Citrus Sinensis ID: 037759

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------48
WPFHILYHGSISLKENIEEALDEPRGLQVVAYCMLPFYLKLCCLYLSVFLVHFEISTKQSYQLWIAEGFIPNNNEATAERYLEQLINGGFVDAGKRGVRGRINTCSIPGHCSPALLTVAFEGEFFISPIMDQEVKLWENVKRFTVHGNLNDFEFLDHFDSFLHSLLHLTLGSHYLDSNYCEKIYKMFKFLRVLDLGSLVLIRYPSEIEYVFLLRYLNLNIPSLKSLPSSLLNSLLNLYTLDMPFSYIDHTADEFWKMSKLRYLNFGSITLSAHPGKYCGSLENLDFISALHPCCCPEDILGRLPNLQNIQIWGDLIYYQSLLSKILYRLSCLESLKLAKESKIPRRSNIILAKYQFPPSLTHLSFLNIELMDDPMPALEKLAVLRKLACSSDGFPKLKVLHLKSMLWLQEWTMGIRAMPKLECSILNPCAHLKMIPEQLWCLKSLNKLELWWPELELRQQLREFEDKEQYGIQLYPYGI
cccEEEEEcccccccccccccHHHHHHHHcccccccHHHHHHHHHcccccccccccHHHHHHHHHHccccccccHHHHHHHHHHHHHcccEEEEEcccccEEcEEEccHHHHHHHHHHHHccccEEEEcccccccccccEEEEEEEcccccccccccccccccEEEEEccccccccHHHHHHHcccccEEEEEEEccccccccccccccccccccccccccccccccHHHHcccccccEEEccccccccccHHHHccccccEEEEccccccccccccccccccccEEcEEccccccHHHHcccccccEEEEEEcccccHHHHHHHHcccccccEEEEEccccccccccccccccccccccccEEEEcEEcccccccHHHHcccccEEEEEccccccccEEEEEccccccEEEEEccccccccEEEEEEccccccccccccccccccEEEEEcccHHHHHHHHHHcccccccEEEEEccc
ccEEEEEEccccccccccccccHHHHHHHccHHHccccccccEEEEEcccccccccHHHHHHHHHHHccccccHHHHHHHHHHHHHHccEEEEEEccccccEEEEEHHHHHHHHHHHHHHHHccEEEEcccccccccccEEEEEEEcccccccccccccccEEEEEEEEcccccccHHHHHHHHHHcccEEEEEccccccccccHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHEccccccccHccHHHHHHHHHHHEEccccccccccccccccHHHHcEEEEEcccccHHHHHHHHHHHHHEEEEcccHHHHHHHHHHHHHcHHHHHEEEHcHHcccccHHccccccccccccEEEEEEccccccccHHHHHHcHcccEEEEcccccHHcEEEEEcccccccEEEEcccccccccEEEEcccHHHHHcccHHHHHHHHcEEEEccccHHHHHHHcccccccEEEEEEccccc
wpfhilyhgsisLKENIEEaldeprglqVVAYCMLPFYLKLCCLYLSVFLVHFEISTKQSYQLWIAegfipnnneATAERYLEQLInggfvdagkrgvrgrintcsipghcspalltvafegeffispimDQEVKLWENVKRftvhgnlndfeflDHFDSFLHSLLHLTlgshyldsnyCEKIYKMFKFLRVLDLGSLVLIRYPSEIEYVFLLRYLNlnipslkslpSSLLNSLLNlytldmpfsyidHTADEFWKMSKLRYLNfgsitlsahpgkycgslenldfisalhpcccpedilgrlpnlqniqIWGDLIYYQSLLSKILYRLSCLESLKLAkeskiprrsniilakyqfppslthlsflnielmddpmpALEKLAVLRKLAcssdgfpklKVLHLKSMLWLQEWTMGirampklecsilnpcahlkmipEQLWCLKSLNKLELWWPELELRQQLREFEDkeqygiqlypygi
WPFHILYHGSISLKENIEEALDEPRGLQVVAYCMLPFYLKLCCLYLSVFLVHFEISTKQSYQLWIAEGFIPNNNEATAERYLEQLINGGFVDAGKRGVRGRINTCSIPGHCSPALLTVAFEGEFFISPIMDQEVKLWENVKRFTVHGNLNDFEFLDHFDSFLHSLLHLTLGSHYLDSNYCEKIYKMFKFLRVLDLGSLVLIRYPSEIEYVFLLRYLNLNIPSLKSLPSSLLNSLLNLYTLDMPFSYIDHTADEFWKMSKLRYLNFGSITLSAHPGKYCGSLENLDFISALHPCCCPEDILGRLPNLQNIQIWGDLIYYQSLLSKILYRLSCLESLKLAkeskiprrsniilakyqfppsLTHLSFLNIELMDDPMPALEKLAVLRKLACSSDGFPKLKVLHLKSMLWLQEWTMGIRAMPKLECSILNPCAHLKMIPEQLWCLKSLNKLELWWPELELRQQLRefedkeqygiqlypygi
WPFHILYHGSISLKENIEEALDEPRGLQVVAYCMLPFYLKLCCLYLSVFLVHFEISTKQSYQLWIAEGFIPNNNEATAERYLEQLINGGFVDAGKRGVRGRINTCSIPGHCSPALLTVAFEGEFFISPIMDQEVKLWENVKRFTVHGNLNDFEfldhfdsflhsllhltlgshyldSNYCEKIYKMFKFLRVLDLGSLVLIRYPSEIEYVFLLRYlnlnipslkslpssllnsllnlYTLDMPFSYIDHTADEFWKMSKLRYLNFGSITLSAHPGKYCGSLENLDFISALHPCCCPEDILGRLPNLQNIQIWGDLIYYQSLLSKILYRLSCLESLKLAKESKIPRRSNIILAKYQFPPSLTHLSFLNIELMDDPMPALEKLAVLRKLACSSDGFPKLKVLHLKSMLWLQEWTMGIRAMPKLECSILNPCAHLKMIPEQLWCLKSLNKLELWWPelelrqqlreFEDKEQYGIQLYPYGI
**FHILYHGSISLKENIEEALDEPRGLQVVAYCMLPFYLKLCCLYLSVFLVHFEISTKQSYQLWIAEGFIPNNNEATAERYLEQLINGGFVDAGKRGVRGRINTCSIPGHCSPALLTVAFEGEFFISPIMDQEVKLWENVKRFTVHGNLNDFEFLDHFDSFLHSLLHLTLGSHYLDSNYCEKIYKMFKFLRVLDLGSLVLIRYPSEIEYVFLLRYLNLNIPSLKSLPSSLLNSLLNLYTLDMPFSYIDHTADEFWKMSKLRYLNFGSITLSAHPGKYCGSLENLDFISALHPCCCPEDILGRLPNLQNIQIWGDLIYYQSLLSKILYRLSCLESLKLAKESKIPRRSNIILAKYQFPPSLTHLSFLNIELMDDPMPALEKLAVLRKLACSSDGFPKLKVLHLKSMLWLQEWTMGIRAMPKLECSILNPCAHLKMIPEQLWCLKSLNKLELWWPELELRQQLREFEDKEQYGIQLYP***
WPFHILYHGSI***********EPRGLQVVAYCMLPFYLKLCCLYLSVFLVHFEISTKQSYQLWIAEGFIPNNNEATAERYLEQLINGGFVDAGKRGVRGRINTCSIPGHCSPALLTVAFEGEFFISPIMDQEVKLWENVKRFTVHGNLNDFEFLDHFDSFLHSLLHLTLGSHYLDSNYCEKIYKMFKFLRVLDLGSLVLIRYPSEIEYVFLLRYLNLNIPSLKSLPSSLLNSLLNLYTLDMPFSYIDHTADEFWKMSKLRYLNFGSITL*********SLENLDFISALHPCCCPEDILGRLPNLQNIQIWGDLIYYQSLLSKILYRLSCLESLKLAKESKIPRRSNIILAKYQFPPSLTHLSFLNIELMDDPMPALEKLAVLRKLACSSDGFPKLKVLHLKSMLWLQEWTMGIRAMPKLECSILNPCAHLKMIPEQLWCLKSLNKLELWWPELELRQQLREFEDKEQYGIQLYPYGI
WPFHILYHGSISLKENIEEALDEPRGLQVVAYCMLPFYLKLCCLYLSVFLVHFEISTKQSYQLWIAEGFIPNNNEATAERYLEQLINGGFVDAGKRGVRGRINTCSIPGHCSPALLTVAFEGEFFISPIMDQEVKLWENVKRFTVHGNLNDFEFLDHFDSFLHSLLHLTLGSHYLDSNYCEKIYKMFKFLRVLDLGSLVLIRYPSEIEYVFLLRYLNLNIPSLKSLPSSLLNSLLNLYTLDMPFSYIDHTADEFWKMSKLRYLNFGSITLSAHPGKYCGSLENLDFISALHPCCCPEDILGRLPNLQNIQIWGDLIYYQSLLSKILYRLSCLESLKLAKESKIPRRSNIILAKYQFPPSLTHLSFLNIELMDDPMPALEKLAVLRKLACSSDGFPKLKVLHLKSMLWLQEWTMGIRAMPKLECSILNPCAHLKMIPEQLWCLKSLNKLELWWPELELRQQLREFEDKEQYGIQLYPYGI
WPFHILYHGSISLKENIEEALDEPRGLQVVAYCMLPFYLKLCCLYLSVFLVHFEISTKQSYQLWIAEGFIPNNNEATAERYLEQLINGGFVDAGKRGVRGRINTCSIPGHCSPALLTVAFEGEFFISPIMDQEVKLWENVKRFTVHGNLNDFEFLDHFDSFLHSLLHLTLGSHYLDSNYCEKIYKMFKFLRVLDLGSLVLIRYPSEIEYVFLLRYLNLNIPSLKSLPSSLLNSLLNLYTLDMPFSYIDHTADEFWKMSKLRYLNFGSITLSAHPGKYCGSLENLDFISALHPCCCPEDILGRLPNLQNIQIWGDLIYYQSLLSKILYRLSCLESLKLAKESKIPRRSNIILAKYQFPPSLTHLSFLNIELMDDPMPALEKLAVLRKLACSSDGFPKLKVLHLKSMLWLQEWTMGIRAMPKLECSILNPCAHLKMIPEQLWCLKSLNKLELWWPELELRQQLREFEDKEQYGIQLYPYGI
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
WPFHILYHGSISLKENIEEALDEPRGLQVVAYCMLPFYLKLCCLYLSVFLVHFEISTKQSYQLWIAEGFIPNNNEATAERYLEQLINGGFVDAGKRGVRGRINTCSIPGHCSPALLTVAFEGEFFISPIMDQEVKLWENVKRFTVHGNLNDFEFLDHFDSFLHSLLHLTLGSHYLDSNYCEKIYKMFKFLRVLDLGSLVLIRYPSEIEYVFLLRYLNLNIPSLKSLPSSLLNSLLNLYTLDMPFSYIDHTADEFWKMSKLRYLNFGSITLSAHPGKYCGSLENLDFISALHPCCCPEDILGRLPNLQNIQIWGDLIYYQSLLSKILYRLSCLESLKLAKESKIPRRSNIILAKYQFPPSLTHLSFLNIELMDDPMPALEKLAVLRKLACSSDGFPKLKVLHLKSMLWLQEWTMGIRAMPKLECSILNPCAHLKMIPEQLWCLKSLNKLELWWPELELRQQLREFEDKEQYGIQLYPYGI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query479 2.2.26 [Sep-21-2011]
Q9FJB5901 Disease resistance RPP8-l yes no 0.866 0.460 0.269 6e-24
Q9FJK8908 Probable disease resistan no no 0.872 0.460 0.266 7e-23
Q9XIF0906 Putative disease resistan no no 0.941 0.497 0.281 4e-21
Q8W4J9908 Disease resistance protei no no 0.874 0.461 0.259 1e-20
P59584910 Disease resistance protei no no 0.891 0.469 0.254 1e-19
P0C8S1906 Probable disease resistan no no 0.870 0.460 0.259 1e-19
Q6L4001284 Putative late blight resi N/A no 0.837 0.312 0.277 1e-17
Q8W474907 Probable disease resistan no no 0.853 0.450 0.269 2e-17
Q6L4381306 Putative late blight resi N/A no 0.853 0.313 0.268 5e-16
Q60CZ81306 Putative late blight resi N/A no 0.853 0.313 0.268 5e-16
>sp|Q9FJB5|RP8L3_ARATH Disease resistance RPP8-like protein 3 OS=Arabidopsis thaliana GN=RPP8L3 PE=2 SV=1 Back     alignment and function desciption
 Score =  112 bits (280), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 131/486 (26%), Positives = 205/486 (42%), Gaps = 71/486 (14%)

