Citrus Sinensis ID: 037641

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------21
MQTIAQFELQMRNNSDNLSKTGLVVREAVLEIYKRSSKCRILVCAPINRTGDVLMRSLKKKIPKSDMFRANAAFREVDGVPVDILPLCLYEGGECFQLPSLQELMRFRVIFSTFTSSFRLHNEGIPAGHFSHIFLLDASSATEPETMIALTNLANEHTTVILTGTPNNRTSWVRSDIARKNGLRVSHFERLHATKTYSNFNPMFITML
cccHHHHHcccccccccccHHHHHHHHHHHHHHHHcccccEEEEcccHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccHHHHccccEEEEEccccccccccccccccccEEEEccccccccHHHHHHHHHccccccEEEEEccccccccEEEcHHHHHccccccHHHHHHccccccccccccEEcc
ccHHHHHHHcccccccccccccHHHHHHHHHHHHHccccEEEEEccccHHHHHHHHHHHHHcccccEEEEEccccccccccHHHHHHHccccccccccccHHHHHcccEEEEEEcccccHHHcccccccEEEEEEEccccccccccEHHHHHccccccEEEEEcccHccccEEccHHHHHccccHHHHHHHHHccccccccccEEEcc
MQTIAQFELQMrnnsdnlsktGLVVREAVLEIYKRSSkcrilvcapinrtGDVLMRSLkkkipksdmfranaafrevdgvpvdilplclyeggecfqlpslqELMRFRVIFSTFTSsfrlhnegipaghfshiflldassatepETMIALTNLANEHTTViltgtpnnrtswvrsdiarknglrvsHFERlhatktysnfnPMFITML
MQTIAQfelqmrnnsdnlsktgLVVREAVLEIYkrsskcrilvcapinrtgdvlMRSLKkkipksdmFRANAAFREVDGVPVDILPLCLYEGGECFQLPSLQELMRFRVIFSTFTSSFRLHNEGIPAGHFSHIFLLDASSATEPETMIALTNLANEHttviltgtpnnrtswvrsdiarknglrvshferlhatktysnfnpMFITML
MQTIAQFELQMRNNSDNLSKTGLVVREAVLEIYKRSSKCRILVCAPINRTGDVLMRSLKKKIPKSDMFRANAAFREVDGVPVDILPLCLYEGGECFQLPSLQELMRFRVIFSTFTSSFRLHNEGIPAGHFSHIFLLDASSATEPETMIALTNLANEHTTVILTGTPNNRTSWVRSDIARKNGLRVSHFERLHATKTYSNFNPMFITML
********************TGLVVREAVLEIYKRSSKCRILVCAPINRTGDVLMRSLKKKIPKSDMFRANAAFREVDGVPVDILPLCLYEGGECFQLPSLQELMRFRVIFSTFTSSFRLHNEGIPAGHFSHIFLLDASSATEPETMIALTNLANEHTTVILTGTPNNRTSWVRSDIARKNGLRVSHFERLHATKTYSNFNPMFI***
**T**QFELQMRNNSDNLSKTGLVVREAVLEIYKRSSKCRILVCAPINRTGDVLMRSLKKKIPKSDMFRANAAFREVDGVPVDILPLCLYEGGECFQLPSLQELMRFRVIFSTFTSSFRLHNEGIPAGHFSHIFLLDASSATEPETMIALTNLANEHTTVILTGTPNNRTSWVRSDIARKNGLRVSHFERLHATKTYSNFNPMFITML
MQTIAQFELQMRNNSDNLSKTGLVVREAVLEIYKRSSKCRILVCAPINRTGDVLMRSLKKKIPKSDMFRANAAFREVDGVPVDILPLCLYEGGECFQLPSLQELMRFRVIFSTFTSSFRLHNEGIPAGHFSHIFLLDASSATEPETMIALTNLANEHTTVILTGTPNNRTSWVRSDIARKNGLRVSHFERLHATKTYSNFNPMFITML
*Q*IAQFELQMRNNSDNLSKTGLVVREAVLEIYKRSSKCRILVCAPINRTGDVLMRSLKKKIPKSDMFRANAAFREVDGVPVDILPLCLYEGGECFQLPSLQELMRFRVIFSTFTSSFRLHNEGIPAGHFSHIFLLDASSATEPETMIALTNLANEHTTVILTGTPNNRTSWVRSDIARKNGLRVSHFERLHATKTYSNFNPMFITML
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MQTIAQFELQMRNNSDNLSKTGLVVREAVLEIYKRSSKCRILVCAPINRTGDVLMRSLKKKIPKSDMFRANAAFREVDGVPVDILPLCLYEGGECFQLPSLQELMRFRVIFSTFTSSFRLHNEGIPAGHFSHIFLLDASSATEPETMIALTNLANEHTTVILTGTPNNRTSWVRSDIARKNGLRVSHFERLHATKTYSNFNPMFITML
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query208 2.2.26 [Sep-21-2011]
Q8GYD9 1002 Probable RNA helicase SDE yes no 0.889 0.184 0.336 1e-25
Q0V8H6 1003 Putative helicase MOV-10 yes no 0.870 0.180 0.335 6e-23
Q9HCE1 1003 Putative helicase MOV-10 yes no 0.865 0.179 0.328 8e-22
P23249 1004 Putative helicase MOV-10 yes no 0.865 0.179 0.333 1e-21
Q5ZKD7 967 Putative helicase MOV-10 yes no 0.875 0.188 0.301 2e-21
Q99MV5 1187 Putative helicase Mov10l1 no no 0.860 0.150 0.318 1e-19
Q1LXK4 1013 Putative helicase mov-10- yes no 0.889 0.182 0.314 1e-18
Q9BXT6 1211 Putative helicase Mov10l1 no no 0.860 0.147 0.313 3e-18
Q6J5K9 1274 Probable RNA helicase arm yes no 0.875 0.142 0.290 3e-15
Q1LXK5 1015 Putative helicase mov-10- no no 0.807 0.165 0.296 3e-14
>sp|Q8GYD9|SDE3_ARATH Probable RNA helicase SDE3 OS=Arabidopsis thaliana GN=SDE3 PE=1 SV=1 Back     alignment and function desciption
 Score =  116 bits (290), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 64/190 (33%), Positives = 104/190 (54%), Gaps = 5/190 (2%)

Query: 23  LVVREAVLEIYKRSSKCRILVCAPINRTGDVLMRSL----KKKIPKSDMFRANAAFREVD 78
           + + EA++++Y      R+LVCAP N   D ++  L      +I  +++FR NAA R  +
Sbjct: 429 MTLVEAIVQLYTTQRNARVLVCAPSNSAADHILEKLLCLEGVRIKDNEIFRLNAATRSYE 488

Query: 79  GVPVDILPLCLYEGGECFQLPSLQELMRFRVIFSTFTSSFRLHNEGIPAGHFSHIFLLDA 138
            +  +I+  C ++    F+ P L+ L R++++ ST+ S+  L+ EG+  GHF+HI L +A
Sbjct: 489 EIKPEIIRFCFFDE-LIFKCPPLKALTRYKLVVSTYMSASLLNAEGVNRGHFTHILLDEA 547

Query: 139 SSATEPETMIALTNLANEHTTVILTGTPNNRTSWVRSDIARKNGLRVSHFERLHATKTYS 198
             A+EPE MIA++NL    T V+L G P      + S  A   GL  S+ ERL     Y 
Sbjct: 548 GQASEPENMIAVSNLCLTETVVVLAGDPRQLGPVIYSRDAESLGLGKSYLERLFECDYYC 607

Query: 199 NFNPMFITML 208
             +  ++T L
Sbjct: 608 EGDENYVTKL 617
Probable RNA helicase required for post-transcriptional gene silencing (PTGS), a process that provides protection in plants against virus infection and can suppress expression of transgenes Plays a central role in RNA interference (RNAi) process, a process that mediates mRNA destruction of translational repression. Required for the assembly of the RISC complex, a complex required for target RNA destruction or repression. May be required in the RISC assembly to unwind miRNAs, in the production of single-stranded miRNA from the double-stranded miRNA, a key step in RISC formation.
Arabidopsis thaliana (taxid: 3702)
EC: 3EC: .EC: 6EC: .EC: 4EC: .EC: 1EC: 3
>sp|Q0V8H6|MOV10_BOVIN Putative helicase MOV-10 OS=Bos taurus GN=MOV10 PE=2 SV=1 Back     alignment and function description
>sp|Q9HCE1|MOV10_HUMAN Putative helicase MOV-10 OS=Homo sapiens GN=MOV10 PE=1 SV=2 Back     alignment and function description
>sp|P23249|MOV10_MOUSE Putative helicase MOV-10 OS=Mus musculus GN=Mov10 PE=1 SV=2 Back     alignment and function description
>sp|Q5ZKD7|MOV10_CHICK Putative helicase MOV-10 OS=Gallus gallus GN=MOV10 PE=2 SV=1 Back     alignment and function description
>sp|Q99MV5|M10L1_MOUSE Putative helicase Mov10l1 OS=Mus musculus GN=Mov10l1 PE=1 SV=1 Back     alignment and function description
>sp|Q1LXK4|M10B1_DANRE Putative helicase mov-10-B.1 OS=Danio rerio GN=mov10b.1 PE=2 SV=2 Back     alignment and function description
>sp|Q9BXT6|M10L1_HUMAN Putative helicase Mov10l1 OS=Homo sapiens GN=MOV10L1 PE=1 SV=1 Back     alignment and function description
>sp|Q6J5K9|ARMI_DROME Probable RNA helicase armi OS=Drosophila melanogaster GN=armi PE=2 SV=3 Back     alignment and function description
>sp|Q1LXK5|M10B2_DANRE Putative helicase mov-10-B.2 OS=Danio rerio GN=mov10b.2 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query208
224094027 687 predicted protein [Populus trichocarpa] 0.937 0.283 0.693 6e-74
224081336 773 predicted protein [Populus trichocarpa] 0.942 0.253 0.670 5e-71
255580302 710 conserved hypothetical protein [Ricinus 0.975 0.285 0.631 4e-70
255588520143 conserved hypothetical protein [Ricinus 0.677 0.986 0.654 6e-47
414864907 806 TPA: putative RNA helicase family protei 0.889 0.229 0.378 6e-30
414864908 967 TPA: putative RNA helicase family protei 0.889 0.191 0.378 7e-30
168029561 885 RNA helicase [Physcomitrella patens subs 0.836 0.196 0.4 1e-29
255552113 882 ATP-dependent helicase NAM7, putative [R 0.889 0.209 0.389 2e-29
242036863 968 hypothetical protein SORBIDRAFT_01g04643 0.889 0.191 0.368 5e-28
224112955 894 hypothetical protein POPTRDRAFT_789212 [ 0.889 0.206 0.368 6e-28
>gi|224094027|ref|XP_002310063.1| predicted protein [Populus trichocarpa] gi|222852966|gb|EEE90513.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  282 bits (721), Expect = 6e-74,   Method: Compositional matrix adjust.
 Identities = 136/196 (69%), Positives = 157/196 (80%), Gaps = 1/196 (0%)

Query: 13  NNSDNLSKTGLVVREAVLEIYKRSSKCRILVCAPINRTGDVLMRSLKKKIPKSDMFRANA 72
           N    LS+TGLV++EAVL+IY+ SSK RIL+CAPINRT D+LM+SL   IPKSDMFRANA
Sbjct: 474 NKFSELSRTGLVIQEAVLQIYQSSSKLRILICAPINRTCDLLMQSLNNDIPKSDMFRANA 533

Query: 73  AFREVDGVPVDILPLCLYEGGECFQLPSLQELMRFRVIFSTFTSSFRLHNEGIPAGHFSH 132
           AFRE+DGVP+DILP C Y+G ECF  PSLQEL +FRVI STF SSFRL NEGI AGHFSH
Sbjct: 534 AFREIDGVPIDILPSCAYKG-ECFTCPSLQELRKFRVILSTFVSSFRLRNEGIAAGHFSH 592

Query: 133 IFLLDASSATEPETMIALTNLANEHTTVILTGTPNNRTSWVRSDIARKNGLRVSHFERLH 192
           IFL+DASSATEPE M+ L NLA+E T VI+TG P N + WVRS+IARKNGL  S+FERL 
Sbjct: 593 IFLVDASSATEPEAMVPLANLASEETAVIVTGAPGNHSGWVRSNIARKNGLMTSYFERLR 652

Query: 193 ATKTYSNFNPMFITML 208
            +K Y +  P FIT L
Sbjct: 653 HSKPYRSLLPKFITQL 668

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224081336|ref|XP_002306375.1| predicted protein [Populus trichocarpa] gi|222855824|gb|EEE93371.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255580302|ref|XP_002530980.1| conserved hypothetical protein [Ricinus communis] gi|223529456|gb|EEF31415.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
>gi|255588520|ref|XP_002534630.1| conserved hypothetical protein [Ricinus communis] gi|223524876|gb|EEF27753.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
>gi|414864907|tpg|DAA43464.1| TPA: putative RNA helicase family protein [Zea mays] Back     alignment and taxonomy information
>gi|414864908|tpg|DAA43465.1| TPA: putative RNA helicase family protein [Zea mays] Back     alignment and taxonomy information
>gi|168029561|ref|XP_001767294.1| RNA helicase [Physcomitrella patens subsp. patens] gi|162681549|gb|EDQ67975.1| RNA helicase [Physcomitrella patens subsp. patens] Back     alignment and taxonomy information
>gi|255552113|ref|XP_002517101.1| ATP-dependent helicase NAM7, putative [Ricinus communis] gi|223543736|gb|EEF45264.1| ATP-dependent helicase NAM7, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|242036863|ref|XP_002465826.1| hypothetical protein SORBIDRAFT_01g046430 [Sorghum bicolor] gi|241919680|gb|EER92824.1| hypothetical protein SORBIDRAFT_01g046430 [Sorghum bicolor] Back     alignment and taxonomy information
>gi|224112955|ref|XP_002332671.1| hypothetical protein POPTRDRAFT_789212 [Populus trichocarpa] gi|222836465|gb|EEE74872.1| hypothetical protein POPTRDRAFT_789212 [Populus trichocarpa] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query208
TAIR|locus:2200996 1002 SDE3 "SILENCING DEFECTIVE" [Ar 0.899 0.186 0.347 3.2e-24
UNIPROTKB|J9P7Z9 983 MOV10 "Uncharacterized protein 0.894 0.189 0.346 2.4e-21
UNIPROTKB|F1P7T4 1003 MOV10 "Uncharacterized protein 0.894 0.185 0.346 2.5e-21
UNIPROTKB|Q0V8H6 1003 MOV10 "Putative helicase MOV-1 0.894 0.185 0.346 3.2e-21
UNIPROTKB|F1NNW1 735 MOV10 "Putative helicase MOV-1 0.903 0.255 0.315 1.7e-20
UNIPROTKB|Q9HCE1 1003 MOV10 "Putative helicase MOV-1 0.894 0.185 0.331 2.3e-20
MGI|MGI:97054 1004 Mov10 "Moloney leukemia virus 0.894 0.185 0.336 2.9e-20
UNIPROTKB|F1SBP9 1001 MOV10 "Uncharacterized protein 0.894 0.185 0.331 3.7e-20
UNIPROTKB|Q5ZKD7 967 MOV10 "Putative helicase MOV-1 0.903 0.194 0.315 7.3e-20
RGD|1598327 1004 Mov10 "Moloney leukemia virus 0.894 0.185 0.326 1.6e-19
TAIR|locus:2200996 SDE3 "SILENCING DEFECTIVE" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 289 (106.8 bits), Expect = 3.2e-24, P = 3.2e-24
 Identities = 67/193 (34%), Positives = 106/193 (54%)

Query:    20 KTGLVVREAVLEIYKRSSKCRILVCAPINRTGDVLMRSLK----KKIPKSDMFRANAAFR 75
             KT  +V EA++++Y      R+LVCAP N   D ++  L      +I  +++FR NAA R
Sbjct:   427 KTMTLV-EAIVQLYTTQRNARVLVCAPSNSAADHILEKLLCLEGVRIKDNEIFRLNAATR 485

Query:    76 EVDGVPVDILPLCLYEGGECFQLPSLQELMRFRVIFSTFTSSFRLHNEGIPAGHFSHIFL 135
               + +  +I+  C ++    F+ P L+ L R++++ ST+ S+  L+ EG+  GHF+HI L
Sbjct:   486 SYEEIKPEIIRFCFFDE-LIFKCPPLKALTRYKLVVSTYMSASLLNAEGVNRGHFTHILL 544

Query:   136 LDASSATEPETMIALTNLANEHTTVILTGTPNNRTSWVRSDIARKNGLRVSHFERLHATK 195
              +A  A+EPE MIA++NL    T V+L G P      + S  A   GL  S+ ERL    
Sbjct:   545 DEAGQASEPENMIAVSNLCLTETVVVLAGDPRQLGPVIYSRDAESLGLGKSYLERLFECD 604

Query:   196 TYSNFNPMFITML 208
              Y   +  ++T L
Sbjct:   605 YYCEGDENYVTKL 617
GO:0005737 "cytoplasm" evidence=ISM
GO:0003724 "RNA helicase activity" evidence=ISS
GO:0009616 "virus induced gene silencing" evidence=IMP
GO:0005515 "protein binding" evidence=IPI
GO:0035194 "posttranscriptional gene silencing by RNA" evidence=IMP
UNIPROTKB|J9P7Z9 MOV10 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1P7T4 MOV10 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q0V8H6 MOV10 "Putative helicase MOV-10" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1NNW1 MOV10 "Putative helicase MOV-10" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q9HCE1 MOV10 "Putative helicase MOV-10" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:97054 Mov10 "Moloney leukemia virus 10" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F1SBP9 MOV10 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|Q5ZKD7 MOV10 "Putative helicase MOV-10" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
RGD|1598327 Mov10 "Moloney leukemia virus 10" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
fgenesh4_pg.C_LG_VII000693
hypothetical protein (687 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query208
pfam13086220 pfam13086, AAA_11, AAA domain 6e-07
>gnl|CDD|221912 pfam13086, AAA_11, AAA domain Back     alignment and domain information 
 Score = 48.1 bits (115), Expect = 6e-07
 Identities = 38/188 (20%), Positives = 66/188 (35%), Gaps = 52/188 (27%)

Query: 20  KTGLVVREAVLEIYKRSSKCRILVCAPINRTGDVLMRSLKKKIPKSDMFRANAAFREVDG 79
           KT   + E + ++   +   ++LVCAP N   D ++  L ++     + R  +  RE   
Sbjct: 30  KTT-TIVEIIKQLLSNAPGKKVLVCAPSNSAVDNILERLLEQKFGLKIVRIGSPARE--- 85

Query: 80  VPVDILPLCLYEGGECFQLPSL-------------------------------------- 101
           +  D+L   L    E      L                                      
Sbjct: 86  IHEDVLQYSLEYLLEAKFEQLLKRIRKLKSLLEEKSKLKRERRKLRSEIKKLKKELERLR 145

Query: 102 -----QELMRFRVIFSTFTSSFRLHNEGIPAGHFSHIFLLDASSATEPETMIALTNLANE 156
                + L    V+ +T + +     EG+    F  + + +A+ ATEPET+I L  L  +
Sbjct: 146 KSIRKEILDEADVVCTTLSGAGSSLLEGLK--KFDVVIIDEAAQATEPETLIPLL-LGCK 202

Query: 157 HTTVILTG 164
              V+L G
Sbjct: 203 K--VVLVG 208

This family of domains contain a P-loop motif that is characteristic of the AAA superfamily. Many of the proteins in this family are conjugative transfer proteins. Length = 220

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 208
KOG1803 649 consensus DNA helicase [Replication, recombination 100.0
KOG1802 935 consensus RNA helicase nonsense mRNA reducing fact 100.0
KOG1805 1100 consensus DNA replication helicase [Replication, r 99.97
TIGR00376 637 DNA helicase, putative. The gene product may repre 99.96
PF13086236 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV 99.95
KOG1804 775 consensus RNA helicase [RNA processing and modific 99.9
COG1112 767 Superfamily I DNA and RNA helicases and helicase s 99.7
KOG1807 1025 consensus Helicases [Replication, recombination an 99.36
PF13604196 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL 99.23
KOG1801 827 consensus tRNA-splicing endonuclease positive effe 99.21
TIGR01447 586 recD exodeoxyribonuclease V, alpha subunit. This f 99.1
PRK10875 615 recD exonuclease V subunit alpha; Provisional 99.09
KOG1806 1320 consensus DEAD box containing helicases [Replicati 98.96
KOG1804 775 consensus RNA helicase [RNA processing and modific 98.86
TIGR02768 744 TraA_Ti Ti-type conjugative transfer relaxase TraA 98.65
TIGR01448 720 recD_rel helicase, putative, RecD/TraA family. Thi 98.59
PRK13889 988 conjugal transfer relaxase TraA; Provisional 98.58
PRK13826 1102 Dtr system oriT relaxase; Provisional 98.49
PRK14712 1623 conjugal transfer nickase/helicase TraI; Provision 98.26
PRK13709 1747 conjugal transfer nickase/helicase TraI; Provision 98.24
TIGR02760 1960 TraI_TIGR conjugative transfer relaxase protein Tr 98.08
TIGR02760 1960 TraI_TIGR conjugative transfer relaxase protein Tr 98.08
PF07652148 Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR 98.05
PF05970 364 PIF1: PIF1-like helicase; InterPro: IPR010285 This 98.03
cd00046144 DEXDc DEAD-like helicases superfamily. A diverse f 97.85
PF1324576 AAA_19: Part of AAA domain 97.41
PF01443234 Viral_helicase1: Viral (Superfamily 1) RNA helicas 97.2
smart00487201 DEXDc DEAD-like helicases superfamily. 97.09
PF00176299 SNF2_N: SNF2 family N-terminal domain; InterPro: I 96.81
KOG0385 971 consensus Chromatin remodeling complex WSTF-ISWI, 96.61
PLN03142 1033 Probable chromatin-remodeling complex ATPase chain 96.51
PRK04914 956 ATP-dependent helicase HepA; Validated 96.47
PRK10536262 hypothetical protein; Provisional 96.35
KOG0389 941 consensus SNF2 family DNA-dependent ATPase [Chroma 96.33
COG4096 875 HsdR Type I site-specific restriction-modification 96.33
COG4098 441 comFA Superfamily II DNA/RNA helicase required for 96.31
PF04851184 ResIII: Type III restriction enzyme, res subunit; 96.27
PHA02558 501 uvsW UvsW helicase; Provisional 96.14
cd00268203 DEADc DEAD-box helicases. A diverse family of prot 96.0
TIGR00603 732 rad25 DNA repair helicase rad25. All proteins in t 95.96
PHA03368 738 DNA packaging terminase subunit 1; Provisional 95.9
COG1111 542 MPH1 ERCC4-like helicases [DNA replication, recomb 95.83
PRK11664 812 ATP-dependent RNA helicase HrpB; Provisional 95.7
TIGR01970 819 DEAH_box_HrpB ATP-dependent helicase HrpB. This mo 95.56
PRK13766 773 Hef nuclease; Provisional 95.55
COG1061 442 SSL2 DNA or RNA helicases of superfamily II [Trans 95.48
PF00270169 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 95.46
PRK11448 1123 hsdR type I restriction enzyme EcoKI subunit R; Pr 95.45
KOG0387 923 consensus Transcription-coupled repair protein CSB 95.39
PF02562205 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH 94.88
PF09848 352 DUF2075: Uncharacterized conserved protein (DUF207 94.74
PRK10917 681 ATP-dependent DNA helicase RecG; Provisional 94.71
PF00580315 UvrD-helicase: UvrD/REP helicase N-terminal domain 94.5
TIGR00643 630 recG ATP-dependent DNA helicase RecG. 94.37
PHA03372 668 DNA packaging terminase subunit 1; Provisional 94.34
KOG1807 1025 consensus Helicases [Replication, recombination an 94.23
PHA03333 752 putative ATPase subunit of terminase; Provisional 93.82
TIGR00595 505 priA primosomal protein N'. All proteins in this f 93.79
COG1875436 NYN ribonuclease and ATPase of PhoH family domains 93.56
PF00580315 UvrD-helicase: UvrD/REP helicase N-terminal domain 93.47
PRK11192 434 ATP-dependent RNA helicase SrmB; Provisional 93.45
PF02399 824 Herpes_ori_bp: Origin of replication binding prote 93.42
TIGR00580 926 mfd transcription-repair coupling factor (mfd). Al 93.33
PRK11634 629 ATP-dependent RNA helicase DeaD; Provisional 92.92
PTZ00424 401 helicase 45; Provisional 92.84
COG0507 696 RecD ATP-dependent exoDNAse (exonuclease V), alpha 92.74
PRK05580 679 primosome assembly protein PriA; Validated 92.45
PRK10590 456 ATP-dependent RNA helicase RhlE; Provisional 92.4
PRK04837 423 ATP-dependent RNA helicase RhlB; Provisional 92.35
PRK09401 1176 reverse gyrase; Reviewed 92.29
PRK02362 737 ski2-like helicase; Provisional 92.05
COG3972 660 Superfamily I DNA and RNA helicases [General funct 91.75
TIGR01587 358 cas3_core CRISPR-associated helicase Cas3. This mo 91.73
PRK10689 1147 transcription-repair coupling factor; Provisional 91.53
PRK01172 674 ski2-like helicase; Provisional 90.68
PRK14873 665 primosome assembly protein PriA; Provisional 90.62
PRK11776 460 ATP-dependent RNA helicase DbpA; Provisional 90.61
KOG1002 791 consensus Nucleotide excision repair protein RAD16 90.55
TIGR00348 667 hsdR type I site-specific deoxyribonuclease, HsdR 90.33
TIGR00609 1087 recB exodeoxyribonuclease V, beta subunit. All pro 90.1
PRK04537 572 ATP-dependent RNA helicase RhlB; Provisional 90.09
TIGR00963 745 secA preprotein translocase, SecA subunit. The pro 90.05
PHA02533 534 17 large terminase protein; Provisional 90.0
COG1074 1139 RecB ATP-dependent exoDNAse (exonuclease V) beta s 89.85
PRK11054 684 helD DNA helicase IV; Provisional 89.65
TIGR01073 726 pcrA ATP-dependent DNA helicase PcrA. Designed to 89.39
TIGR01075 715 uvrD DNA helicase II. Designed to identify uvrD me 89.3
KOG0390 776 consensus DNA repair protein, SNF2 family [Replica 89.26
PRK10919 672 ATP-dependent DNA helicase Rep; Provisional 89.21
TIGR01054 1171 rgy reverse gyrase. Generally, these gyrases are e 88.99
TIGR03714 762 secA2 accessory Sec system translocase SecA2. Memb 88.87
PRK14701 1638 reverse gyrase; Provisional 88.82
TIGR01074 664 rep ATP-dependent DNA helicase Rep. Designed to id 88.51
PRK11773 721 uvrD DNA-dependent helicase II; Provisional 88.11
KOG0331 519 consensus ATP-dependent RNA helicase [RNA processi 87.91
COG1200 677 RecG RecG-like helicase [DNA replication, recombin 87.9
PRK12898 656 secA preprotein translocase subunit SecA; Reviewed 87.85
TIGR03817 742 DECH_helic helicase/secretion neighborhood putativ 87.22
PRK04296190 thymidine kinase; Provisional 86.96
PRK12899 970 secA preprotein translocase subunit SecA; Reviewed 86.87
PRK13104 896 secA preprotein translocase subunit SecA; Reviewed 86.59
PRK10919 672 ATP-dependent DNA helicase Rep; Provisional 86.25
TIGR01967 1283 DEAH_box_HrpA ATP-dependent helicase HrpA. This mo 86.24
PTZ00110 545 helicase; Provisional 85.97
PRK13709 1747 conjugal transfer nickase/helicase TraI; Provision 85.29
PRK09200 790 preprotein translocase subunit SecA; Reviewed 85.19
PRK11131 1294 ATP-dependent RNA helicase HrpA; Provisional 84.05
KOG0354 746 consensus DEAD-box like helicase [General function 83.44
PRK11054 684 helD DNA helicase IV; Provisional 82.37
PLN00206 518 DEAD-box ATP-dependent RNA helicase; Provisional 81.95
PRK10876 1181 recB exonuclease V subunit beta; Provisional 81.89
TIGR01075 715 uvrD DNA helicase II. Designed to identify uvrD me 81.77
COG1204 766 Superfamily II helicase [General function predicti 81.38
PRK01297 475 ATP-dependent RNA helicase RhlB; Provisional 81.18
TIGR02784 1141 addA_alphas double-strand break repair helicase Ad 80.75
PRK13909 910 putative recombination protein RecB; Provisional 80.41
PHA02653 675 RNA helicase NPH-II; Provisional 80.27
>KOG1803 consensus DNA helicase [Replication, recombination and repair] Back     alignment and domain information 
Probab=100.00  E-value=8.4e-36  Score=273.51  Aligned_cols=182  Identities=25%  Similarity=0.337  Sum_probs=138.9

Q ss_pred             hHHHHHHhhcccCCCCchh----HHHHHHHHHHHHcCCCCeEEEECCChHHHHHHHHHhhhhCCCCCeEEEeccccCCCC
Q 037641            4 IAQFELQMRNNSDNLSKTG----LVVREAVLEIYKRSSKCRILVCAPINRTGDVLMRSLKKKIPKSDMFRANAAFREVDG   79 (208)
Q Consensus         4 ~~~~~~~~~~~~~~~~~t~----~Tive~i~ql~~~~~~~rILV~A~SN~AvD~l~~rL~~~~~~~~i~Rv~~~~r~~~~   79 (208)
                      ..+|.+.-++.....|.+|    .|++|+|.|++++  ++|||||||||.||||+.+||.  ..+..++|+|.+.|.+++
T Consensus       193 Av~~~~~~k~l~~I~GPPGTGKT~TlvEiI~qlvk~--~k~VLVcaPSn~AVdNiverl~--~~~~~l~R~g~paRl~~~  268 (649)
T KOG1803|consen  193 AVSFAINNKDLLIIHGPPGTGKTRTLVEIISQLVKQ--KKRVLVCAPSNVAVDNIVERLT--HLKLNLVRVGHPARLLES  268 (649)
T ss_pred             HHHHHhccCCceEeeCCCCCCceeeHHHHHHHHHHc--CCeEEEEcCchHHHHHHHHHhc--ccccchhhcCchhhhhhh
Confidence            3456666666666666654    3899999999998  6899999999999999999998  356789999999887655


Q ss_pred             CCchhhc-cccccC------------------CCc---------cC--c-------c--h----HHHhccCcEEEEcccc
Q 037641           80 VPVDILP-LCLYEG------------------GEC---------FQ--L-------P--S----LQELMRFRVIFSTFTS  116 (208)
Q Consensus        80 ~~~~l~~-~~~~~~------------------~~~---------~~--~-------~--~----~~~l~~~~Vv~~T~~~  116 (208)
                      +.+.-.. ..+..+                  ...         ..  +       .  +    ++.+.+++||++|..+
T Consensus       269 ~~~~sld~~~~t~d~~~~~~~~sk~~d~~~~~~~~tk~~~~~~~~~~~i~~lrkdl~kre~~~v~eii~n~~VVfaTl~g  348 (649)
T KOG1803|consen  269 VADHSLDLLSNTKDNSQNAKDISKDIDILFQKNTKTKNDKLRKGIRKEIKLLRKDLRKRERKTVKEIISNSRVVFATLGG  348 (649)
T ss_pred             hhhhHHHHHHhcCchhhhhhhhHHHHHHHhhhhhcccchHHHHHHHHHHHHHHHHHHHHHHHHHHHhhcccceEEEeccc
Confidence            4221000 000000                  000         00  0       0  0    1336789999999999


Q ss_pred             cchhhcCCCCCCCCcEEEEecCCCCCchhhhHHHhhcccCCceEEEEcCCCCCCcceechHHhhCCCCccHHHHHHcCCC
Q 037641          117 SFRLHNEGIPAGHFSHIFLLDASSATEPETMIALTNLANEHTTVILTGTPNNRTSWVRSDIARKNGLRVSHFERLHATKT  196 (208)
Q Consensus       117 a~~l~~~~~~~~~Fd~vIIDEAsQa~Epe~liPL~~l~~~~~~vVLvGD~~QL~P~V~s~~a~~~gl~~SLfeRL~~~~~  196 (208)
                      |+..   ......||+||||||+||+||+||||+.    +.+++||+|||+||||+|.|+.|...||+.|+||||.+.+.
T Consensus       349 a~~~---~~~~~~fD~vIIDEaaQamE~~cWipvl----k~kk~ILaGDp~QLpP~v~S~~a~~~gl~~Sl~erlae~~~  421 (649)
T KOG1803|consen  349 ALDR---LLRKRTFDLVIIDEAAQAMEPQCWIPVL----KGKKFILAGDPKQLPPTVLSDKAKRGGLQVSLLERLAEKFG  421 (649)
T ss_pred             hhhh---hhcccCCCEEEEehhhhhccchhhhHHh----cCCceEEeCCcccCCcccccchhhhccchhhHHHHHHHHcc
Confidence            8752   2344579999999999999999999999    57899999999999999999999999999999999987654

>KOG1802 consensus RNA helicase nonsense mRNA reducing factor (pNORF1) [RNA processing and modification] Back     alignment and domain information
>KOG1805 consensus DNA replication helicase [Replication, recombination and repair] Back     alignment and domain information
>TIGR00376 DNA helicase, putative Back     alignment and domain information
>PF13086 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A Back     alignment and domain information
>KOG1804 consensus RNA helicase [RNA processing and modification] Back     alignment and domain information
>COG1112 Superfamily I DNA and RNA helicases and helicase subunits [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG1807 consensus Helicases [Replication, recombination and repair] Back     alignment and domain information
>PF13604 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A Back     alignment and domain information
>KOG1801 consensus tRNA-splicing endonuclease positive effector (SEN1) [RNA processing and modification] Back     alignment and domain information
>TIGR01447 recD exodeoxyribonuclease V, alpha subunit Back     alignment and domain information
>PRK10875 recD exonuclease V subunit alpha; Provisional Back     alignment and domain information
>KOG1806 consensus DEAD box containing helicases [Replication, recombination and repair] Back     alignment and domain information
>KOG1804 consensus RNA helicase [RNA processing and modification] Back     alignment and domain information
>TIGR02768 TraA_Ti Ti-type conjugative transfer relaxase TraA Back     alignment and domain information
>TIGR01448 recD_rel helicase, putative, RecD/TraA family Back     alignment and domain information
>PRK13889 conjugal transfer relaxase TraA; Provisional Back     alignment and domain information
>PRK13826 Dtr system oriT relaxase; Provisional Back     alignment and domain information
>PRK14712 conjugal transfer nickase/helicase TraI; Provisional Back     alignment and domain information
>PRK13709 conjugal transfer nickase/helicase TraI; Provisional Back     alignment and domain information
>TIGR02760 TraI_TIGR conjugative transfer relaxase protein TraI Back     alignment and domain information
>TIGR02760 TraI_TIGR conjugative transfer relaxase protein TraI Back     alignment and domain information
>PF07652 Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR011492 This is the Flavivirus DEAD domain Back     alignment and domain information
>PF05970 PIF1: PIF1-like helicase; InterPro: IPR010285 This entry represents PIF1 helicase and related proteins Back     alignment and domain information
>cd00046 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>PF13245 AAA_19: Part of AAA domain Back     alignment and domain information
>PF01443 Viral_helicase1: Viral (Superfamily 1) RNA helicase; InterPro: IPR000606 This entry includes RNA and DNA helicases Back     alignment and domain information
>smart00487 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>PF00176 SNF2_N: SNF2 family N-terminal domain; InterPro: IPR000330 This domain is found in proteins involved in a variety of processes including transcription regulation (e Back     alignment and domain information
>KOG0385 consensus Chromatin remodeling complex WSTF-ISWI, small subunit [Transcription] Back     alignment and domain information
>PLN03142 Probable chromatin-remodeling complex ATPase chain; Provisional Back     alignment and domain information
>PRK04914 ATP-dependent helicase HepA; Validated Back     alignment and domain information
>PRK10536 hypothetical protein; Provisional Back     alignment and domain information
>KOG0389 consensus SNF2 family DNA-dependent ATPase [Chromatin structure and dynamics] Back     alignment and domain information
>COG4096 HsdR Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms] Back     alignment and domain information
>COG4098 comFA Superfamily II DNA/RNA helicase required for DNA uptake (late competence protein) [DNA replication, recombination, and repair] Back     alignment and domain information
>PF04851 ResIII: Type III restriction enzyme, res subunit; InterPro: IPR006935 This entry represents a domain found in the N terminus of several proteins, including helicases, the R subunit (HsdR) of type I restriction endonucleases (3 Back     alignment and domain information
>PHA02558 uvsW UvsW helicase; Provisional Back     alignment and domain information
>cd00268 DEADc DEAD-box helicases Back     alignment and domain information
>TIGR00603 rad25 DNA repair helicase rad25 Back     alignment and domain information
>PHA03368 DNA packaging terminase subunit 1; Provisional Back     alignment and domain information
>COG1111 MPH1 ERCC4-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK11664 ATP-dependent RNA helicase HrpB; Provisional Back     alignment and domain information
>TIGR01970 DEAH_box_HrpB ATP-dependent helicase HrpB Back     alignment and domain information
>PRK13766 Hef nuclease; Provisional Back     alignment and domain information
>COG1061 SSL2 DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>PF00270 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 Members of this family include the DEAD and DEAH box helicases Back     alignment and domain information
>PRK11448 hsdR type I restriction enzyme EcoKI subunit R; Provisional Back     alignment and domain information
>KOG0387 consensus Transcription-coupled repair protein CSB/RAD26 (contains SNF2 family DNA-dependent ATPase domain) [Transcription; Replication, recombination and repair] Back     alignment and domain information
>PF02562 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH is a cytoplasmic protein and predicted ATPase that is induced by phosphate starvation and belongings to the phosphate regulon (pho) in Escherichia coli [] Back     alignment and domain information
>PF09848 DUF2075: Uncharacterized conserved protein (DUF2075); InterPro: IPR018647 This domain, found in putative ATP/GTP binding proteins, has no known function Back     alignment and domain information
>PRK10917 ATP-dependent DNA helicase RecG; Provisional Back     alignment and domain information
>PF00580 UvrD-helicase: UvrD/REP helicase N-terminal domain; InterPro: IPR000212 Members of this family are helicases that catalyse ATP dependent unwinding of double stranded DNA to single stranded DNA Back     alignment and domain information
>TIGR00643 recG ATP-dependent DNA helicase RecG Back     alignment and domain information
>PHA03372 DNA packaging terminase subunit 1; Provisional Back     alignment and domain information
>KOG1807 consensus Helicases [Replication, recombination and repair] Back     alignment and domain information
>PHA03333 putative ATPase subunit of terminase; Provisional Back     alignment and domain information
>TIGR00595 priA primosomal protein N' Back     alignment and domain information
>COG1875 NYN ribonuclease and ATPase of PhoH family domains [General function prediction only] Back     alignment and domain information
>PF00580 UvrD-helicase: UvrD/REP helicase N-terminal domain; InterPro: IPR000212 Members of this family are helicases that catalyse ATP dependent unwinding of double stranded DNA to single stranded DNA Back     alignment and domain information
>PRK11192 ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>PF02399 Herpes_ori_bp: Origin of replication binding protein; InterPro: IPR003450 This entry represents replication origin binding protein Back     alignment and domain information
>TIGR00580 mfd transcription-repair coupling factor (mfd) Back     alignment and domain information
>PRK11634 ATP-dependent RNA helicase DeaD; Provisional Back     alignment and domain information
>PTZ00424 helicase 45; Provisional Back     alignment and domain information
>COG0507 RecD ATP-dependent exoDNAse (exonuclease V), alpha subunit - helicase superfamily I member [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK05580 primosome assembly protein PriA; Validated Back     alignment and domain information
>PRK10590 ATP-dependent RNA helicase RhlE; Provisional Back     alignment and domain information
>PRK04837 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PRK09401 reverse gyrase; Reviewed Back     alignment and domain information
>PRK02362 ski2-like helicase; Provisional Back     alignment and domain information
>COG3972 Superfamily I DNA and RNA helicases [General function prediction only] Back     alignment and domain information
>TIGR01587 cas3_core CRISPR-associated helicase Cas3 Back     alignment and domain information
>PRK10689 transcription-repair coupling factor; Provisional Back     alignment and domain information
>PRK01172 ski2-like helicase; Provisional Back     alignment and domain information
>PRK14873 primosome assembly protein PriA; Provisional Back     alignment and domain information
>PRK11776 ATP-dependent RNA helicase DbpA; Provisional Back     alignment and domain information
>KOG1002 consensus Nucleotide excision repair protein RAD16 [Replication, recombination and repair] Back     alignment and domain information
>TIGR00348 hsdR type I site-specific deoxyribonuclease, HsdR family Back     alignment and domain information
>TIGR00609 recB exodeoxyribonuclease V, beta subunit Back     alignment and domain information
>PRK04537 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>TIGR00963 secA preprotein translocase, SecA subunit Back     alignment and domain information
>PHA02533 17 large terminase protein; Provisional Back     alignment and domain information
>COG1074 RecB ATP-dependent exoDNAse (exonuclease V) beta subunit (contains helicase and exonuclease domains) [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK11054 helD DNA helicase IV; Provisional Back     alignment and domain information
>TIGR01073 pcrA ATP-dependent DNA helicase PcrA Back     alignment and domain information
>TIGR01075 uvrD DNA helicase II Back     alignment and domain information
>KOG0390 consensus DNA repair protein, SNF2 family [Replication, recombination and repair] Back     alignment and domain information
>PRK10919 ATP-dependent DNA helicase Rep; Provisional Back     alignment and domain information
>TIGR01054 rgy reverse gyrase Back     alignment and domain information
>TIGR03714 secA2 accessory Sec system translocase SecA2 Back     alignment and domain information
>PRK14701 reverse gyrase; Provisional Back     alignment and domain information
>TIGR01074 rep ATP-dependent DNA helicase Rep Back     alignment and domain information
>PRK11773 uvrD DNA-dependent helicase II; Provisional Back     alignment and domain information
>KOG0331 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>COG1200 RecG RecG-like helicase [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>PRK12898 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>TIGR03817 DECH_helic helicase/secretion neighborhood putative DEAH-box helicase Back     alignment and domain information
>PRK04296 thymidine kinase; Provisional Back     alignment and domain information
>PRK12899 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK13104 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK10919 ATP-dependent DNA helicase Rep; Provisional Back     alignment and domain information
>TIGR01967 DEAH_box_HrpA ATP-dependent helicase HrpA Back     alignment and domain information
>PTZ00110 helicase; Provisional Back     alignment and domain information
>PRK13709 conjugal transfer nickase/helicase TraI; Provisional Back     alignment and domain information
>PRK09200 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK11131 ATP-dependent RNA helicase HrpA; Provisional Back     alignment and domain information
>KOG0354 consensus DEAD-box like helicase [General function prediction only] Back     alignment and domain information
>PRK11054 helD DNA helicase IV; Provisional Back     alignment and domain information
>PLN00206 DEAD-box ATP-dependent RNA helicase; Provisional Back     alignment and domain information
>PRK10876 recB exonuclease V subunit beta; Provisional Back     alignment and domain information
>TIGR01075 uvrD DNA helicase II Back     alignment and domain information
>COG1204 Superfamily II helicase [General function prediction only] Back     alignment and domain information
>PRK01297 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>TIGR02784 addA_alphas double-strand break repair helicase AddA, alphaproteobacterial type Back     alignment and domain information
>PRK13909 putative recombination protein RecB; Provisional Back     alignment and domain information
>PHA02653 RNA helicase NPH-II; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query208
2wjy_A 800 Regulator of nonsense transcripts 1; nonsense medi 8e-16
2gk6_A 624 Regulator of nonsense transcripts 1; UPF1, helicas 1e-15
2xzl_A 802 ATP-dependent helicase NAM7; hydrolase-RNA complex 3e-15
>2wjy_A Regulator of nonsense transcripts 1; nonsense mediated decay, zinc-finger, ATP-binding, metal-BIN UPF2, UPF1, helicase, hydrolase; 2.50A {Homo sapiens} PDB: 2wjv_A 2iyk_A Length = 800 Back     alignment and structure
 Score = 74.2 bits (182), Expect = 8e-16
 Identities = 47/190 (24%), Positives = 63/190 (33%), Gaps = 37/190 (19%)

Query: 38  KCRILVCAPINRTGDVLMRSLKKKIPKSDMFRANAAFREVDGVPVDILPLCLY------- 90
              +LVCAP N   D L   + +   K  + R  A  RE    PV  L L          
Sbjct: 400 NGPVLVCAPSNIAVDQLTEKIHQTGLK--VVRLCAKSREAIDSPVSFLALHNQIRNMDSM 457

Query: 91  -----------EGGEC-----------FQLPSLQELMRFRVIFSTFTSSFRLHNEGIPAG 128
                      E GE             +    + LM   VI  T   +    +  +   
Sbjct: 458 PELQKLQQLKDETGELSSADEKRYRALKRTAERELLMNADVICCTCVGAG---DPRLAKM 514

Query: 129 HFSHIFLLDASSATEPETMIALTNLANEHTTVILTGTPNNRTSWVRSDIARKNGLRVSHF 188
            F  I + +++ ATEPE M+ +   A     +IL G        V    A K GL  S F
Sbjct: 515 QFRSILIDESTQATEPECMVPVVLGAK---QLILVGDHCQLGPVVMCKKAAKAGLSQSLF 571

Query: 189 ERLHATKTYS 198
           ERL       
Sbjct: 572 ERLVVLGIRP 581
>2gk6_A Regulator of nonsense transcripts 1; UPF1, helicase, NMD, hydrolase; HET: ADP; 2.40A {Homo sapiens} PDB: 2gjk_A* 2gk7_A 2xzo_A* 2xzp_A Length = 624 Back     alignment and structure
>2xzl_A ATP-dependent helicase NAM7; hydrolase-RNA complex, NMD, RNA degradation, allosteric REGU; HET: ADP 1PE; 2.40A {Saccharomyces cerevisiae} Length = 802 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query208
4b3f_X 646 DNA-binding protein smubp-2; hydrolase, helicase; 99.97
2gk6_A 624 Regulator of nonsense transcripts 1; UPF1, helicas 99.94
2wjy_A 800 Regulator of nonsense transcripts 1; nonsense medi 99.92
2xzl_A 802 ATP-dependent helicase NAM7; hydrolase-RNA complex 99.91
1w36_D 608 RECD, exodeoxyribonuclease V alpha chain; recombin 99.29
3e1s_A 574 Exodeoxyribonuclease V, subunit RECD; alpha and be 98.89
3upu_A 459 ATP-dependent DNA helicase DDA; RECA-like domain, 98.83
3vkw_A 446 Replicase large subunit; alpha/beta domain, helica 98.51
3lfu_A 647 DNA helicase II; SF1 helicase, ATP-binding, DNA da 98.06
2gxq_A207 Heat resistant RNA dependent ATPase; RNA helicase, 97.5
1z63_A 500 Helicase of the SNF2/RAD54 hamily; protein-DNA com 97.18
3mwy_W 800 Chromo domain-containing protein 1; SWI2/SNF2 ATPa 97.17
1hv8_A 367 Putative ATP-dependent RNA helicase MJ0669; RNA-bi 97.06
1qde_A224 EIF4A, translation initiation factor 4A; DEAD box 97.04
1wp9_A 494 ATP-dependent RNA helicase, putative; ATPase, DNA 97.03
3b6e_A216 Interferon-induced helicase C domain-containing P; 96.98
3iuy_A228 Probable ATP-dependent RNA helicase DDX53; REC-A-l 96.98
2oxc_A230 Probable ATP-dependent RNA helicase DDX20; DEAD, s 96.95
1rif_A282 DAR protein, DNA helicase UVSW; bacteriophage, REC 96.91
2pl3_A236 Probable ATP-dependent RNA helicase DDX10; DEAD, s 96.9
1vec_A206 ATP-dependent RNA helicase P54; DEAD-box protein, 96.89
1z3i_X 644 Similar to RAD54-like; recombination ATPase helica 96.84
3ber_A249 Probable ATP-dependent RNA helicase DDX47; DEAD, A 96.83
3bor_A237 Human initiation factor 4A-II; translation initiat 96.75
1t6n_A220 Probable ATP-dependent RNA helicase; RECA-like fol 96.7
2fz4_A237 DNA repair protein RAD25; RECA-like domain, DNA da 96.67
3dkp_A245 Probable ATP-dependent RNA helicase DDX52; DEAD, A 96.64
3pey_A 395 ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A 96.59
1wrb_A253 DJVLGB; RNA helicase, DEAD BOX, VASA, structural g 96.56
4a2p_A 556 RIG-I, retinoic acid inducible protein I; hydrolas 96.53
3oiy_A 414 Reverse gyrase helicase domain; topoisomerase, DNA 96.49
1q0u_A219 Bstdead; DEAD protein, RNA binding protein; 1.85A 96.48
3h1t_A 590 Type I site-specific restriction-modification syst 96.43
3fho_A 508 ATP-dependent RNA helicase DBP5; mRNA export, ATPa 96.35
2z0m_A 337 337AA long hypothetical ATP-dependent RNA helicase 96.34
1s2m_A 400 Putative ATP-dependent RNA helicase DHH1; ATP-bind 96.34
1fuu_A 394 Yeast initiation factor 4A; IF4A, helicase, DEAD-b 96.32
3tbk_A 555 RIG-I helicase domain; DECH helicase, ATP binding, 96.31
1xti_A 391 Probable ATP-dependent RNA helicase P47; alpha-bet 96.21
2oca_A 510 DAR protein, ATP-dependent DNA helicase UVSW; ATP- 96.12
3fht_A 412 ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box 96.09
4a2q_A 797 RIG-I, retinoic acid inducible protein I; hydrolas 96.06
3eiq_A 414 Eukaryotic initiation factor 4A-I; PDCD4, anti-onc 95.97
3ly5_A262 ATP-dependent RNA helicase DDX18; alpha-beta, stru 95.87
2i4i_A 417 ATP-dependent RNA helicase DDX3X; DEAD, structural 95.74
2j0s_A 410 ATP-dependent RNA helicase DDX48; mRNA processing, 95.71
2ykg_A 696 Probable ATP-dependent RNA helicase DDX58; hydrola 95.7
2db3_A 434 ATP-dependent RNA helicase VASA; DEAD-BOX, protein 95.51
3dmq_A 968 RNA polymerase-associated protein RAPA; SWF2/SNF2, 95.45
4gl2_A 699 Interferon-induced helicase C domain-containing P; 95.37
3o8b_A 666 HCV NS3 protease/helicase; ntpase, RNA, translocat 95.37
3fe2_A242 Probable ATP-dependent RNA helicase DDX5; DEAD, AD 95.34
2fwr_A 472 DNA repair protein RAD25; DNA unwinding, XPB, DNA 95.22
4a2w_A 936 RIG-I, retinoic acid inducible protein I; hydrolas 95.13
2vl7_A 540 XPD; helicase, unknown function; 2.25A {Sulfolobus 95.07
3crv_A 551 XPD/RAD3 related DNA helicase; XPD helicase DNA re 94.99
2eyq_A 1151 TRCF, transcription-repair coupling factor; MFD, S 94.93
3fmo_B300 ATP-dependent RNA helicase DDX19B; nuclear porin, 94.57
3llm_A235 ATP-dependent RNA helicase A; alpha-beta-alpha, st 94.4
1gm5_A 780 RECG; helicase, replication restart; HET: DNA ADP; 94.37
3fmp_B 479 ATP-dependent RNA helicase DDX19B; nuclear porin, 94.34
2p6r_A 702 Afuhel308 helicase; protein-DNA complex, SF2 helic 94.24
1uaa_A 673 REP helicase, protein (ATP-dependent DNA helicase 94.06
2va8_A 715 SSO2462, SKI2-type helicase; hydrolase, DNA repair 93.44
4ddu_A 1104 Reverse gyrase; topoisomerase, DNA supercoiling, a 93.4
3l9o_A 1108 ATP-dependent RNA helicase DOB1; REC-A fold, winge 93.29
2zj8_A 720 DNA helicase, putative SKI2-type helicase; RECA fo 92.93
3sqw_A 579 ATP-dependent RNA helicase MSS116, mitochondrial; 92.93
2xgj_A 1010 ATP-dependent RNA helicase DOB1; hydrolase-RNA com 92.81
1pjr_A 724 PCRA; DNA repair, DNA replication, SOS response, h 92.73
4a4z_A 997 Antiviral helicase SKI2; hydrolase, ATPase, mRNA d 92.71
3i5x_A 563 ATP-dependent RNA helicase MSS116; protein-RNA com 92.7
1gku_B 1054 Reverse gyrase, TOP-RG; topoisomerase, DNA superco 92.28
2o0j_A385 Terminase, DNA packaging protein GP17; nucleotide- 91.81
4f92_B 1724 U5 small nuclear ribonucleoprotein 200 kDa helica; 90.67
2jlq_A 451 Serine protease subunit NS3; ribonucleoprotein, nu 89.52
2z83_A 459 Helicase/nucleoside triphosphatase; hydrolase, mem 88.77
1uaa_A 673 REP helicase, protein (ATP-dependent DNA helicase 88.71
2xau_A 773 PRE-mRNA-splicing factor ATP-dependent RNA helica; 88.68
3cpe_A 592 Terminase, DNA packaging protein GP17; large termi 87.85
2l8b_A189 Protein TRAI, DNA helicase I; RECD, hydrolase; NMR 87.44
3rc3_A 677 ATP-dependent RNA helicase SUPV3L1, mitochondrial; 86.51
1pjr_A 724 PCRA; DNA repair, DNA replication, SOS response, h 84.65
2whx_A 618 Serine protease/ntpase/helicase NS3; transcription 84.17
2w00_A 1038 HSDR, R.ECOR124I; ATP-binding, DNA-binding, restri 84.16
2b8t_A223 Thymidine kinase; deoxyribonucleoside kinase, zinc 84.01
2v6i_A 431 RNA helicase; membrane, hydrolase, transmembrane, 83.12
1tf5_A 844 Preprotein translocase SECA subunit; ATPase, helic 82.45
2orw_A184 Thymidine kinase; TMTK, TP4A, transferase; HET: 4T 80.77
2fsf_A 853 Preprotein translocase SECA subunit; ATPase, DNA-R 80.45
>4b3f_X DNA-binding protein smubp-2; hydrolase, helicase; 2.50A {Homo sapiens} PDB: 4b3g_A Back     alignment and structure
Probab=99.97  E-value=1.1e-31  Score=253.39  Aligned_cols=165  Identities=25%  Similarity=0.281  Sum_probs=125.5

Q ss_pred             CchhH--HHHHHHHHHHHcCCCCeEEEECCChHHHHHHHHHhhhhCCCCCeEEEeccccCCCCCCchhhcccccc-----
Q 037641           19 SKTGL--VVREAVLEIYKRSSKCRILVCAPINRTGDVLMRSLKKKIPKSDMFRANAAFREVDGVPVDILPLCLYE-----   91 (208)
Q Consensus        19 ~~t~~--Tive~i~ql~~~~~~~rILV~A~SN~AvD~l~~rL~~~~~~~~i~Rv~~~~r~~~~~~~~l~~~~~~~-----   91 (208)
                      .+|||  ||+++|.++++.  +.+||||||||.|||++++||.+.  +.+++|+|.+.|..    +.+..+++..     
T Consensus       214 PGTGKT~ti~~~I~~l~~~--~~~ILv~a~TN~AvD~i~erL~~~--~~~ilRlG~~~r~~----~~~~~~~l~~~~~~~  285 (646)
T 4b3f_X          214 PGTGKTTTVVEIILQAVKQ--GLKVLCCAPSNIAVDNLVERLALC--KQRILRLGHPARLL----ESIQQHSLDAVLARS  285 (646)
T ss_dssp             TTSCHHHHHHHHHHHHHHT--TCCEEEEESSHHHHHHHHHHHHHT--TCCEEECSCCSSCC----HHHHTTBHHHHHTTT
T ss_pred             CCCCHHHHHHHHHHHHHhC--CCeEEEEcCchHHHHHHHHHHHhc--CCceEEecchhhhh----hhhhhhhHHHHHhhc
Confidence            34665  689999999986  679999999999999999999863  56899999887632    2222111100     


Q ss_pred             ------------------C---------CCccCc---------------chHHHhccCcEEEEcccccchhhc-CCCCCC
Q 037641           92 ------------------G---------GECFQL---------------PSLQELMRFRVIFSTFTSSFRLHN-EGIPAG  128 (208)
Q Consensus        92 ------------------~---------~~~~~~---------------~~~~~l~~~~Vv~~T~~~a~~l~~-~~~~~~  128 (208)
                                        .         ...+..               ...+.+..++||++||.+++.... ..+...
T Consensus       286 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~l~~~~~~~~~~~l~~~~vv~~t~~~a~~~~~~~~~~~~  365 (646)
T 4b3f_X          286 DSAQIVADIRKDIDQVFVKNKKTQDKREKSNFRNEIKLLRKELKEREEAAMLESLTSANVVLATNTGASADGPLKLLPES  365 (646)
T ss_dssp             TCSSTHHHHHHHHTTSSTTTTC------CCSSHHHHHHHHHHHHHHHHHHHHHHHHHCSEEEEETTTTCSSSGGGGSCTT
T ss_pred             hHHHHHHHHHHHHHHHHHhhhhhhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhcceeeeehhhhhhhhHHHhhhhc
Confidence                              0         000000               001236789999999998875321 124556


Q ss_pred             CCcEEEEecCCCCCchhhhHHHhhcccCCceEEEEcCCCCCCcceechHHhhCCCCccHHHHHHcCC
Q 037641          129 HFSHIFLLDASSATEPETMIALTNLANEHTTVILTGTPNNRTSWVRSDIARKNGLRVSHFERLHATK  195 (208)
Q Consensus       129 ~Fd~vIIDEAsQa~Epe~liPL~~l~~~~~~vVLvGD~~QL~P~V~s~~a~~~gl~~SLfeRL~~~~  195 (208)
                      .||+||||||+|++||++|+||.    +++++||||||+||||+|.+..+...|++.|+||||.+.+
T Consensus       366 ~Fd~vIIDEAsQ~~e~~~lipL~----~~~~~ILVGD~~QLpP~v~~~~a~~~gl~~SlferL~~~~  428 (646)
T 4b3f_X          366 YFDVVVIDECAQALEASCWIPLL----KARKCILAGDHKQLPPTTVSHKAALAGLSLSLMERLAEEY  428 (646)
T ss_dssp             CCSEEEETTGGGSCHHHHTTTGG----GSSEEEEEECTTSCCCCCSCHHHHHTTTTCCHHHHHHHHH
T ss_pred             cCCEEEEcCccccchHHHHhhcc----ccceEEEcCCccccCceecchhhhhccccchHHHHHHHhc
Confidence            89999999999999999999998    4689999999999999999999999999999999998653
>2gk6_A Regulator of nonsense transcripts 1; UPF1, helicase, NMD, hydrolase; HET: ADP; 2.40A {Homo sapiens} PDB: 2gjk_A* 2gk7_A 2xzo_A* 2xzp_A Back     alignment and structure
>2wjy_A Regulator of nonsense transcripts 1; nonsense mediated decay, zinc-finger, ATP-binding, metal-BIN UPF2, UPF1, helicase, hydrolase; 2.50A {Homo sapiens} PDB: 2wjv_A 2iyk_A Back     alignment and structure
>2xzl_A ATP-dependent helicase NAM7; hydrolase-RNA complex, NMD, RNA degradation, allosteric REGU; HET: ADP 1PE; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1w36_D RECD, exodeoxyribonuclease V alpha chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 PDB: 3k70_D* Back     alignment and structure
>3e1s_A Exodeoxyribonuclease V, subunit RECD; alpha and beta protein, ATP-binding, nucleotide-binding, HYD; 2.20A {Deinococcus radiodurans} PDB: 3gp8_A 3gpl_A* Back     alignment and structure
>3upu_A ATP-dependent DNA helicase DDA; RECA-like domain, SH3 domain, PIN-tower interface, coupling hydrolysis to DNA unwinding, ssDNA; 3.30A {Enterobacteria phage T4} Back     alignment and structure
>3vkw_A Replicase large subunit; alpha/beta domain, helicase, transferase; 1.90A {Tomato mosaic virus} Back     alignment and structure
>3lfu_A DNA helicase II; SF1 helicase, ATP-binding, DNA damage, DNA REP replication, DNA-binding, hydrolase, nucleotide-B SOS response; HET: DNA; 1.80A {Escherichia coli} PDB: 2is6_A* 2is2_A* 2is1_A* 2is4_A* Back     alignment and structure
>2gxq_A Heat resistant RNA dependent ATPase; RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, hydrolase; HET: AMP; 1.20A {Thermus thermophilus HB27} PDB: 2gxs_A* 2gxu_A 3mwj_A 3mwk_A* 3mwl_A* 3nbf_A* 3nej_A Back     alignment and structure
>1z63_A Helicase of the SNF2/RAD54 hamily; protein-DNA complex, hydrolase/DNA complex complex; 3.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 c.37.1.19 PDB: 1z6a_A Back     alignment and structure
>3mwy_W Chromo domain-containing protein 1; SWI2/SNF2 ATPase, double chromodomains, hydrolase; HET: ATG; 3.70A {Saccharomyces cerevisiae} Back     alignment and structure
>1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A Back     alignment and structure
>1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>3b6e_A Interferon-induced helicase C domain-containing P; DECH, DEXD/H RNA-binding helicase, innate immunity, IFIH1, S genomics; 1.60A {Homo sapiens} Back     alignment and structure
>3iuy_A Probable ATP-dependent RNA helicase DDX53; REC-A-like, DEAD-BOX, structural genomics, structural genomi consortium, SGC, ATP-binding, hydrolase; HET: AMP; 2.40A {Homo sapiens} Back     alignment and structure
>2oxc_A Probable ATP-dependent RNA helicase DDX20; DEAD, structural genomics, structural genomics consortium, SGC, hydrolase; HET: ADP; 1.30A {Homo sapiens} PDB: 3b7g_A* Back     alignment and structure
>1rif_A DAR protein, DNA helicase UVSW; bacteriophage, RECG, SF2, DNA binding protein; HET: DNA; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.23 Back     alignment and structure
>2pl3_A Probable ATP-dependent RNA helicase DDX10; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; HET: ADP; 2.15A {Homo sapiens} Back     alignment and structure
>1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>1z3i_X Similar to RAD54-like; recombination ATPase helicase, recombination-DNA binding COM; 3.00A {Danio rerio} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>3ber_A Probable ATP-dependent RNA helicase DDX47; DEAD, AMP, structural genomics, structural GEN consortium, SGC, ATP-binding, hydrolase; HET: AMP PGE; 1.40A {Homo sapiens} Back     alignment and structure
>3bor_A Human initiation factor 4A-II; translation initiation, DEAD BOX, structural genomics, helic binding, HOST-virus interaction, hydrolase; 1.85A {Homo sapiens} PDB: 2g9n_A* Back     alignment and structure
>1t6n_A Probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; HET: FLC; 1.94A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>2fz4_A DNA repair protein RAD25; RECA-like domain, DNA damage recognition domain, DNA binding; HET: DNA; 2.40A {Archaeoglobus fulgidus} SCOP: c.37.1.19 Back     alignment and structure
>3dkp_A Probable ATP-dependent RNA helicase DDX52; DEAD, ADP, structural genomics, structural GEN consortium, SGC, rRNA, ATP-binding, hydrolase; HET: ADP; 2.10A {Homo sapiens} Back     alignment and structure
>3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* Back     alignment and structure
>1wrb_A DJVLGB; RNA helicase, DEAD BOX, VASA, structural genomics, NPPSFA, N project on protein structural and functional analyses; 2.40A {Dugesia japonica} SCOP: c.37.1.19 Back     alignment and structure
>4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A* Back     alignment and structure
>3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* Back     alignment and structure
>1q0u_A Bstdead; DEAD protein, RNA binding protein; 1.85A {Geobacillus stearothermophilus} SCOP: c.37.1.19 Back     alignment and structure
>3h1t_A Type I site-specific restriction-modification system, R (restriction) subunit; hydrolase, restriction enzyme HSDR, ATP-binding; 2.30A {Vibrio vulnificus} Back     alignment and structure
>2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A Back     alignment and structure
>1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* Back     alignment and structure
>3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} Back     alignment and structure
>1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A Back     alignment and structure
>2oca_A DAR protein, ATP-dependent DNA helicase UVSW; ATP-dependant helicase, T4-bacteriophage, recombination, hydrolase; 2.70A {Enterobacteria phage T4} Back     alignment and structure
>3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B Back     alignment and structure
>4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos} Back     alignment and structure
>3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} Back     alignment and structure
>3ly5_A ATP-dependent RNA helicase DDX18; alpha-beta, structural genomics, structural genomics consort ATP-binding, hydrolase, nucleotide-binding, RNA-B; 2.80A {Homo sapiens} Back     alignment and structure
>2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} Back     alignment and structure
>2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A Back     alignment and structure
>2ykg_A Probable ATP-dependent RNA helicase DDX58; hydrolase, innate immunity; 2.50A {Homo sapiens} PDB: 3tmi_A* Back     alignment and structure
>2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} Back     alignment and structure
>3dmq_A RNA polymerase-associated protein RAPA; SWF2/SNF2, transcription factor, RNA polymerase recycling, activator, ATP-binding, DNA-binding; 3.20A {Escherichia coli K12} Back     alignment and structure
>4gl2_A Interferon-induced helicase C domain-containing P; MDA5, dsRNA, anti-viral signaling, RIG-I, MAVS, oligomerizat helicase, ATPase; HET: ANP; 3.56A {Homo sapiens} Back     alignment and structure
>3o8b_A HCV NS3 protease/helicase; ntpase, RNA, translocation, protein-RNA compl protease/ntpase/helicase, hydrolase; 1.95A {Hepatitis c virus} PDB: 3o8c_A* 3o8d_A* 3o8r_A* 4b71_A* 4b73_A* 4b74_A* 4b76_A* 4b75_A* 4a92_A* 1cu1_A 4b6e_A* 4b6f_A* 2zjo_A* 1a1v_A* 1hei_A 3kqn_A* 3kql_A* 3kqu_A* 3kqh_A 3kqk_A ... Back     alignment and structure
>3fe2_A Probable ATP-dependent RNA helicase DDX5; DEAD, ADP, ATP-binding, hydrolase, nucleotide- RNA-binding, methylation, mRNA processing, mRNA S nucleus; HET: ADP; 2.60A {Homo sapiens} PDB: 4a4d_A Back     alignment and structure
>2fwr_A DNA repair protein RAD25; DNA unwinding, XPB, DNA binding protein; HET: DNA; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.19 c.37.1.19 PDB: 2fzl_A* Back     alignment and structure
>4a2w_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.70A {Anas platyrhynchos} Back     alignment and structure
>2vl7_A XPD; helicase, unknown function; 2.25A {Sulfolobus tokodaii} Back     alignment and structure
>3crv_A XPD/RAD3 related DNA helicase; XPD helicase DNA repair cancer aging, hydrolase; HET: FLC; 2.00A {Sulfolobus acidocaldarius} PDB: 3crw_1* Back     alignment and structure
>2eyq_A TRCF, transcription-repair coupling factor; MFD, SF2 ATPase, hydrolase; HET: EPE; 3.20A {Escherichia coli} SCOP: b.34.18.1 c.37.1.19 c.37.1.19 c.37.1.19 c.37.1.19 d.315.1.1 Back     alignment and structure
>3fmo_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 2.51A {Homo sapiens} Back     alignment and structure
>3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens} Back     alignment and structure
>1gm5_A RECG; helicase, replication restart; HET: DNA ADP; 3.24A {Thermotoga maritima} SCOP: a.24.21.1 b.40.4.9 c.37.1.19 c.37.1.19 Back     alignment and structure
>3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} Back     alignment and structure
>2p6r_A Afuhel308 helicase; protein-DNA complex, SF2 helicase, archaeal helicase, DNA repair,, DNA binding protein/DNA complex; 3.00A {Archaeoglobus fulgidus} SCOP: a.4.5.43 a.289.1.2 c.37.1.19 c.37.1.19 PDB: 2p6u_A Back     alignment and structure
>1uaa_A REP helicase, protein (ATP-dependent DNA helicase REP.); complex (helicase/DNA), DNA unwinding, hydrolase/DNA complex; HET: DNA; 3.00A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-bindin nucleotide-binding; 2.30A {Sulfolobus solfataricus} Back     alignment and structure
>4ddu_A Reverse gyrase; topoisomerase, DNA supercoiling, archaea, helicase, hydrolas; 3.00A {Thermotoga maritima} PDB: 4ddt_A 4ddv_A 4ddw_A 4ddx_A Back     alignment and structure
>3l9o_A ATP-dependent RNA helicase DOB1; REC-A fold, winged-helix-turn-helix, antiparallel-coiled-COI domain, ATP-binding, helicase, hydrolase; 3.39A {Saccharomyces cerevisiae} Back     alignment and structure
>2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A* Back     alignment and structure
>3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2xgj_A ATP-dependent RNA helicase DOB1; hydrolase-RNA complex, hydrolase, tramp, exosome, DEAD, nucleotide-binding; HET: ADP; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>1pjr_A PCRA; DNA repair, DNA replication, SOS response, helicase, ATP- binding, DNA-binding; 2.50A {Geobacillus stearothermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1qhg_A* 3pjr_A* 2pjr_A* 1qhh_B* 1qhh_D* 1qhh_A* 1qhh_C* 2pjr_B* Back     alignment and structure
>4a4z_A Antiviral helicase SKI2; hydrolase, ATPase, mRNA degradation, exosome; HET: ANP; 2.40A {Saccharomyces cerevisiae} PDB: 4a4k_A Back     alignment and structure
>3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* 4db2_A 4db4_A Back     alignment and structure
>1gku_B Reverse gyrase, TOP-RG; topoisomerase, DNA supercoiling, archaea, helicase; 2.7A {Archaeoglobus fulgidus} SCOP: c.37.1.16 c.37.1.16 e.10.1.1 PDB: 1gl9_B* Back     alignment and structure
>2o0j_A Terminase, DNA packaging protein GP17; nucleotide-binding fold, hydrolase; HET: DNA ADP; 1.80A {Enterobacteria phage T4} PDB: 2o0h_A* 2o0k_A* Back     alignment and structure
>4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B Back     alignment and structure
>2jlq_A Serine protease subunit NS3; ribonucleoprotein, nucleotide-binding, viral nucleoprotein, endoplasmic reticulum, helicase, hydrolase; 1.67A {Dengue virus 4} PDB: 2jly_A* 2jls_A* 2jlu_A 2jlv_A* 2jlw_A 2jlx_A* 2jlz_A* 2jlr_A* 2bmf_A 2bhr_A Back     alignment and structure
>2z83_A Helicase/nucleoside triphosphatase; hydrolase, membrane, nucleotide-binding, RNA replication, transmembrane, viral protein; 1.80A {Japanese encephalitis virus} PDB: 2v8o_A 2qeq_A Back     alignment and structure
>1uaa_A REP helicase, protein (ATP-dependent DNA helicase REP.); complex (helicase/DNA), DNA unwinding, hydrolase/DNA complex; HET: DNA; 3.00A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* Back     alignment and structure
>3cpe_A Terminase, DNA packaging protein GP17; large terminase, alternative initiation, ATP-binding, DNA- binding, hydrolase, nuclease; HET: DNA; 2.80A {Bacteriophage T4} PDB: 3ezk_A* Back     alignment and structure
>2l8b_A Protein TRAI, DNA helicase I; RECD, hydrolase; NMR {Escherichia coli} Back     alignment and structure
>3rc3_A ATP-dependent RNA helicase SUPV3L1, mitochondrial; SUV3, nucleus, hydrolase; HET: ANP; 2.08A {Homo sapiens} PDB: 3rc8_A Back     alignment and structure
>1pjr_A PCRA; DNA repair, DNA replication, SOS response, helicase, ATP- binding, DNA-binding; 2.50A {Geobacillus stearothermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1qhg_A* 3pjr_A* 2pjr_A* 1qhh_B* 1qhh_D* 1qhh_A* 1qhh_C* 2pjr_B* Back     alignment and structure
>2whx_A Serine protease/ntpase/helicase NS3; transcription, hydrolase, ATP-binding, reticulum, nucleotidyltransferase, multifunctional enzyme; HET: ADP; 2.20A {Dengue virus 4} PDB: 2vbc_A 2wzq_A Back     alignment and structure
>2w00_A HSDR, R.ECOR124I; ATP-binding, DNA-binding, restriction system, helicase, HYDR R.ECOR124I, nucleotide-binding; HET: ATP; 2.6A {Escherichia coli} PDB: 2y3t_A* 2w74_B* Back     alignment and structure
>2b8t_A Thymidine kinase; deoxyribonucleoside kinase, zinc-binding domain, TK1, UU-TK, transferase; HET: THM; 2.00A {Ureaplasma parvum} SCOP: c.37.1.24 g.39.1.14 PDB: 2uz3_A* Back     alignment and structure
>2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A Back     alignment and structure
>1tf5_A Preprotein translocase SECA subunit; ATPase, helicase, translocation, secretion, protein transport; 2.18A {Bacillus subtilis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1tf2_A 3iqy_A 1m6n_A 1m74_A* 3iqm_A 3jv2_A* 2ibm_A* 3dl8_A 1sx0_A 1sx1_A 1tm6_A Back     alignment and structure
>2orw_A Thymidine kinase; TMTK, TP4A, transferase; HET: 4TA; 1.50A {Thermotoga maritima} PDB: 2qpo_A 2qq0_A* 2qqe_A* Back     alignment and structure
>2fsf_A Preprotein translocase SECA subunit; ATPase, DNA-RNA helicase, protein translocation, protein transport; 2.00A {Escherichia coli} PDB: 2fsg_A* 2fsh_A* 2fsi_A* 2vda_A 3bxz_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query208
d1w36d1359 Exodeoxyribonuclease V alpha chain (RecD) {Escheri 99.56
d1gkub1237 Helicase-like "domain" of reverse gyrase {Archaeon 97.68
d1a1va1136 HCV helicase domain {Human hepatitis C virus (HCV) 97.31
d1z63a1230 Helicase of the SNF2/Rad54 hamily {Sulfolobus solf 97.14
d1yksa1140 YFV helicase domain {Yellow fever virus [TaxId: 11 96.86
d1z3ix2298 Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxI 96.81
d1wp9a1200 putative ATP-dependent RNA helicase PF2015 {Pyroco 96.7
d2bmfa2 305 Dengue virus helicase {Dengue virus type 2 [TaxId: 96.69
d1rifa_282 DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665] 96.59
d2fz4a1206 DNA repair protein RAD25 {Archaeoglobus fulgidus [ 96.41
d1uaaa1306 DEXX box DNA helicase {Escherichia coli, RepD [Tax 96.04
d1hv8a1208 Putative DEAD box RNA helicase {Archaeon Methanoco 96.01
d1uaaa1306 DEXX box DNA helicase {Escherichia coli, RepD [Tax 95.81
d2p6ra3202 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 95.47
d1qdea_212 Initiation factor 4a {Baker's yeast (Saccharomyces 95.21
d2eyqa3233 Transcription-repair coupling factor, TRCF {Escher 93.83
d1pjra1318 DEXX box DNA helicase {Bacillus stearothermophilus 93.76
d1gm5a3264 RecG helicase domain {Thermotoga maritima [TaxId: 93.52
d1pjra1318 DEXX box DNA helicase {Bacillus stearothermophilus 93.44
d2g9na1218 Initiation factor 4a {Human (Homo sapiens) [TaxId: 93.09
d1t6na_207 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 92.83
d1w36b1 485 Exodeoxyribonuclease V beta chain (RecB), N-termin 92.01
g1qhh.1 623 DEXX box DNA helicase {Bacillus stearothermophilus 91.62
d1wrba1238 putative ATP-dependent RNA helicase VlgB {Flatworm 91.4
d1veca_206 DEAD box RNA helicase rck/p54 {Human (Homo sapiens 91.27
d2j0sa1222 Probable ATP-dependent RNA helicase DDX48 {Human ( 90.12
d1s2ma1206 Putative ATP-dependent RNA helicase DHH1 {Baker's 89.28
g1qhh.1 623 DEXX box DNA helicase {Bacillus stearothermophilus 83.71
d1w36b1485 Exodeoxyribonuclease V beta chain (RecB), N-termin 81.22
d1oywa2206 RecQ helicase domain {Escherichia coli [TaxId: 562 81.07
>d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Tandem AAA-ATPase domain
domain: Exodeoxyribonuclease V alpha chain (RecD)
species: Escherichia coli [TaxId: 562]

Probab=99.56  E-value=6.1e-15  Score=128.44  Aligned_cols=147  Identities=22%  Similarity=0.289  Sum_probs=80.8

Q ss_pred             chhHH--HHHHHHHHHHc--CCCCeEEEECCChHHHHHHHHHhhhhCCCCCeEEEeccccCCCCCCchhhccccccCCCc
Q 037641           20 KTGLV--VREAVLEIYKR--SSKCRILVCAPINRTGDVLMRSLKKKIPKSDMFRANAAFREVDGVPVDILPLCLYEGGEC   95 (208)
Q Consensus        20 ~t~~T--ive~i~ql~~~--~~~~rILV~A~SN~AvD~l~~rL~~~~~~~~i~Rv~~~~r~~~~~~~~l~~~~~~~~~~~   95 (208)
                      +||||  +++++..+.+.  .++.+|++|||||.|++++.+++.......     ..........+.......       
T Consensus       173 GTGKTt~i~~~l~~l~~~~~~~~~~I~l~ApTgkAA~~L~e~~~~~~~~~-----~~~~~~~~~~~~~~~t~~-------  240 (359)
T d1w36d1         173 GTGKTTTVAKLLAALIQMADGERCRIRLAAPTGKAAARLTESLGKALRQL-----PLTDEQKKRIPEDASTLH-------  240 (359)
T ss_dssp             TSTHHHHHHHHHHHHHHTCSSCCCCEEEEBSSHHHHHHHHHHHTHHHHHS-----SCCSCCCCSCSCCCBTTT-------
T ss_pred             CCCceehHHHHHHHHHHHHhccCCeEEEecCcHHHHHHHHHHHHHHHhhc-----CchhhhhhhhhhhhhHHH-------
Confidence            46653  44555555543  457899999999999999999886531100     000000000000000000       


Q ss_pred             cCcchHHHhccCcEEEEcccccchhhcCCCCCCCCcEEEEecCCCCCchhhhHHHhhcccCCceEEEEcCCCCCCccee-
Q 037641           96 FQLPSLQELMRFRVIFSTFTSSFRLHNEGIPAGHFSHIFLLDASSATEPETMIALTNLANEHTTVILTGTPNNRTSWVR-  174 (208)
Q Consensus        96 ~~~~~~~~l~~~~Vv~~T~~~a~~l~~~~~~~~~Fd~vIIDEAsQa~Epe~liPL~~l~~~~~~vVLvGD~~QL~P~V~-  174 (208)
                                  +....+.. ...+.........||++|||||||++++.....+..+ ....++||+|||+|||||-. 
T Consensus       241 ------------~ll~~~~~-~~~~~~~~~~~l~~d~lIIDEaSmv~~~l~~~ll~~~-~~~~~lILvGD~~QLppV~~G  306 (359)
T d1w36d1         241 ------------RLLGAQPG-SQRLRHHAGNPLHLDVLVVDEASMIDLPMMSRLIDAL-PDHARVIFLGDRDQLASVEAG  306 (359)
T ss_dssp             ------------SCC------------CTTSCCSCSEEEECSGGGCBHHHHHHHHHTC-CTTCEEEEEECTTSGGGTSTT
T ss_pred             ------------HHHhhhhc-chHHHHhhhcccccceeeehhhhccCHHHHHHHHHHh-cCCCEEEEECChhhccCCCCC
Confidence                        00000000 0011111112347999999999999998876666644 45789999999999999844 


Q ss_pred             ---chHHh--hCCCCccHHHHHH
Q 037641          175 ---SDIAR--KNGLRVSHFERLH  192 (208)
Q Consensus       175 ---s~~a~--~~gl~~SLfeRL~  192 (208)
                         .+...  ..+++.+..++|.
T Consensus       307 ~vl~dl~~~~~~~~~~~~~~~l~  329 (359)
T d1w36d1         307 AVLGDICAYANAGFTAERARQLS  329 (359)
T ss_dssp             BCHHHHGGGGTTCCCHHHHHHHH
T ss_pred             cHHHHHHHHHhcCCCHHHHHHHH
Confidence               33322  3456655545444
>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1z63a1 c.37.1.19 (A:432-661) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d1z3ix2 c.37.1.19 (X:92-389) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} Back     information, alignment and structure
>d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Back     information, alignment and structure
>d1rifa_ c.37.1.23 (A:) DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} Back     information, alignment and structure
>d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} Back     information, alignment and structure
>d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} Back     information, alignment and structure
>d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} Back     information, alignment and structure
>d2g9na1 c.37.1.19 (A:21-238) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w36b1 c.37.1.19 (B:1-485) Exodeoxyribonuclease V beta chain (RecB), N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wrba1 c.37.1.19 (A:164-401) putative ATP-dependent RNA helicase VlgB {Flatworm (Dugesia japonica) [TaxId: 6161]} Back     information, alignment and structure
>d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s2ma1 c.37.1.19 (A:46-251) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1w36b1 c.37.1.19 (B:1-485) Exodeoxyribonuclease V beta chain (RecB), N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1oywa2 c.37.1.19 (A:1-206) RecQ helicase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure