+DG PE+FD
Sbjct:    87 MMDPSAVHGVTQFSDLTEEEFKRMYTGVADVGG----SRGGTVGAEAPMVEVDGLPEDFD 142

Query:   149 WREKGAVTEVKMQ 161
             WREKG VTEVK Q
Sbjct:   143 WREKGGVTEVKNQ 155
GO:0005576 "extracellular region" evidence=ISM
GO:0006508 "proteolysis" evidence=IEA;ISS
GO:0008234 "cysteine-type peptidase activity" evidence=IEA;ISS
TAIR|locus:2050145 AT2G21430 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2130180 AT4G16190 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2120222 RD19 "RESPONSIVE TO DEHYDRATION 19" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
MGI|MGI:1861434 Ctsf "cathepsin F" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1308181 Ctsf "cathepsin F" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|E2RR02 CTSF "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1RU48 CTSF "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|Q0VCU3 CTSF "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
WB|WBGene00007055 tag-196 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query161
smart0084857 smart00848, Inhibitor_I29, Cathepsin propeptide in 4e-16
PTZ00203 348 PTZ00203, PTZ00203, cathepsin L protease; Provisio 6e-16
pfam0824658 pfam08246, Inhibitor_I29, Cathepsin propeptide inh 6e-16
PTZ00021 489 PTZ00021, PTZ00021, falcipain-2; Provisional 8e-10
PTZ00200 448 PTZ00200, PTZ00200, cysteine proteinase; Provision 2e-09
pfam00112 213 pfam00112, Peptidase_C1, Papain family cysteine pr 6e-06
smart00645 175 smart00645, Pept_C1, Papain family cysteine protea 8e-06
cd02248 210 cd02248, Peptidase_C1A, Peptidase C1A subfamily (M 1e-05
>gnl|CDD|214853 smart00848, Inhibitor_I29, Cathepsin propeptide inhibitor domain (I29) Back     alignment and domain information 
 Score = 67.7 bits (166), Expect = 4e-16
 Identities = 21/57 (36%), Positives = 33/57 (57%), Gaps = 1/57 (1%)

Query: 55  FKIFMQKYEKSYATREEYVHRLGIFAKNMIRAAEHQLL-DPTAVHGVTPFSDLSEEE 110
           F+ + +K+ KSY++ EE   R  IF +N+ +  EH    + +   GV  FSDL+ EE
Sbjct: 1   FEQWKKKHGKSYSSEEEEARRFAIFKENLKKIEEHNKKYEHSYKLGVNQFSDLTPEE 57

This domain is found at the N-terminus of some C1 peptidases such as Cathepsin L where it acts as a propeptide. There are also a number of proteins that are composed solely of multiple copies of this domain such as the peptidase inhibitor salarin. This family is classified as I29 by MEROPS. Peptide proteinase inhibitors can be found as single domain proteins or as single or multiple domains within proteins; these are referred to as either simple or compound inhibitors, respectively. In many cases they are synthesised as part of a larger precursor protein, either as a prepropeptide or as an N-terminal domain associated with an inactive peptidase or zymogen. This domain prevents access of the substrate to the active site. Removal of the N-terminal inhibitor domain either by interaction with a second peptidase or by autocatalytic cleavage activates the zymogen. Other inhibitors interact direct with proteinases using a simple noncovalent lock and key mechanism; while yet others use a conformational change-based trapping mechanism that depends on their structural and thermodynamic properties. Length = 57
>gnl|CDD|185513 PTZ00203, PTZ00203, cathepsin L protease; Provisional Back     alignment and domain information
>gnl|CDD|219764 pfam08246, Inhibitor_I29, Cathepsin propeptide inhibitor domain (I29) Back     alignment and domain information
>gnl|CDD|240232 PTZ00021, PTZ00021, falcipain-2; Provisional Back     alignment and domain information
>gnl|CDD|240310 PTZ00200, PTZ00200, cysteine proteinase; Provisional Back     alignment and domain information
>gnl|CDD|215726 pfam00112, Peptidase_C1, Papain family cysteine protease Back     alignment and domain information
>gnl|CDD|214761 smart00645, Pept_C1, Papain family cysteine protease Back     alignment and domain information
>gnl|CDD|239068 cd02248, Peptidase_C1A, Peptidase C1A subfamily (MEROPS database nomenclature); composed of cysteine peptidases (CPs) similar to papain, including the mammalian CPs (cathepsins B, C, F, H, L, K, O, S, V, X and W) Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 161
KOG1542 372 consensus Cysteine proteinase Cathepsin F [Posttra 99.96
PTZ00203 348 cathepsin L protease; Provisional 99.95
PTZ00200 448 cysteine proteinase; Provisional 99.91
PTZ00021 489 falcipain-2; Provisional 99.89
PF0824658 Inhibitor_I29: Cathepsin propeptide inhibitor doma 99.8
smart0084857 Inhibitor_I29 Cathepsin propeptide inhibitor domai 99.66
KOG1543 325 consensus Cysteine proteinase Cathepsin L [Posttra 99.6
PTZ00364 548 dipeptidyl-peptidase I precursor; Provisional 96.52
PF0812741 Propeptide_C1: Peptidase family C1 propeptide; Int 96.19
PTZ00049 693 cathepsin C-like protein; Provisional 94.93
COG4870 372 Cysteine protease [Posttranslational modification, 91.97
>KOG1542 consensus Cysteine proteinase Cathepsin F [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information 
Probab=99.96  E-value=4.3e-29  Score=204.28  Aligned_cols=146  Identities=44%  Similarity=0.633  Sum_probs=115.6

Q ss_pred             HHHHHHHHHHHHHHhhhccCCCCCCccccccCC--ccccccCchHHHHHHHHHHHhCCCCCCHHHHHHHHHHHHHHHHHH
Q 037577            9 LTCAIGVTLLTYALTLSSALVPQNPTIRQVTDN--PSHLLLGSATENNFKIFMQKYEKSYATREEYVHRLGIFAKNMIRA   86 (161)
Q Consensus         9 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~--~~~~~~~~~~~~~f~~fk~k~~K~Y~s~~E~~~R~~iF~~N~~~I   86 (161)
                      ..|...+++++..+  +-..+.++.+|++|+..  ..++.++  .+..|..|+.+|+|+|.+.+|..+|+.+|+.|+..+
T Consensus        27 ~~~~~~~~~~~~~~--~~v~~~~~~~i~~v~~~~~~~~~~l~--~~~~F~~F~~kf~r~Y~s~eE~~~Rl~iF~~N~~~a  102 (372)
T KOG1542|consen   27 RKCPIEFTALSVSL--SVVPLGDDLTIRQVVRLQDLNPRGLG--LEDSFKLFTIKFGRSYASREEHAHRLSIFKHNLLRA  102 (372)
T ss_pred             hccchhhhhhhhhc--cccccchhhhhhhhhhhcccCCcccc--hHHHHHHHHHhcCcccCcHHHHHHHHHHHHHHHHHH
Confidence            34455455554443  33446678899998874  4566777  699999999999999999999999999999999999


Q ss_pred             HHhcCCCC-CeeeeeCcCCCCCHHHHHHHhcCCCCCCCCCCCCCCCCCcccccccCCCCCccccccCCCCCCCCCC
Q 037577           87 AEHQLLDP-TAVHGVTPFSDLSEEEFESMYTGMKGGPPVMDSGGLESGSVKMMEIDGFPENFDWREKGAVTEVKMQ  161 (161)
Q Consensus        87 ~~hN~~~~-sy~lgiN~FsDlT~eEf~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~lP~s~DWR~kg~VtpVKnQ  161 (161)
                      ++++..+. +..+|+|+|||||+|||++++++.+.....   .+......+......+|++||||++|+|||||||
T Consensus       103 ~~~q~~d~gsA~yGvtqFSDlT~eEFkk~~l~~~~~~~~---~~~~~~~~~~~~~~~lP~~fDWR~kgaVTpVKnQ  175 (372)
T KOG1542|consen  103 ERLQENDPGSAEYGVTQFSDLTEEEFKKIYLGVKRRGSK---LPGDAAEAPIEPGESLPESFDWRDKGAVTPVKNQ  175 (372)
T ss_pred             HHhhhcCccccccCccchhhcCHHHHHHHhhcccccccc---CccccccCcCCCCCCCCcccchhccCCccccccC
Confidence            99998876 899999999999999999999887653210   1222233333456789999999999999999999

>PTZ00203 cathepsin L protease; Provisional Back     alignment and domain information
>PTZ00200 cysteine proteinase; Provisional Back     alignment and domain information
>PTZ00021 falcipain-2; Provisional Back     alignment and domain information
>PF08246 Inhibitor_I29: Cathepsin propeptide inhibitor domain (I29); InterPro: IPR013201 Peptide proteinase inhibitors can be found as single domain proteins or as single or multiple domains within proteins; these are referred to as either simple or compound inhibitors, respectively Back     alignment and domain information
>smart00848 Inhibitor_I29 Cathepsin propeptide inhibitor domain (I29) Back     alignment and domain information
>KOG1543 consensus Cysteine proteinase Cathepsin L [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PTZ00364 dipeptidyl-peptidase I precursor; Provisional Back     alignment and domain information
>PF08127 Propeptide_C1: Peptidase family C1 propeptide; InterPro: IPR012599 This domain is found at the N-terminal of cathepsin B and cathepsin B-like peptidases that belong to MEROPS peptidase subfamily C1A Back     alignment and domain information
>PTZ00049 cathepsin C-like protein; Provisional Back     alignment and domain information
>COG4870 Cysteine protease [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query161
3tnx_A 363 Structure Of The Precursor Of A Thermostable Varian 6e-09
1pci_A 322 Procaricain Length = 322 9e-09
2o6x_A 310 Crystal Structure Of Procathepsin L1 From Fasciola 8e-06
2c0y_A 315 The Crystal Structure Of A Cys25ala Mutant Of Human 9e-06
3f75_P106 Activated Toxoplasma Gondii Cathepsin L (Tgcpl) In 1e-04
3qj3_A 331 Structure Of Digestive Procathepsin L2 Proteinase F 2e-04
>pdb|3TNX|A Chain A, Structure Of The Precursor Of A Thermostable Variant Of Papain At 2.6 Angstroem Resolution Length = 363 Back     alignment and structure 
Iteration: 1

 Score = 56.6 bits (135), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 37/111 (33%), Positives = 53/111 (47%), Gaps = 10/111 (9%)
Query: 55  FKIFMQKYEKSYATREEYVHRLGIFAKNMIRAAEHQLLDPTAVHGVTPFSDLSEEEFESM 114
           F+ +M K+ K Y   +E ++R  IF  N+    E    + +   G+  F+D+S +EF+  
Sbjct: 66  FESWMLKHNKIYKNIDEKIYRFEIFKDNLKYIDETNKKNNSYWLGLNVFADMSNDEFKEK 125
Query: 115 YTGMKGGPPVMDSGG----LESGSVKMMEIDGFPENFDWREKGAVTEVKMQ 161
           YTG   G            L  G V +      PE  DWR+KGAVT VK Q
Sbjct: 126 YTGSIAGNYTTTELSYEEVLNDGDVNI------PEYVDWRQKGAVTPVKNQ 170
>pdb|1PCI|A Chain A, Procaricain Length = 322 Back     alignment and structure
>pdb|2O6X|A Chain A, Crystal Structure Of Procathepsin L1 From Fasciola Hepatica Length = 310 Back     alignment and structure
>pdb|2C0Y|A Chain A, The Crystal Structure Of A Cys25ala Mutant Of Human Procathepsin S Length = 315 Back     alignment and structure
>pdb|3F75|P Chain P, Activated Toxoplasma Gondii Cathepsin L (Tgcpl) In Complex With Its Propeptide Length = 106 Back     alignment and structure
>pdb|3QJ3|A Chain A, Structure Of Digestive Procathepsin L2 Proteinase From Tenebrio Molitor Larval Midgut Length = 331 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query161
3qj3_A 331 Cathepsin L-like protein; hydrolase, proteinase, l 3e-31
1xkg_A 312 DER P I, major mite fecal allergen DER P 1; major 9e-31
2c0y_A 315 Procathepsin S; proenzyme, proteinase, hydrolase, 2e-28
1pci_A 322 Procaricain; zymogen, hydrolase, thiol protease; 3 2e-27
2o6x_A 310 Procathepsin L1, secreted cathepsin L 1; hydrolase 2e-26
1cs8_A 316 Human procathepsin L; prosegment, propeptide, inhi 3e-26
1by8_A 314 Protein (procathepsin K); hydrolase(sulfhydryl pro 3e-26
3qt4_A 329 Cathepsin-L-like midgut cysteine proteinase; hydro 9e-25
3f75_P106 Toxopain-2, cathepsin L propeptide; medical struct 2e-21
2l95_A80 Crammer, LP06209P; cysteine proteinase inhibitor, 3e-13
3pdf_A 441 Cathepsin C, dipeptidyl peptidase 1; two domains, 1e-11
1m6d_A 214 Cathepsin F, catsf; papain family cysteine proteas 4e-07
3i06_A 215 Cruzipain; autocatalytic cleavage, glycoprotein, p 5e-07
3u8e_A 222 Papain-like cysteine protease; papain-like cystein 7e-07
1o0e_A 208 Ervatamin C; plant cysteine protease, two domain, 8e-07
3bwk_A 243 Cysteine protease falcipain-3; malaria, hydrolase; 1e-06
2bdz_A 214 Mexicain; cysteine protease, peptidase_C1, papain- 1e-06
3f5v_A 222 DER P 1 allergen; allergy, asthma, DUST mites, gly 1e-06
2oul_A 241 Falcipain 2; cysteine protease, inhibitor, macromo 1e-06
1yal_A 218 Chymopapain; hydrolase, thiol protease; 1.70A {Car 2e-06
2b1m_A 246 SPE31; papain-like, sugar binding protein; HET: NA 2e-06
2xu3_A 220 Cathepsin L1; hydrolase, drug design, thiol protea 2e-06
1cqd_A 221 Protein (protease II); cysteine protease, glycopro 3e-06
3kwz_A 215 Cathepsin K; enzyme inhibitor, covalent reversible 3e-06
3ovx_A 218 Cathepsin S; hydrolase, covalent inhibitor, aldehy 4e-06
1s4v_A 229 Cysteine endopeptidase; KDEL ER retention signal, 4e-06
2fo5_A 262 Cysteine proteinase EP-B 2; EP-B2, EPB2, EPB, cyst 4e-06
2cio_A 212 Papain; hydrolase/inhibitor, complex hydrolase/inh 4e-06
1iwd_A 215 Ervatamin B; cysteine protease, alpha-beta protein 4e-06
3ioq_A 213 CMS1MS2; caricaceae, cysteine protease, papain fam 4e-06
3f75_A 224 Toxopain-2, cathepsin L protease; medical structur 5e-06
3hhi_A 325 Cathepsin B-like cysteine protease; occluding loop 5e-06
3p5u_A 220 Actinidin; SAD, cysteine proteinases, hydrolase; 1 7e-06
1ppo_A 216 Protease omega; hydrolase(thiol protease); 1.80A { 7e-06
1deu_A 277 Procathepsin X; cysteine protease, proregion, pros 8e-06
3pbh_A 317 Procathepsin B; thiol protease, cysteine protease, 9e-06
8pch_A 220 Cathepsin H; hydrolase, protease, cysteine protein 2e-05
2wbf_X 265 Serine-repeat antigen protein; SERA, malaria, vacu 2e-04
>3qj3_A Cathepsin L-like protein; hydrolase, proteinase, larVal midgut; 1.85A {Tenebrio molitor} Length = 331 Back     alignment and structure
 Score =  113 bits (285), Expect = 3e-31
 Identities = 34/132 (25%), Positives = 56/132 (42%), Gaps = 11/132 (8%)

Query: 41  NPSHLLLGSAT-----ENNFKIFMQKYEKSYATREEYVHRLGIFAKNMIRAAEHQLLDPT 95
           +  H L GSA         ++ F   Y +SY   +E   R  IF K +    EH      
Sbjct: 3   HHHHHLEGSALPSTFVAEKWENFKTTYARSYVNAKEETFRKQIFQKKLETFEEHNEKYRQ 62

Query: 96  AVH----GVTPFSDLSEEEFESMYTGMKGGPPVMDSG--GLESGSVKMMEIDGFPENFDW 149
            +     GV  F+D++ EE ++   G+     +  +G        + +     +P +FDW
Sbjct: 63  GLVSYTLGVNLFTDMTPEEMKAYTHGLIMPADLHKNGIPIKTREDLGLNASVRYPASFDW 122

Query: 150 REKGAVTEVKMQ 161
           R++G V+ VK Q
Sbjct: 123 RDQGMVSPVKNQ 134
>1xkg_A DER P I, major mite fecal allergen DER P 1; major allergen, cysteine protease, house DUST mite, dermatop pteronyssinus; 1.61A {Dermatophagoides pteronyssinus} SCOP: d.3.1.1 Length = 312 Back     alignment and structure
>2c0y_A Procathepsin S; proenzyme, proteinase, hydrolase, thiol protease, prosegment binding loop, glycoprotein, lysosome, protease, zymogen; 2.1A {Homo sapiens} Length = 315 Back     alignment and structure
>1pci_A Procaricain; zymogen, hydrolase, thiol protease; 3.20A {Carica papaya} SCOP: d.3.1.1 Length = 322 Back     alignment and structure
>2o6x_A Procathepsin L1, secreted cathepsin L 1; hydrolase, thiol protease, cysteine protease, zymogen, hydro; 1.40A {Fasciola hepatica} Length = 310 Back     alignment and structure
>1cs8_A Human procathepsin L; prosegment, propeptide, inhibition, hydrolase; HET: OCS; 1.80A {Homo sapiens} SCOP: d.3.1.1 PDB: 1cjl_A 3hwn_A* Length = 316 Back     alignment and structure
>1by8_A Protein (procathepsin K); hydrolase(sulfhydryl proteinase), papain; 2.60A {Homo sapiens} SCOP: d.3.1.1 PDB: 7pck_A Length = 314 Back     alignment and structure
>3qt4_A Cathepsin-L-like midgut cysteine proteinase; hydrolase, zymogen, intramolecular DISS bonds, insect larVal midgut; HET: PG4 PG6; 2.11A {Tenebrio molitor} Length = 329 Back     alignment and structure
>3f75_P Toxopain-2, cathepsin L propeptide; medical structural genomics of pathogenic protozoa, MSGPP, C protease, parasite, protozoa, hydrolase; 1.99A {Toxoplasma gondii} Length = 106 Back     alignment and structure
>2l95_A Crammer, LP06209P; cysteine proteinase inhibitor, intrinsic disorder P like protein, hydrolase; NMR {Drosophila melanogaster} Length = 80 Back     alignment and structure
>3pdf_A Cathepsin C, dipeptidyl peptidase 1; two domains, cystein protease, hydrolase-hydrolase inhibitor; HET: LXV NAG; 1.85A {Homo sapiens} PDB: 1jqp_A* 2djf_B* 1k3b_B* 2djg_B* 2djf_A* 1k3b_A* 2djg_A* 2djf_C* 1k3b_C* 2djg_C* Length = 441 Back     alignment and structure
>1m6d_A Cathepsin F, catsf; papain family cysteine protease, hydrolase; HET: MYP; 1.70A {Homo sapiens} SCOP: d.3.1.1 Length = 214 Back     alignment and structure
>3i06_A Cruzipain; autocatalytic cleavage, glycoprotein, protease, thiol protease, zymogen; HET: QL2; 1.10A {Trypanosoma cruzi} PDB: 1ewm_A* 1ewo_A* 1ewl_A* 1f29_A* 1ewp_A* 1f2b_A* 1f2c_A* 1f2a_A* 1me4_A* 1u9q_X* 2aim_A* 2efm_A* 2oz2_A* 1me3_A* 3kku_A* 3lxs_A* 1aim_A* 3iut_A* 3hd3_A* 2p86_A* ... Length = 215 Back     alignment and structure
>3u8e_A Papain-like cysteine protease; papain-like cysteine peptidase, peptidase_C1A, hydrolase, in form; 1.31A {Crocus sativus} Length = 222 Back     alignment and structure
>1o0e_A Ervatamin C; plant cysteine protease, two domain, stable at PH 2-12, HYDR; 1.90A {Tabernaemontana divaricata} SCOP: d.3.1.1 PDB: 2pns_A* 2pre_A* 3bcn_A* Length = 208 Back     alignment and structure
>3bwk_A Cysteine protease falcipain-3; malaria, hydrolase; HET: C1P; 2.42A {Plasmodium falciparum} PDB: 3bpm_A* Length = 243 Back     alignment and structure
>2bdz_A Mexicain; cysteine protease, peptidase_C1, papain-like, HYDR; HET: E64; 2.10A {Jacaratia mexicana} Length = 214 Back     alignment and structure
>3f5v_A DER P 1 allergen; allergy, asthma, DUST mites, glycoprotein, hydrola protease, secreted, thiol protease; HET: P6G; 1.36A {Dermatophagoides pteronyssinus} PDB: 2as8_A 3rvw_A* 3rvx_A 3rvv_A* 3d6s_A* Length = 222 Back     alignment and structure
>2oul_A Falcipain 2; cysteine protease, inhibitor, macromolecular interaction, HY hydrolase inhibitor complex; 2.20A {Plasmodium falciparum} SCOP: d.3.1.1 PDB: 2ghu_A 1yvb_A 3bpf_A* 3pnr_A Length = 241 Back     alignment and structure
>1yal_A Chymopapain; hydrolase, thiol protease; 1.70A {Carica papaya} SCOP: d.3.1.1 PDB: 1gec_E* Length = 218 Back     alignment and structure
>2b1m_A SPE31; papain-like, sugar binding protein; HET: NAG FUC PG4; 2.00A {Pachyrhizus erosus} PDB: 2b1n_A* Length = 246 Back     alignment and structure
>2xu3_A Cathepsin L1; hydrolase, drug design, thiol protease; HET: XU3 BTB; 0.90A {Homo sapiens} PDB: 2xu4_A* 2xu5_A* 2yj2_A* 2yj8_A* 2yj9_A* 2yjb_A* 2yjc_A* 3bc3_A* 3h89_A* 3h8b_A* 3h8c_A* 3of9_A* 3of8_A* 3hha_A* 2xu1_A* 3iv2_A* 3k24_A* 2nqd_B* 3kse_A* 2vhs_A ... Length = 220 Back     alignment and structure
>1cqd_A Protein (protease II); cysteine protease, glycoprotein, proline specificity, carboh papain family, hydrolase; HET: NAG FUL FUC; 2.10A {Zingiber officinale} SCOP: d.3.1.1 Length = 221 Back     alignment and structure
>3kwz_A Cathepsin K; enzyme inhibitor, covalent reversible inhibitor, disease mutation, disulfide bond, glycoprotein, hydrolase, lysosome, protease; HET: KWZ; 1.49A {Homo sapiens} PDB: 1au0_A* 1au2_A* 1au3_A* 1au4_A* 1ayu_A* 1ayv_A* 1ayw_A* 1bgo_A* 1atk_A* 1nl6_A* 1nlj_A* 1q6k_A* 1mem_A* 1yk7_A* 1yk8_A* 1yt7_A* 2ato_A* 2aux_A* 2auz_A* 2bdl_A* ... Length = 215 Back     alignment and structure
>3ovx_A Cathepsin S; hydrolase, covalent inhibitor, aldehyde warhead is covalently bound to Cys25, lysosomeal protein; HET: O64; 1.49A {Homo sapiens} PDB: 2h7j_A* 2f1g_A* 2hh5_B* 2hhn_A* 2hxz_A* 2op3_A* 2frq_A* 2fra_A* 2fq9_A* 2ft2_A* 2fud_A* 2g7y_A* 1ms6_A* 2r9m_A* 2r9n_A* 2r9o_A* 3n3g_A* 3n4c_A* 3mpe_A* 1nqc_A* ... Length = 218 Back     alignment and structure
>1s4v_A Cysteine endopeptidase; KDEL ER retention signal, endosperm, ricinosomes, SEED germi senescence, hydrolase-hydrolase inhibitor complex; 2.00A {Ricinus communis} SCOP: d.3.1.1 Length = 229 Back     alignment and structure
>2fo5_A Cysteine proteinase EP-B 2; EP-B2, EPB2, EPB, cysteine endoprotease, endopeptidase, LEUP hydrolase; HET: AR7; 2.20A {Hordeum vulgare} Length = 262 Back     alignment and structure
>2cio_A Papain; hydrolase/inhibitor, complex hydrolase/inhibitor, ICP, cysteine protease, allergen, protease, thiol protease; 1.5A {Carica papaya} PDB: 1khq_A 1khp_A 1ppn_A 3e1z_B 3ima_A 3lfy_A 9pap_A 1bqi_A* 1bp4_A* 1pad_A 1pe6_A* 1pip_A* 1pop_A* 1ppd_A 1ppp_A* 1stf_E* 2pad_A 4pad_A* 5pad_A* 6pad_A* ... Length = 212 Back     alignment and structure
>1iwd_A Ervatamin B; cysteine protease, alpha-beta protein, catalytic DYAD, L-DOM domain., hydrolase; 1.63A {Tabernaemontana divaricata} SCOP: d.3.1.1 Length = 215 Back     alignment and structure
>3ioq_A CMS1MS2; caricaceae, cysteine protease, papain family, hydrolase; HET: E64 SO4; 1.87A {Carica candamarcensis} Length = 213 Back     alignment and structure
>3f75_A Toxopain-2, cathepsin L protease; medical structural genomics of pathogenic protozoa, MSGPP, C protease, parasite, protozoa, hydrolase; 1.99A {Toxoplasma gondii} Length = 224 Back     alignment and structure
>3hhi_A Cathepsin B-like cysteine protease; occluding loop, hydrolase, THIO protease; HET: 074; 1.60A {Trypanosoma brucei} PDB: 3mor_A* Length = 325 Back     alignment and structure
>3p5u_A Actinidin; SAD, cysteine proteinases, hydrolase; 1.50A {Actinidia arguta} PDB: 3p5v_A 3p5w_A 3p5x_A 1aec_A* 2act_A Length = 220 Back     alignment and structure
>1ppo_A Protease omega; hydrolase(thiol protease); 1.80A {Carica papaya} SCOP: d.3.1.1 PDB: 1meg_A* Length = 216 Back     alignment and structure
>1deu_A Procathepsin X; cysteine protease, proregion, prosegment, HY; 1.70A {Homo sapiens} SCOP: d.3.1.1 PDB: 1ef7_A Length = 277 Back     alignment and structure
>3pbh_A Procathepsin B; thiol protease, cysteine protease, proenzyme, papain; 2.50A {Homo sapiens} SCOP: d.3.1.1 PDB: 2pbh_A 1pbh_A 1mir_A Length = 317 Back     alignment and structure
>8pch_A Cathepsin H; hydrolase, protease, cysteine proteinase, aminopeptidase; HET: NAG BMA; 2.10A {Sus scrofa} SCOP: d.3.1.1 PDB: 1nb3_A* 1nb5_A* Length = 220 Back     alignment and structure
>2wbf_X Serine-repeat antigen protein; SERA, malaria, vacuole, protease, cathepsin, hydrolase, glycoprotein, thiol protease; HET: DMS; 1.60A {Plasmodium falciparum} PDB: 3ch3_X 3ch2_X Length = 265 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query161
3tnx_A 363 Papain; hydrolase, cytoplasm for recombinant expre 99.96
3qj3_A 331 Cathepsin L-like protein; hydrolase, proteinase, l 99.95
1pci_A 322 Procaricain; zymogen, hydrolase, thiol protease; 3 99.93
1by8_A 314 Protein (procathepsin K); hydrolase(sulfhydryl pro 99.93
1cs8_A 316 Human procathepsin L; prosegment, propeptide, inhi 99.93
2c0y_A 315 Procathepsin S; proenzyme, proteinase, hydrolase, 99.93
3qt4_A 329 Cathepsin-L-like midgut cysteine proteinase; hydro 99.92
2o6x_A 310 Procathepsin L1, secreted cathepsin L 1; hydrolase 99.92
3f75_P106 Toxopain-2, cathepsin L propeptide; medical struct 99.85
1xkg_A 312 DER P I, major mite fecal allergen DER P 1; major 99.85
2l95_A80 Crammer, LP06209P; cysteine proteinase inhibitor, 99.83
3pdf_A 441 Cathepsin C, dipeptidyl peptidase 1; two domains, 99.64
3hhi_A 325 Cathepsin B-like cysteine protease; occluding loop 99.39
3pbh_A 317 Procathepsin B; thiol protease, cysteine protease, 99.26
1deu_A 277 Procathepsin X; cysteine protease, proregion, pros 97.24
3ois_A 291 Cysteine protease; alpha and beta, hydrolase; HET: 97.08
>3tnx_A Papain; hydrolase, cytoplasm for recombinant expression; 2.62A {Carica papaya} Back     alignment and structure
Probab=99.96  E-value=2.2e-28  Score=204.18  Aligned_cols=110  Identities=33%  Similarity=0.422  Sum_probs=90.1

Q ss_pred             hHHHHHHHHHHHhCCCCCCHHHHHHHHHHHHHHHHHHHHhcCCCCCeeeeeCcCCCCCHHHHHHHhcCCCCCCCCCCCCC
Q 037577           50 ATENNFKIFMQKYEKSYATREEYVHRLGIFAKNMIRAAEHQLLDPTAVHGVTPFSDLSEEEFESMYTGMKGGPPVMDSGG  129 (161)
Q Consensus        50 ~~~~~f~~fk~k~~K~Y~s~~E~~~R~~iF~~N~~~I~~hN~~~~sy~lgiN~FsDlT~eEf~~~~~g~~~~~~~~~~~~  129 (161)
                      ++...|++||.+|+|.|.+.+|+.+|+.||++|+++|++||+++.+|++|+|+|+|||.+||+.+++|........  ..
T Consensus        61 ~~~~lf~~f~~~~~K~Y~~~~E~~~R~~iF~~Nl~~I~~~N~~~~sy~~g~N~FaDlT~eEf~~~~~~~~~~~~~~--~~  138 (363)
T 3tnx_A           61 RLIQLFESWMLKHNKIYKNIDEKIYRFEIFKDNLKYIDETNKKNNSYWLGLNVFADMSNDEFKEKYTGSIAGNYTT--TE  138 (363)
T ss_dssp             HHHHHHHHHHHHTTCCCSSHHHHHHHHHHHHHHHHHHHHHTTSCCSEEECSCTTTTSCHHHHHHHHSCSSCSCCCC--SS
T ss_pred             HHHHHHHHHHHHcCCcCCCHHHHHHHHHHHHHHHHHHHHHHcCCCCeEEeccccccCCHHHHHHHhcccccccccc--cc
Confidence            4677899999999999999999999999999999999999999889999999999999999999998865433110  00


Q ss_pred             CCCCcccccccCCCCCccccccCCCCCCCCCC
Q 037577          130 LESGSVKMMEIDGFPENFDWREKGAVTEVKMQ  161 (161)
Q Consensus       130 ~~~~~~~~~~~~~lP~s~DWR~kg~VtpVKnQ  161 (161)
                      ............++|++||||++|+|||||||
T Consensus       139 ~~~~~~~~~~~~~lP~s~DWR~~g~VtpVkdQ  170 (363)
T 3tnx_A          139 LSYEEVLNDGDVNIPEYVDWRQKGAVTPVKNQ  170 (363)
T ss_dssp             SSSSCCCCCSCCCCCSCEEGGGGTCCCCCCBC
T ss_pred             cccccccCcccCCCCcceecccCCCCCCCccC
Confidence            00011111234579999999999999999999
>3qj3_A Cathepsin L-like protein; hydrolase, proteinase, larVal midgut; 1.85A {Tenebrio molitor} SCOP: d.3.1.0 Back     alignment and structure
>1pci_A Procaricain; zymogen, hydrolase, thiol protease; 3.20A {Carica papaya} SCOP: d.3.1.1 Back     alignment and structure
>1by8_A Protein (procathepsin K); hydrolase(sulfhydryl proteinase), papain; 2.60A {Homo sapiens} SCOP: d.3.1.1 PDB: 7pck_A Back     alignment and structure
>1cs8_A Human procathepsin L; prosegment, propeptide, inhibition, hydrolase; HET: OCS; 1.80A {Homo sapiens} SCOP: d.3.1.1 PDB: 1cjl_A 3hwn_A* Back     alignment and structure
>2c0y_A Procathepsin S; proenzyme, proteinase, hydrolase, thiol protease, prosegment binding loop, glycoprotein, lysosome, protease, zymogen; 2.1A {Homo sapiens} Back     alignment and structure
>3qt4_A Cathepsin-L-like midgut cysteine proteinase; hydrolase, zymogen, intramolecular DISS bonds, insect larVal midgut; HET: PG4 PG6; 2.11A {Tenebrio molitor} Back     alignment and structure
>2o6x_A Procathepsin L1, secreted cathepsin L 1; hydrolase, thiol protease, cysteine protease, zymogen, hydro; 1.40A {Fasciola hepatica} Back     alignment and structure
>3f75_P Toxopain-2, cathepsin L propeptide; medical structural genomics of pathogenic protozoa, MSGPP, C protease, parasite, protozoa, hydrolase; 1.99A {Toxoplasma gondii} Back     alignment and structure
>1xkg_A DER P I, major mite fecal allergen DER P 1; major allergen, cysteine protease, house DUST mite, dermatop pteronyssinus; 1.61A {Dermatophagoides pteronyssinus} SCOP: d.3.1.1 Back     alignment and structure
>2l95_A Crammer, LP06209P; cysteine proteinase inhibitor, intrinsic disorder P like protein, hydrolase; NMR {Drosophila melanogaster} Back     alignment and structure
>3pdf_A Cathepsin C, dipeptidyl peptidase 1; two domains, cystein protease, hydrolase-hydrolase inhibitor; HET: LXV NAG; 1.85A {Homo sapiens} PDB: 1jqp_A* 2djf_B* 1k3b_B* 2djg_B* 2djf_A* 1k3b_A* 2djg_A* 2djf_C* 1k3b_C* 2djg_C* Back     alignment and structure
>3hhi_A Cathepsin B-like cysteine protease; occluding loop, hydrolase, THIO protease; HET: 074; 1.60A {Trypanosoma brucei} SCOP: d.3.1.0 PDB: 4hwy_A* 3mor_A* Back     alignment and structure
>3pbh_A Procathepsin B; thiol protease, cysteine protease, proenzyme, papain; 2.50A {Homo sapiens} SCOP: d.3.1.1 PDB: 2pbh_A 1pbh_A 1mir_A Back     alignment and structure
>1deu_A Procathepsin X; cysteine protease, proregion, prosegment, HY; 1.70A {Homo sapiens} SCOP: d.3.1.1 PDB: 1ef7_A Back     alignment and structure
>3ois_A Cysteine protease; alpha and beta, hydrolase; HET: UDP; 1.65A {Xylella fastidiosa} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 161
d1xkga1 302 d.3.1.1 (A:4-305) Major mite fecal allergen der p 2e-23
d1cs8a_ 316 d.3.1.1 (A:) (Pro)cathepsin L {Human (Homo sapiens 2e-18
d1yala_ 218 d.3.1.1 (A:) Chymopapain {Papaya (Carica papaya) [ 1e-06
d1khqa_ 212 d.3.1.1 (A:) Papain {Papaya (Carica papaya) [TaxId 5e-06
d2h7ja1 217 d.3.1.1 (A:1-217) (Pro)cathepsin S {Human (Homo sa 6e-06
d1o0ea_ 208 d.3.1.1 (A:) Ervatamin C {East indian rosebay (Erv 6e-06
d1me4a_ 215 d.3.1.1 (A:) Cruzain {Trypanosoma cruzi [TaxId: 56 7e-06
d1m6da_ 214 d.3.1.1 (A:) Cathepsin F {Human (Homo sapiens) [Ta 7e-06
d1cqda_ 216 d.3.1.1 (A:) Proline-specific cysteine protease {G 8e-06
d2r6na1 215 d.3.1.1 (A:1-215) (Pro)cathepsin K {Human (Homo sa 8e-06
d1ppoa_ 216 d.3.1.1 (A:) Caricain (protease omega) {Papaya (Ca 9e-06
d1iwda_ 215 d.3.1.1 (A:) Ervatamin B {Adam's apple (Ervatamia 1e-05
d1fh0a_ 221 d.3.1.1 (A:) (Pro)cathepsin V {Human (Homo sapiens 1e-05
d1aeca_ 218 d.3.1.1 (A:) Actinidin {Chinese gooseberry or kiwi 1e-05
d1s4va_ 224 d.3.1.1 (A:) Vignain (bean endopeptidase) {Castor 1e-05
d2oula1 241 d.3.1.1 (A:-16-224) Falcipain 2 {Plasmodium falcip 9e-05
d1deua_ 275 d.3.1.1 (A:) (Pro)cathepsin X {Human (Homo sapiens 1e-04
g8pch.1 228 d.3.1.1 (P:,A:) Cathepsin H {Pig (Sus scrofa) [Tax 2e-04
d1gmya_ 254 d.3.1.1 (A:) (Pro)cathepsin B {Human (Homo sapiens 0.001
g1k3b.1 233 d.3.1.1 (B:,C:) Cathepsin C (dipeptidyl peptidase 0.001
>d1xkga1 d.3.1.1 (A:4-305) Major mite fecal allergen der p 1 {House-dust mite (Dermatophagoides pteronyssinus) [TaxId: 6956]} Length = 302 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Cysteine proteinases
superfamily: Cysteine proteinases
family: Papain-like
domain: Major mite fecal allergen der p 1
species: House-dust mite (Dermatophagoides pteronyssinus) [TaxId: 6956]

 Score = 91.3 bits (225), Expect = 2e-23
 Identities = 23/112 (20%), Positives = 45/112 (40%), Gaps = 8/112 (7%)

Query: 51  TENNFKIFMQKYEKSYATREEYVHRLGIFAKNMIRAAEHQLLDPTAVHGVTPFSDLSEEE 110
           +   F+ + + + KSYAT E+       F +++     +          +   SDLS +E
Sbjct: 1   SIKTFEEYKKAFNKSYATFEDEEAARKNFLESVKYVQSNGG-------AINHLSDLSLDE 53

Query: 111 FESMYTGMKGGPPVMDSGGLESGSVKMMEIDG-FPENFDWREKGAVTEVKMQ 161
           F++ +         + +    +       I+G  P   D R+   VT ++MQ
Sbjct: 54  FKNRFLMSAEAFEHLKTQFDLNAETNACSINGNAPAEIDLRQMRTVTPIRMQ 105
>d1cs8a_ d.3.1.1 (A:) (Pro)cathepsin L {Human (Homo sapiens) [TaxId: 9606]} Length = 316 Back     information, alignment and structure
>d1yala_ d.3.1.1 (A:) Chymopapain {Papaya (Carica papaya) [TaxId: 3649]} Length = 218 Back     information, alignment and structure
>d1khqa_ d.3.1.1 (A:) Papain {Papaya (Carica papaya) [TaxId: 3649]} Length = 212 Back     information, alignment and structure
>d2h7ja1 d.3.1.1 (A:1-217) (Pro)cathepsin S {Human (Homo sapiens) [TaxId: 9606]} Length = 217 Back     information, alignment and structure
>d1o0ea_ d.3.1.1 (A:) Ervatamin C {East indian rosebay (Ervatamia coronaria) [TaxId: 52861]} Length = 208 Back     information, alignment and structure
>d1me4a_ d.3.1.1 (A:) Cruzain {Trypanosoma cruzi [TaxId: 5693]} Length = 215 Back     information, alignment and structure
>d1m6da_ d.3.1.1 (A:) Cathepsin F {Human (Homo sapiens) [TaxId: 9606]} Length = 214 Back     information, alignment and structure
>d1cqda_ d.3.1.1 (A:) Proline-specific cysteine protease {Ginger rhizome (Zingiber officinale) [TaxId: 94328]} Length = 216 Back     information, alignment and structure
>d2r6na1 d.3.1.1 (A:1-215) (Pro)cathepsin K {Human (Homo sapiens) [TaxId: 9606]} Length = 215 Back     information, alignment and structure
>d1ppoa_ d.3.1.1 (A:) Caricain (protease omega) {Papaya (Carica papaya) [TaxId: 3649]} Length = 216 Back     information, alignment and structure
>d1iwda_ d.3.1.1 (A:) Ervatamin B {Adam's apple (Ervatamia coronaria) [TaxId: 52861]} Length = 215 Back     information, alignment and structure
>d1fh0a_ d.3.1.1 (A:) (Pro)cathepsin V {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1aeca_ d.3.1.1 (A:) Actinidin {Chinese gooseberry or kiwifruit (Actinidia chinensis) [TaxId: 3625]} Length = 218 Back     information, alignment and structure
>d1s4va_ d.3.1.1 (A:) Vignain (bean endopeptidase) {Castor bean (Ricinus communis) [TaxId: 3988]} Length = 224 Back     information, alignment and structure
>d2oula1 d.3.1.1 (A:-16-224) Falcipain 2 {Plasmodium falciparum [TaxId: 5833]} Length = 241 Back     information, alignment and structure
>d1deua_ d.3.1.1 (A:) (Pro)cathepsin X {Human (Homo sapiens) [TaxId: 9606]} Length = 275 Back     information, alignment and structure
>d1gmya_ d.3.1.1 (A:) (Pro)cathepsin B {Human (Homo sapiens) [TaxId: 9606]} Length = 254 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query161
d1cs8a_ 316 (Pro)cathepsin L {Human (Homo sapiens) [TaxId: 960 99.93
d1xkga1 302 Major mite fecal allergen der p 1 {House-dust mite 99.89
>d1cs8a_ d.3.1.1 (A:) (Pro)cathepsin L {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Cysteine proteinases
superfamily: Cysteine proteinases
family: Papain-like
domain: (Pro)cathepsin L
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.93  E-value=1.2e-26  Score=188.03  Aligned_cols=105  Identities=26%  Similarity=0.380  Sum_probs=85.4

Q ss_pred             hHHHHHHHHHHHhCCCCCCHHHHHHHHHHHHHHHHHHHHhcCC----CCCeeeeeCcCCCCCHHHHHHHhcCCCCCCCCC
Q 037577           50 ATENNFKIFMQKYEKSYATREEYVHRLGIFAKNMIRAAEHQLL----DPTAVHGVTPFSDLSEEEFESMYTGMKGGPPVM  125 (161)
Q Consensus        50 ~~~~~f~~fk~k~~K~Y~s~~E~~~R~~iF~~N~~~I~~hN~~----~~sy~lgiN~FsDlT~eEf~~~~~g~~~~~~~~  125 (161)
                      +.+.+|++||++|+|.|.+ .|+.+|+.+|.+|+++|++||++    ..+|++|+|+|+|||.+||.+++++......  
T Consensus         7 ~l~~~F~~f~~~~~K~Y~~-~ee~~R~~iF~~N~~~I~~~N~~~~~~~~~~~~g~N~fsDlt~eEf~~~~~~~~~~~~--   83 (316)
T d1cs8a_           7 SLEAQWTKWKAMHNRLYGM-NEEGWRRAVWEKNMKMIELHNQEYREGKHSFTMAMNAFGDMTSEEFRQVMNGFQNRKP--   83 (316)
T ss_dssp             GGHHHHHHHHHHTTCCCCT-THHHHHHHHHHHHHHHHHHHHHHHHTTCCSEEECCCTTTTCCHHHHHHHHCCBCCCCC--
T ss_pred             HHHHHHHHHHHHhCCcCCC-HHHHHHHHHHHHHHHHHHHHHhHhhcCCCceEEeceeccccCcHHHHhhhcccccccc--
Confidence            4677999999999999987 57789999999999999999974    4589999999999999999998876544321  


Q ss_pred             CCCCCCCCcccccccCCCCCccccccCCCCCCCCCC
Q 037577          126 DSGGLESGSVKMMEIDGFPENFDWREKGAVTEVKMQ  161 (161)
Q Consensus       126 ~~~~~~~~~~~~~~~~~lP~s~DWR~kg~VtpVKnQ  161 (161)
                          ............++|++||||++|+|+|||||
T Consensus        84 ----~~~~~~~~~~~~~lP~s~Dwr~~g~vtpVkdQ  115 (316)
T d1cs8a_          84 ----RKGKVFQEPLFYEAPRSVDWREKGYVTPVKNQ  115 (316)
T ss_dssp             ----SCCEECCCCTTCCCCSCEEGGGGTCCCCCCBC
T ss_pred             ----ccCccccCcccccCCCceECCcCCcccccccC
Confidence                11111111234579999999999999999999
>d1xkga1 d.3.1.1 (A:4-305) Major mite fecal allergen der p 1 {House-dust mite (Dermatophagoides pteronyssinus) [TaxId: 6956]} Back     information, alignment and structure