Query: 30  VAYCMLPFYLKLCCLYLSVFLVHFEISTKQSYQLWIAEGFIPN-NNEATAERYLEQLING 88
           ++Y  LP  LK C LYL+ F   ++I T+  Y  W AEG         + E YLE+L+  
Sbjct: 408 LSYEDLPTDLKHCFLYLAHFPEDYKIKTRTLYSYWAAEGIYDGLTILDSGEDYLEELVRR 467

Query: 89  GFVDAGKRGVRGRINTCSIPGHCSPALLTVAFEGEFF--------ISPIMDQEVKLWENV 140
             V A K  +  R+  C +        ++ A    F          S I+ Q        
Sbjct: 468 NLVIAEKSNLSWRLKLCQMHDMMREVCISKAKVENFLQIIKVPTSTSTIIAQSPS---RS 524

Query: 141 KRFTVHGNLNDFEFLDHFDSFLHSLLHLTLGSHYLDSNYCEKIYKMFKFLRVLDLGSLVL 200
           +R TVH     F  L H    + SLL L L       +     ++    LRVLDL S+  
Sbjct: 525 RRLTVHSG-KAFHILGHKKK-VRSLLVLGLKEDLWIQSASR--FQSLPLLRVLDLSSVKF 580

Query: 201 --IRYPSEIEYVFLLRYLNLNIPSLKSLPSSLLNSLLNLY-TLDMPFSYIDHTADEFWKM 257
              + PS I  +  LR+L+L+   +  LPS++ N  L LY  L +      H  +   +M
Sbjct: 581 EGGKLPSSIGGLIHLRFLSLHQAVVSHLPSTIRNLKLMLYLNLHVAIGVPVHVPNVLKEM 640

Query: 258 SKLRYLNFGSITLSAHPGKYC--GSLENLDFI---SALHPC------------------- 293
            +LRYL   S+ L  H       G L NL+++   S  H                     
Sbjct: 641 LELRYL---SLPLDMHDKTKLELGDLVNLEYLWCFSTQHSSVTDLLRMTKLRFFGVSFSE 697

Query: 294 -CCPEDILGRLPNLQNIQ----IWGDLIYYQSLLSKILYRLSCLESLKLAKE-SKIPRRS 347
            C  E++   L   + ++    I+    Y    + + +     L+ L L    SKIP   
Sbjct: 698 RCTFENLSSSLRQFRKLETLSFIYSRKTYMVDYVGEFVLDFIHLKKLSLGVHLSKIP--- 754

Query: 348 NIILAKYQFPPSLTHLSFLNIELMDDPMPALEKLAVL------------RKLACSSDGFP 395
                ++Q PP + H+  L   + +DPMP LEKL  L            R++ CS  GFP
Sbjct: 755 ----DQHQLPPHIAHIYLLFCHMEEDPMPILEKLLHLKSVELRRKAFIGRRMVCSKGGFP 810

Query: 396 KLKVLHLKSMLWLQEWTMGIRAMPKLECSILNPCAHLKMIPEQLWCLKSLNKLELWWPEL 455
           +L+ L +     L+EW +   +MP L   I++ C  L+ +P+ L  + SL +L++   + 
Sbjct: 811 QLRALQISEQSELEEWIVEEGSMPCLRDLIIHSCEKLEELPDGLKYVTSLKELKIEGMKR 870

Query: 456 ELRQQL 461
           E +++L
Sbjct: 871 EWKEKL 876
Disease resistance protein.
Arabidopsis thaliana (taxid: 3702)
>sp|Q9FJK8|RP8L4_ARATH Probable disease resistance RPP8-like protein 4 OS=Arabidopsis thaliana GN=RPP8L4 PE=2 SV=1 Back     alignment and function description
>sp|Q9XIF0|DRL13_ARATH Putative disease resistance protein At1g59780 OS=Arabidopsis thaliana GN=At1g59780 PE=2 SV=1 Back     alignment and function description
>sp|Q8W4J9|RPP8_ARATH Disease resistance protein RPP8 OS=Arabidopsis thaliana GN=RPP8 PE=1 SV=2 Back     alignment and function description
>sp|P59584|RP8HA_ARATH Disease resistance protein RPH8A OS=Arabidopsis thaliana GN=RPH8A PE=3 SV=1 Back     alignment and function description
>sp|P0C8S1|RP8L2_ARATH Probable disease resistance RPP8-like protein 2 OS=Arabidopsis thaliana GN=RPP8L2 PE=1 SV=1 Back     alignment and function description
>sp|Q6L400|R1B16_SOLDE Putative late blight resistance protein homolog R1B-16 OS=Solanum demissum GN=R1B-16 PE=3 SV=1 Back     alignment and function description
>sp|Q8W474|DRL7_ARATH Probable disease resistance protein At1g58390 OS=Arabidopsis thaliana GN=At1g58390 PE=2 SV=4 Back     alignment and function description
>sp|Q6L438|R1A6_SOLDE Putative late blight resistance protein homolog R1A-6 OS=Solanum demissum GN=R1A-6 PE=3 SV=2 Back     alignment and function description
>sp|Q60CZ8|R1A10_SOLDE Putative late blight resistance protein homolog R1A-10 OS=Solanum demissum GN=R1A-10 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query479
359496848 856 PREDICTED: disease resistance RPP8-like 0.868 0.485 0.295 1e-40
147766035 902 hypothetical protein VITISV_038742 [Viti 0.868 0.461 0.291 2e-39
339431373 968 putative CC-NBS-LRR protein [Malus x dom 0.881 0.435 0.303 7e-35
359491404 922 PREDICTED: probable disease resistance R 0.893 0.464 0.295 3e-33
357483589 941 Disease resistance RPP8-like protein [Me 0.918 0.467 0.280 3e-31
351720730 761 NBS-LRR disease-resistance protein scn3r 0.901 0.567 0.263 3e-30
356496703 910 PREDICTED: disease resistance RPP8-like 0.883 0.464 0.281 5e-29
356538242 912 PREDICTED: disease resistance RPP8-like 0.885 0.464 0.285 2e-28
359489156 899 PREDICTED: probable disease resistance p 0.943 0.502 0.269 2e-28
359489792 916 PREDICTED: probable disease resistance p 0.893 0.467 0.288 3e-28
>gi|359496848|ref|XP_002269653.2| PREDICTED: disease resistance RPP8-like protein 3-like [Vitis vinifera] Back     alignment and taxonomy information
 Score =  174 bits (440), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 136/460 (29%), Positives = 215/460 (46%), Gaps = 44/460 (9%)

Query: 29  VVAYCMLPFYLKLCCLYLSVFLVHFEISTKQSYQLWIAEGFIPNNNEAT----AERYLEQ 84
            ++Y  LP+YLK C LY  +F    EI   +   LWIAEGF+    E +    AE +LE+
Sbjct: 371 ALSYNDLPYYLKPCFLYFGLFPEDLEIPVGKLVLLWIAEGFVQQRGEESMEDVAEDFLEE 430

Query: 85  LINGGFVDAGKRGVRGRINTCSIPGHCSPALLTVAFEGEFFISPIMDQ---EVKLWENVK 141
           L++   +   ++   G+I  C I        ++ A E +F    I+D    +  +    +
Sbjct: 431 LVDRSMIQVAEKRYNGKIKACRIHDLLRDLAMSEAKECKFL--EILDSTNIDTSVTTRAR 488

Query: 142 RFTVHGNLNDFEFLDHFDSFLHSLLHLTLGSHYLDSNYCEKIYKMFKFLRVLDLGSLVLI 201
           R +VH +L ++  L H +    S+LH +     L  +  + +++  K LRVLDL  +   
Sbjct: 489 RISVHSSLEEYMKLRHPNPHFRSMLHFSRCEESLRRDQWKSLFESLKLLRVLDLERVQTH 548

Query: 202 RYPSEIEYVFLLRYLNLNIPSLKSLPSSLLNSLLNLYTLDMPFSYIDHTADEFWKMSKLR 261
             P EI  +  LRYL L    L+ LPSS+ N   NL TLD+  + +     + W M  LR
Sbjct: 549 ALPKEIRELVHLRYLGLRRTGLQRLPSSIQN-FCNLQTLDIRATKVSRLPIQLWNMPGLR 607

Query: 262 YLNFGSITLSAHPGKYCG--SLENLDFISALHPCCCPEDILGRLPNLQNIQIWGDLIYYQ 319
           +L     +++ HP  +     L+ L  +S       P D+LG+L NL+ + I G      
Sbjct: 608 HLYLEKTSIAGHPPVHVSVMHLQTLSTVSIYGNQWIP-DLLGKLTNLRKLGIHGYFASQT 666

Query: 320 SLLSKILYRLSCLESLKLAKESKI-----------PRRSNIILAK--------YQFPPSL 360
             LS+ L +LS L++L+L     I           P    + L+          +  P+L
Sbjct: 667 EALSRCLVKLSNLQNLQLRGTELILEPTIKLLLNQPNIHKLHLSGPIEKLPDPQEIQPNL 726

Query: 361 THLSFLNIELMDD------PMPALEKLAVL------RKLACSSDGFPKLKVLHLKSMLWL 408
           T +   N  L+ D       +P L+ L +L      +++ CS+ GFPKL  L L  ++ L
Sbjct: 727 TKIILENSLLVQDIFVILGKLPNLQMLKLLINSFFGKEITCSASGFPKLHGLELSELVNL 786

Query: 409 QEWTMGIRAMPKLECSILNPCAHLKMIPEQLWCLKSLNKL 448
           +EW +   AMP L   I++ C  LK IPE    L +L +L
Sbjct: 787 EEWRVDDGAMPSLRHLIIDHCDQLKKIPEGFQYLTALREL 826

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|147766035|emb|CAN70214.1| hypothetical protein VITISV_038742 [Vitis vinifera] Back     alignment and taxonomy information
>gi|339431373|gb|AEJ72566.1| putative CC-NBS-LRR protein [Malus x domestica] Back     alignment and taxonomy information
>gi|359491404|ref|XP_002274414.2| PREDICTED: probable disease resistance RPP8-like protein 2-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|357483589|ref|XP_003612081.1| Disease resistance RPP8-like protein [Medicago truncatula] gi|355513416|gb|AES95039.1| Disease resistance RPP8-like protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|351720730|ref|NP_001237442.1| NBS-LRR disease-resistance protein scn3r1 [Glycine max] gi|212293340|gb|ACJ24527.1| NBS-LRR disease-resistance protein scn3r1 [Glycine max] Back     alignment and taxonomy information
>gi|356496703|ref|XP_003517205.1| PREDICTED: disease resistance RPP8-like protein 3-like [Glycine max] Back     alignment and taxonomy information
>gi|356538242|ref|XP_003537613.1| PREDICTED: disease resistance RPP8-like protein 3-like [Glycine max] Back     alignment and taxonomy information
>gi|359489156|ref|XP_003633889.1| PREDICTED: probable disease resistance protein RDL6/RF9-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|359489792|ref|XP_002274076.2| PREDICTED: probable disease resistance protein RDL6/RF9-like [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query479
TAIR|locus:2176486908 RPP8 "RECOGNITION OF PERONOSPO 0.434 0.229 0.263 1.2e-15
TAIR|locus:2152536908 AT5G48620 [Arabidopsis thalian 0.421 0.222 0.282 4.2e-15
TAIR|locus:2169523901 AT5G35450 [Arabidopsis thalian 0.526 0.279 0.25 2.1e-14
TAIR|locus:504956182 1049 AT1G58848 [Arabidopsis thalian 0.183 0.083 0.356 4.6e-11
TAIR|locus:2826978 1049 AT1G59218 [Arabidopsis thalian 0.183 0.083 0.356 4.6e-11
TAIR|locus:504956184 1017 AT1G58807 "AT1G58807" [Arabido 0.277 0.130 0.291 3e-10
TAIR|locus:2827038 1017 AT1G59124 "AT1G59124" [Arabido 0.277 0.130 0.291 3e-10
TAIR|locus:2102857847 AT3G46710 [Arabidopsis thalian 0.329 0.186 0.299 8e-10
TAIR|locus:2037639907 AT1G58390 "AT1G58390" [Arabido 0.196 0.103 0.379 9e-10
TAIR|locus:5049561861138 AT1G58602 [Arabidopsis thalian 0.334 0.140 0.259 9.6e-10
TAIR|locus:2176486 RPP8 "RECOGNITION OF PERONOSPORA PARASITICA 8" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 175 (66.7 bits), Expect = 1.2e-15, Sum P(2) = 1.2e-15
 Identities = 59/224 (26%), Positives = 102/224 (45%)

Query:   240 LDMPFSYIDHTADEFWKMSKLRYLNFGSITLSAHPGKYCGSLENLDFIS-ALHPCCCPED 298
             L +P    D T  E   +  L YL +G  T  +        +  L +++ +L   C  E 
Sbjct:   654 LSLPLKMDDKTKLELGDLVNLEYL-YGFSTQHSSVTDLL-RMTKLRYLAVSLSERCNFET 711

Query:   299 ILGRLPNLQNIQIWGDLIYYQSLLSKILYRLSCLESLKLAKESKIPRRSNIILAKYQFPP 358
             +   L  L+N++    L   ++ +   +     L+     K+  +  R + I  ++QFPP
Sbjct:   712 LSSSLRELRNLETLNFLFSLETYMVDYMGEF-VLDHFIHLKQLGLAVRMSKIPDQHQFPP 770

Query:   359 SLTHLSFLNIELMDDPMPALEKLAVLR------------KLACSSDGFPKLKVLHLKSML 406
              L HL  +   + +DPMP LEKL  L+            ++ CS  GFP+L V+ +    
Sbjct:   771 HLVHLFLIYCGMEEDPMPILEKLLHLKSVRLARKAFLGSRMVCSKGGFPQLCVIEISKES 830

Query:   407 WLQEWTMGIRAMPKLECSILNPCAHLKMIPEQLWCLKSLNKLEL 450
              L+EW +   +MP L    ++ C  LK +P+ L  + SL +L++
Sbjct:   831 ELEEWIVEEGSMPCLRTLTIDDCKKLKELPDGLKYITSLKELKI 874
GO:0006952 "defense response" evidence=IEA;ISS;TAS
GO:0043531 "ADP binding" evidence=IEA
GO:0000166 "nucleotide binding" evidence=ISS
GO:0009416 "response to light stimulus" evidence=IMP
GO:0051607 "defense response to virus" evidence=IMP
GO:0005886 "plasma membrane" evidence=IDA
GO:0009626 "plant-type hypersensitive response" evidence=IMP
GO:0051707 "response to other organism" evidence=IMP
TAIR|locus:2152536 AT5G48620 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2169523 AT5G35450 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:504956182 AT1G58848 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2826978 AT1G59218 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:504956184 AT1G58807 "AT1G58807" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2827038 AT1G59124 "AT1G59124" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2102857 AT3G46710 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2037639 AT1G58390 "AT1G58390" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:504956186 AT1G58602 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query479
pfam00931285 pfam00931, NB-ARC, NB-ARC domain 7e-06
>gnl|CDD|216202 pfam00931, NB-ARC, NB-ARC domain Back     alignment and domain information 
 Score = 47.3 bits (113), Expect = 7e-06
 Identities = 19/44 (43%), Positives = 28/44 (63%)

Query: 32  YCMLPFYLKLCCLYLSVFLVHFEISTKQSYQLWIAEGFIPNNNE 75
           Y  LP +LK C LYL++F   + I  +Q  +LWIAEGF+  ++ 
Sbjct: 242 YDNLPMHLKRCFLYLALFPEDYNIRKEQLIKLWIAEGFVIPSDI 285

Length = 285

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 479
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 100.0
PLN03210 1153 Resistant to P. syringae 6; Provisional 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.9
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.9
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.87
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.84
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.82
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.76
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.75
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.73
KOG0472 565 consensus Leucine-rich repeat protein [Function un 99.61
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.52
KOG0617264 consensus Ras suppressor protein (contains leucine 99.52
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.47
KOG4237 498 consensus Extracellular matrix protein slit, conta 99.46
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.44
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.43
KOG0617264 consensus Ras suppressor protein (contains leucine 99.4
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 99.31
KOG4237498 consensus Extracellular matrix protein slit, conta 99.2
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.19
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.19
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.08
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.03
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.87
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.83
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 98.74
PF00931287 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is 98.69
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.68
KOG4341483 consensus F-box protein containing LRR [General fu 98.6
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.56
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.56
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.56
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 98.55
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.55
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.47
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 98.46
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.44
PLN03150623 hypothetical protein; Provisional 98.4
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 98.32
PLN03150623 hypothetical protein; Provisional 98.28
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.2
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.19
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.11
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.1
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.99
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.88
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.84
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 97.73
KOG2982418 consensus Uncharacterized conserved protein [Funct 97.71
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 97.7
KOG2982418 consensus Uncharacterized conserved protein [Funct 97.54
KOG4341483 consensus F-box protein containing LRR [General fu 97.51
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.5
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 97.38
PRK15386426 type III secretion protein GogB; Provisional 97.23
PRK15386426 type III secretion protein GogB; Provisional 97.17
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 97.11
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 96.98
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 96.83
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 96.8
KOG1947482 consensus Leucine rich repeat proteins, some prote 96.71
KOG2123388 consensus Uncharacterized conserved protein [Funct 96.66
KOG1947482 consensus Leucine rich repeat proteins, some prote 96.52
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 96.32
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 96.29
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.26
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.96
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 95.87
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.57
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 95.31
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 95.11
KOG3864221 consensus Uncharacterized conserved protein [Funct 94.92
KOG0473326 consensus Leucine-rich repeat protein [Function un 94.37
KOG2123388 consensus Uncharacterized conserved protein [Funct 94.23
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 94.13
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 93.83
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 93.81
smart0037026 LRR Leucine-rich repeats, outliers. 93.81
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 89.92
smart0037026 LRR Leucine-rich repeats, outliers. 89.92
KOG3864221 consensus Uncharacterized conserved protein [Funct 83.92
KOG0473326 consensus Leucine-rich repeat protein [Function un 83.53
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information 
Probab=100.00  E-value=9.8e-47  Score=402.03  Aligned_cols=415  Identities=26%  Similarity=0.336  Sum_probs=315.8

Q ss_pred             chhhhhhHHHHHHHhccCCchhhHHHHhhhcccCCCceechhhHHHHHHhcCCCCC-----ChHHHHHHHHHHHHhCCce
Q 037759           17 IEEALDEPRGLQVVAYCMLPFYLKLCCLYLSVFLVHFEISTKQSYQLWIAEGFIPN-----NNEATAERYLEQLINGGFV   91 (479)
Q Consensus        17 ~~~~~~~i~~~L~lSY~~L~~~~K~cfl~~a~fp~~~~i~~~~Li~~w~a~g~i~~-----~~~~~~~~~~~~L~~~~ll   91 (479)
                      .+.+++.|+++|++|||.||+++|.||+|||+|||||+|++++||.+||||||+.+     +++|.|..|+++|+++||+
T Consensus       390 ~~~~~~~i~~iLklSyd~L~~~lK~CFLycalFPED~~I~~e~Li~yWiaEGfi~~~~~~~~~~d~G~~~i~~LV~~~Ll  469 (889)
T KOG4658|consen  390 FSGMEESILPILKLSYDNLPEELKSCFLYCALFPEDYEIKKEKLIEYWIAEGFIDPLDGGETAEDVGYDYIEELVRASLL  469 (889)
T ss_pred             CCchhhhhHHhhhccHhhhhHHHHHHHHhhccCCcccccchHHHHHHHHhccCcCccccccchhcchHHHHHHHHHHHHH
Confidence            35668999999999999999999999999999999999999999999999999977     7899999999999999999


Q ss_pred             eeeecCCCCCeeEEEeChhHHHHHHHhhh-----hCCceeeecC-----CCcccCCCCeEEEEEEcCCCCccccccc-CC
Q 037759           92 DAGKRGVRGRINTCSIPGHCSPALLTVAF-----EGEFFISPIM-----DQEVKLWENVKRFTVHGNLNDFEFLDHF-DS  160 (479)
Q Consensus        92 ~~~~~~~~g~~~~~~mHdli~~l~~~~~~-----~~~~~~~~~~-----~~~~~~~~~~~~l~l~~~~~~~~~~~~~-~~  160 (479)
                      +.....  ++..+|+|||++|++|.+++.     +++.+. ..+     ......+..+|++++. ++....++... ++
T Consensus       470 ~~~~~~--~~~~~~kmHDvvRe~al~ias~~~~~~e~~iv-~~~~~~~~~~~~~~~~~~rr~s~~-~~~~~~~~~~~~~~  545 (889)
T KOG4658|consen  470 IEERDE--GRKETVKMHDVVREMALWIASDFGKQEENQIV-SDGVGLSEIPQVKSWNSVRRMSLM-NNKIEHIAGSSENP  545 (889)
T ss_pred             hhcccc--cceeEEEeeHHHHHHHHHHhccccccccceEE-ECCcCccccccccchhheeEEEEe-ccchhhccCCCCCC
Confidence            988754  666889999999999999999     666444 222     1233366789999999 88888788888 99


Q ss_pred             CccEEEEecCCCCCCCcchhHHHhCcCCceeEEEecCCc-CccCchhhcccccCCeeecCCCCCccCChhHHhcCcCCcE
Q 037759          161 FLHSLLHLTLGSHYLDSNYCEKIYKMFKFLRVLDLGSLV-LIRYPSEIEYVFLLRYLNLNIPSLKSLPSSLLNSLLNLYT  239 (479)
Q Consensus       161 ~Lr~L~l~~~~~~~~~~~~~~~~~~~l~~L~~L~L~~~~-l~~lp~~l~~L~~L~~L~L~~~~l~~lp~~i~~~l~~L~~  239 (479)
                      +|++|.+.++...  ...+...+|..|+.||||||++|. +.++|..+++|.+||||+++++.+..+|.++ ++|.+|.+
T Consensus       546 ~L~tLll~~n~~~--l~~is~~ff~~m~~LrVLDLs~~~~l~~LP~~I~~Li~LryL~L~~t~I~~LP~~l-~~Lk~L~~  622 (889)
T KOG4658|consen  546 KLRTLLLQRNSDW--LLEISGEFFRSLPLLRVLDLSGNSSLSKLPSSIGELVHLRYLDLSDTGISHLPSGL-GNLKKLIY  622 (889)
T ss_pred             ccceEEEeecchh--hhhcCHHHHhhCcceEEEECCCCCccCcCChHHhhhhhhhcccccCCCccccchHH-HHHHhhhe
Confidence            9999999998631  455677889999999999999876 7799999999999999999999999999999 99999999


Q ss_pred             EecCCC-cccccchhhhcCccCcEEEeccCCCCCCCC-C----CCCCCcccCeeecCCC-CCChhhhcCCCCCCCeEEEE
Q 037759          240 LDMPFS-YIDHTADEFWKMSKLRYLNFGSITLSAHPG-K----YCGSLENLDFISALHP-CCCPEDILGRLPNLQNIQIW  312 (479)
Q Consensus       240 L~l~~~-~l~~lp~~~~~L~~L~~L~l~~~~~~~~~~-p----~i~~L~~L~~l~~~~~-~~~~~~~l~~l~~L~~L~l~  312 (479)
                      |++..+ .+..+|.....|++||+|.+.   ...... .    .+.+|++|+.+.+... ...... +..++.|+.+...
T Consensus       623 Lnl~~~~~l~~~~~i~~~L~~Lr~L~l~---~s~~~~~~~~l~el~~Le~L~~ls~~~~s~~~~e~-l~~~~~L~~~~~~  698 (889)
T KOG4658|consen  623 LNLEVTGRLESIPGILLELQSLRVLRLP---RSALSNDKLLLKELENLEHLENLSITISSVLLLED-LLGMTRLRSLLQS  698 (889)
T ss_pred             eccccccccccccchhhhcccccEEEee---ccccccchhhHHhhhcccchhhheeecchhHhHhh-hhhhHHHHHHhHh
Confidence            999999 666666666779999999999   543222 2    2336666666666541 122233 4444444422222


Q ss_pred             ---eCCccchHHHHHHhccCCCccEEEeecCCC----------------CCCccEEEe---------ecccccCcceEEE
Q 037759          313 ---GDLIYYQSLLSKILYRLSCLESLKLAKESK----------------IPRRSNIIL---------AKYQFPPSLTHLS  364 (479)
Q Consensus       313 ---~~~~~~~~~~~~~l~~l~~L~~L~l~~~~~----------------lp~L~~L~l---------~~~~lp~~L~~L~  364 (479)
                         .+.  .......++..+.+|+.|.+.+..+                ||++.++.+         ....+||+|+.|.
T Consensus       699 l~~~~~--~~~~~~~~~~~l~~L~~L~i~~~~~~e~~~~~~~~~~~~~~f~~l~~~~~~~~~~~r~l~~~~f~~~L~~l~  776 (889)
T KOG4658|consen  699 LSIEGC--SKRTLISSLGSLGNLEELSILDCGISEIVIEWEESLIVLLCFPNLSKVSILNCHMLRDLTWLLFAPHLTSLS  776 (889)
T ss_pred             hhhccc--ccceeecccccccCcceEEEEcCCCchhhcccccccchhhhHHHHHHHHhhccccccccchhhccCcccEEE
Confidence               111  3444556667778888888876111                222222222         1124569999999


Q ss_pred             EecccCCCCCccccccCccCceEEeccCCCCCcceEeeccCCCCCeeEEcCCCCCCccEeEEecCCCCCCCcccccCCCC
Q 037759          365 FLNIELMDDPMPALEKLAVLRKLACSSDGFPKLKVLHLKSMLWLQEWTMGIRAMPKLECSILNPCAHLKMIPEQLWCLKS  444 (479)
Q Consensus       365 l~~~~l~~~~~~~l~~l~~L~~l~~~~~~~~~L~~L~l~~~~~l~~~~~~~~~~~~L~~L~l~~c~~l~~lp~~l~~l~~  444 (479)
                      +..|...+.+++....+..+.......+.++.++  .+.+...++.+....-.++.|+.+.+..||++..+|       .
T Consensus       777 l~~~~~~e~~i~~~k~~~~l~~~i~~f~~~~~l~--~~~~l~~l~~i~~~~l~~~~l~~~~ve~~p~l~~~P-------~  847 (889)
T KOG4658|consen  777 LVSCRLLEDIIPKLKALLELKELILPFNKLEGLR--MLCSLGGLPQLYWLPLSFLKLEELIVEECPKLGKLP-------L  847 (889)
T ss_pred             EecccccccCCCHHHHhhhcccEEecccccccce--eeecCCCCceeEecccCccchhheehhcCcccccCc-------c
Confidence            9999988899988888887776555544444443  355555666665555567779999999998888776       4


Q ss_pred             CCEEEeeCC
Q 037759          445 LNKLELWWP  453 (479)
Q Consensus       445 L~~L~l~~c  453 (479)
                      +.++.+.+|
T Consensus       848 ~~~~~i~~~  856 (889)
T KOG4658|consen  848 LSTLTIVGC  856 (889)
T ss_pred             ccccceecc
Confidence            555666665

>PLN03210 Resistant to P Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>PF00931 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is the NB-ARC domain, a novel signalling motif found in bacteria and eukaryotes, shared by plant resistance gene products and regulators of cell death in animals [] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query479
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-09
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 8e-05
1z6t_A591 APAF-1, apoptotic protease activating factor 1; ca 1e-07
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 4e-07
2a5y_B549 CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis 4e-07
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-06
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 6e-06
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 7e-06
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 7e-04
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 7e-06
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 8e-06
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-04
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-05
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-04
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 3e-04
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-05
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 9e-05
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 5e-05
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-04
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 2e-04
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 4e-04
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 9e-04
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 4e-04
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 5e-04
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 8e-04
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 9e-04
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
 Score = 57.6 bits (138), Expect = 6e-09
 Identities = 69/417 (16%), Positives = 111/417 (26%), Gaps = 127/417 (30%)

Query: 130 MDQEVKLWENVKRFTVHGNLNDF-EFLD--HFDSFLHSLLHLTLGSHYLDSNYCEKIYKM 186
           MD E    +   +  +    + F +  D         S+L              + I   
Sbjct: 7   MDFETGEHQYQYKDILSVFEDAFVDNFDCKDVQDMPKSIL---------SKEEIDHIIMS 57

Query: 187 ----FKFLRVLDLGSLVLIRYPSEIEYVFLLRYLNLNIPSL----------KSLPSSLLN 232
                  LR+       L+    E+   F+   L +N   L           S+ + +  
Sbjct: 58  KDAVSGTLRLFWT----LLSKQEEMVQKFVEEVLRINYKFLMSPIKTEQRQPSMMTRMYI 113

Query: 233 SLLN-LYTLDMPFSYIDHTADEFWKMSKLRYLNFGSITLSAHPGKY--------CG---- 279
              + LY  +  F+  + +  +     KLR        L   P K          G    
Sbjct: 114 EQRDRLYNDNQVFAKYNVSRLQ--PYLKLR-----QALLELRPAKNVLIDGVLGSGKTWV 166

Query: 280 ---SLENLDFISA---------LHPCCCPEDILGRLPNLQNIQIWGDLIYYQSLLSKILY 327
                 +               L  C  PE +L  L  L           YQ +      
Sbjct: 167 ALDVCLSYKVQCKMDFKIFWLNLKNCNSPETVLEMLQKL----------LYQ-IDPNWTS 215

Query: 328 RLSCLESLKLAKESKIPRRSNIILAKYQFPPSLTHL----------SF------L----N 367
           R     ++KL   S       ++ +K  +   L  L          +F      L     
Sbjct: 216 RSDHSSNIKLRIHSIQAELRRLLKSK-PYENCLLVLLNVQNAKAWNAFNLSCKILLTTRF 274

Query: 368 IELMDDPMPALEKLAVLRKLACSSDGFPKLKVLHLKSMLWLQEWTMGIRAMPKLECSILN 427
            ++ D    A      L      S      +V  L    +L       + +P+   +  N
Sbjct: 275 KQVTDFLSAATTTHISLDHH---SMTLTPDEVKSLLL-KYL---DCRPQDLPREVLTT-N 326

Query: 428 PCAHLKMIPEQL------W-------CLK-------SLNKLELWWPELELRQQLREF 464
           P   L +I E +      W       C K       SLN LE   P  E R+     
Sbjct: 327 PRR-LSIIAESIRDGLATWDNWKHVNCDKLTTIIESSLNVLE---PA-EYRKMFDRL 378
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Length = 591 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query479
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.92
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.92
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.92
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 99.91
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.91
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.91
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.91
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.9
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.9
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.9
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.9
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 99.9
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 99.9
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.9
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.9
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.89
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.89
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.89
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.89
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.89
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.89
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.88
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 99.88
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.88
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.88
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.88
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.88
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.87
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.87
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.87
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.87
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.86
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 99.85
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.85
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.85
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.85
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.85
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.85
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.85
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.84
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.83
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.83
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.82
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.82
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.81
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.81
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.81
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.8
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.79
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.79
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.79
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.79
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.78
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.77
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.76
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.76
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.75
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.74
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.74
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.73
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.72
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.7
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.7
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.69
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.69
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.69
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.67
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.67
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.66
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.66
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.65
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.65
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.64
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.64
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.64
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.63
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.63
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.63
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.63
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.62
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.6
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.59
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.59
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.55
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.54
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.54
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.54
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.54
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.53
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.53
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.53
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.52
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.52
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.51
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.51
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.51
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.5
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.5
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.48
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.47
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.45
2a5y_B549 CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis 99.44
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.43
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.43
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.41
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.41
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.4
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.39
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.38
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.38
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.37
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.37
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.37
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.35
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.35
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.34
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.33
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.33
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.32
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.32
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.31
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.31
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.31
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.31
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.28
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.24
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.24
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.24
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.21
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.2
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.19
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.16
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.14
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.14
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.13
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.1
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.08
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.08
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.04
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.01
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 98.99
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 98.97
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 98.85
4fdw_A401 Leucine rich hypothetical protein; putative cell s 98.79
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 98.78
4fdw_A401 Leucine rich hypothetical protein; putative cell s 98.78
1z6t_A591 APAF-1, apoptotic protease activating factor 1; ca 98.66
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 98.62
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 98.59
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 98.34
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 98.33
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.16
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 98.12
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 97.95
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.93
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.92
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.85
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 97.85
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 97.83
4gt6_A394 Cell surface protein; leucine rich repeats, putati 97.82
4gt6_A394 Cell surface protein; leucine rich repeats, putati 97.62
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.47
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 97.05
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.69
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 95.87
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 95.29
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 95.28
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 94.23
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
Probab=99.92  E-value=5.3e-25  Score=219.94  Aligned_cols=276  Identities=17%  Similarity=0.169  Sum_probs=172.3

Q ss_pred             CCCccEEEEecCCCCCCCcchhHHHhCcCCceeEEEecCCcCccCc-hhhcccccCCeeecCCCCCccCChhHHhcCcCC
Q 037759          159 DSFLHSLLHLTLGSHYLDSNYCEKIYKMFKFLRVLDLGSLVLIRYP-SEIEYVFLLRYLNLNIPSLKSLPSSLLNSLLNL  237 (479)
Q Consensus       159 ~~~Lr~L~l~~~~~~~~~~~~~~~~~~~l~~L~~L~L~~~~l~~lp-~~l~~L~~L~~L~L~~~~l~~lp~~i~~~l~~L  237 (479)
                      .++++.|.+.++.    ...++...|..+++|++|++++|.++.++ ..+..+++|++|++++|.+..+|+..|+++++|
T Consensus        44 l~~l~~l~l~~~~----l~~l~~~~~~~l~~L~~L~L~~n~i~~~~~~~~~~l~~L~~L~L~~n~l~~~~~~~~~~l~~L  119 (390)
T 3o6n_A           44 LNNQKIVTFKNST----MRKLPAALLDSFRQVELLNLNDLQIEEIDTYAFAYAHTIQKLYMGFNAIRYLPPHVFQNVPLL  119 (390)
T ss_dssp             GCCCSEEEEESCE----ESEECTHHHHHCCCCSEEECTTSCCCEECTTTTTTCTTCCEEECCSSCCCCCCTTTTTTCTTC
T ss_pred             cCCceEEEecCCc----hhhCChhHhcccccCcEEECCCCcccccChhhccCCCCcCEEECCCCCCCcCCHHHhcCCCCC
Confidence            5555666655554    34444455555666666666666655443 355556666666666666555554433566666


Q ss_pred             cEEecCCCcccccchh-hhcCccCcEEEeccCCCCCCCC--C-CCCCCcccCeeecCCCCCChhhhcCCCCCCCeEEEEe
Q 037759          238 YTLDMPFSYIDHTADE-FWKMSKLRYLNFGSITLSAHPG--K-YCGSLENLDFISALHPCCCPEDILGRLPNLQNIQIWG  313 (479)
Q Consensus       238 ~~L~l~~~~l~~lp~~-~~~L~~L~~L~l~~~~~~~~~~--p-~i~~L~~L~~l~~~~~~~~~~~~l~~l~~L~~L~l~~  313 (479)
                      ++|++++|.+..+|.. ++++++|++|+++   +|....  | .+..++.|+.+++.+....... ++.+++|+.|++++
T Consensus       120 ~~L~L~~n~l~~l~~~~~~~l~~L~~L~L~---~n~l~~~~~~~~~~l~~L~~L~l~~n~l~~~~-~~~l~~L~~L~l~~  195 (390)
T 3o6n_A          120 TVLVLERNDLSSLPRGIFHNTPKLTTLSMS---NNNLERIEDDTFQATTSLQNLQLSSNRLTHVD-LSLIPSLFHANVSY  195 (390)
T ss_dssp             CEEECCSSCCCCCCTTTTTTCTTCCEEECC---SSCCCBCCTTTTSSCTTCCEEECCSSCCSBCC-GGGCTTCSEEECCS
T ss_pred             CEEECCCCccCcCCHHHhcCCCCCcEEECC---CCccCccChhhccCCCCCCEEECCCCcCCccc-cccccccceeeccc
Confidence            6666666655555544 3556666666666   555444  2 3455555555555542222223 44555666666654


Q ss_pred             CCccchHHHHHHhccCCCccEEEeecC-------CCCCCccEEEe---------ecccccCcceEEEEecccCCCCCccc
Q 037759          314 DLIYYQSLLSKILYRLSCLESLKLAKE-------SKIPRRSNIIL---------AKYQFPPSLTHLSFLNIELMDDPMPA  377 (479)
Q Consensus       314 ~~~~~~~~~~~~l~~l~~L~~L~l~~~-------~~lp~L~~L~l---------~~~~lp~~L~~L~l~~~~l~~~~~~~  377 (479)
                      +.  ..     .+...++|++|++++.       ...++|+.|++         ++..+ ++|++|++++|.+.......
T Consensus       196 n~--l~-----~~~~~~~L~~L~l~~n~l~~~~~~~~~~L~~L~l~~n~l~~~~~l~~l-~~L~~L~Ls~n~l~~~~~~~  267 (390)
T 3o6n_A          196 NL--LS-----TLAIPIAVEELDASHNSINVVRGPVNVELTILKLQHNNLTDTAWLLNY-PGLVEVDLSYNELEKIMYHP  267 (390)
T ss_dssp             SC--CS-----EEECCSSCSEEECCSSCCCEEECCCCSSCCEEECCSSCCCCCGGGGGC-TTCSEEECCSSCCCEEESGG
T ss_pred             cc--cc-----ccCCCCcceEEECCCCeeeeccccccccccEEECCCCCCcccHHHcCC-CCccEEECCCCcCCCcChhH
Confidence            43  11     1233345566655541       12245555555         45566 88999999999887666667


Q ss_pred             cccCccCceEEeccC----------CCCCcceEeeccCCCCCeeEEcCCCCCCccEeEEecCCCCCCCcccccCCCCCCE
Q 037759          378 LEKLAVLRKLACSSD----------GFPKLKVLHLKSMLWLQEWTMGIRAMPKLECSILNPCAHLKMIPEQLWCLKSLNK  447 (479)
Q Consensus       378 l~~l~~L~~l~~~~~----------~~~~L~~L~l~~~~~l~~~~~~~~~~~~L~~L~l~~c~~l~~lp~~l~~l~~L~~  447 (479)
                      ++.+++|+.++++.+          .+++|+.|+++++ .+..++...+.+++|+.|++.+| .++.+|  +..+++|+.
T Consensus       268 ~~~l~~L~~L~L~~n~l~~~~~~~~~l~~L~~L~L~~n-~l~~~~~~~~~l~~L~~L~L~~N-~i~~~~--~~~~~~L~~  343 (390)
T 3o6n_A          268 FVKMQRLERLYISNNRLVALNLYGQPIPTLKVLDLSHN-HLLHVERNQPQFDRLENLYLDHN-SIVTLK--LSTHHTLKN  343 (390)
T ss_dssp             GTTCSSCCEEECCSSCCCEEECSSSCCTTCCEEECCSS-CCCCCGGGHHHHTTCSEEECCSS-CCCCCC--CCTTCCCSE
T ss_pred             ccccccCCEEECCCCcCcccCcccCCCCCCCEEECCCC-cceecCccccccCcCCEEECCCC-ccceeC--chhhccCCE
Confidence            888899998887654          3688999999886 46666655567899999999995 577776  678899999


Q ss_pred             EEeeCCc
Q 037759          448 LELWWPE  454 (479)
Q Consensus       448 L~l~~c~  454 (479)
                      |++++++
T Consensus       344 L~l~~N~  350 (390)
T 3o6n_A          344 LTLSHND  350 (390)
T ss_dssp             EECCSSC
T ss_pred             EEcCCCC
Confidence            9999987
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 479
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 0.004
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Ngr ectodomain-like
domain: Decorin
species: Cow (Bos taurus) [TaxId: 9913]

 Score = 36.9 bits (84), Expect = 0.004
 Identities = 42/267 (15%), Positives = 83/267 (31%), Gaps = 18/267 (6%)

Query: 187 FKFLRVLDLGSLVLIRY-PSEIEYVFLLRYLNLNIPSLKSLPSSLLNSLLNLYTLDMPFS 245
            K L  L L +  + +  P     +  L  L L+   LK LP  +  +L  L   +   +
Sbjct: 54  LKNLHTLILINNKISKISPGAFAPLVKLERLYLSKNQLKELPEKMPKTLQELRVHENEIT 113

Query: 246 YIDHTADEFWKMSKLRYLNFGSITLSAHPGKYCGSLENLDFISALHPCCCPEDILGRLPN 305
            +  +         +  L    +  S         ++ L +I  +          G  P+
Sbjct: 114 KVRKSVFNGLNQMIVVELGTNPLKSSGIENGAFQGMKKLSYIR-IADTNITTIPQGLPPS 172

Query: 306 LQNIQIWGDLIYYQSLLSKILYRLSCLESLKLAKESKIPRRSNIILAKYQFPPSLTHLSF 365
           L  + + G+ I      +  L  L+ L  L L+  S     +          P L  L  
Sbjct: 173 LTELHLDGNKITKVD--AASLKGLNNLAKLGLSFNSISAVDNGS----LANTPHLRELHL 226

Query: 366 LNIELMDDPMPALEKLAVLRKLACSSDGFPKLKVLHLKSMLWLQEWTMGIRAMPKLECSI 425
            N +L+  P   L     ++ +   ++    +         +  +               
Sbjct: 227 NNNKLVKVPG-GLADHKYIQVVYLHNNNISAIGSNDFCPPGYNTK-------KASYSGVS 278

Query: 426 L--NPCAHLKMIPEQLWCLKSLNKLEL 450
           L  NP  + ++ P    C+     ++L
Sbjct: 279 LFSNPVQYWEIQPSTFRCVYVRAAVQL 305

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query479
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.76
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.72
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.71
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.68
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.66
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.65
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.59
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.59
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.58
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.51
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.5
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.5
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.48
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.48
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.47
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.47
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.46
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.38
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.33
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.32
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.32
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.3
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.3
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.29
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.29
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.24
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.15
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.12
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.04
d1z7xw1 460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.04
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.84
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 98.84
d1z7xw1 460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 98.82
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.78
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 98.58
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 98.39
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.11
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.48
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.22
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 96.66
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 96.5
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 95.92
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]

Probab=99.76  E-value=1.5e-17  Score=162.50  Aligned_cols=65  Identities=15%  Similarity=0.164  Sum_probs=37.3

Q ss_pred             hCcCCceeEEEecCCcCccCchhhcccccCCeeecCCCCCccCChhHHhcCcCCcEEecCCCcccccc
Q 037759          184 YKMFKFLRVLDLGSLVLIRYPSEIEYVFLLRYLNLNIPSLKSLPSSLLNSLLNLYTLDMPFSYIDHTA  251 (479)
Q Consensus       184 ~~~l~~L~~L~L~~~~l~~lp~~l~~L~~L~~L~L~~~~l~~lp~~i~~~l~~L~~L~l~~~~l~~lp  251 (479)
                      +..+++|++|++++|+++.+|. ++++++|++|++++|.+..+++ + +++++|+.|++.++.+..++
T Consensus        62 l~~L~nL~~L~Ls~N~l~~l~~-l~~L~~L~~L~L~~n~i~~i~~-l-~~l~~L~~L~~~~~~~~~~~  126 (384)
T d2omza2          62 VEYLNNLTQINFSNNQLTDITP-LKNLTKLVDILMNNNQIADITP-L-ANLTNLTGLTLFNNQITDID  126 (384)
T ss_dssp             GGGCTTCCEEECCSSCCCCCGG-GTTCTTCCEEECCSSCCCCCGG-G-TTCTTCCEEECCSSCCCCCG
T ss_pred             cccCCCCCEEeCcCCcCCCCcc-ccCCcccccccccccccccccc-c-cccccccccccccccccccc
Confidence            4555666666666666655542 5566666666666666655543 4 56666666666555444443
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure