Citrus Sinensis ID: 037778


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-----
PIRRRRLKLYRAALTGDWAVARGIYDVHEGEIRAPISKRKDTALHIAAAAKQYGFVKELVQRMEPGDLAQENNVGYTALFFAAASGMVELAREIMTHNKAIATEQDDKRVLPIDLAASLGHEDMVVYLYGQTKNSLNDEDRSHLLVTLIQTDLYDVALRVFEDLHEKSAIGRAANEETALHALARKNLNYSHFTKQYQRGFFSAKDIENKRQKALKLVQRLWEKVVLLSDSRISNLIAEPELIFDAARQGNLEFLLILIREYPDLIWNIDENGYTIFHTAVLHRRKRIFKLIYQIGAAKDLILKFEDPKKNNILHLAAMLPPQDRLNIVSGAALQMQRELLWFEEVEKAVQRRSAEAKNEDGLSPRALFTRKHENLREQGEKWMKDTATSCMLVATLIATVVFAAAFTVPGGNKGDTGFPFFLEKVSFKIFAISEAISLVSSSASIVNFLSILTSRYTEKDFLRLLPKKLLIGLATLFVSIAAMMVVFSAAFFIVFKDSRLWVAILVTVIASIPVIMFIVQHCQLLCDVVRSTYVSNSLFQRDKISLFHKEDEASERQRMTKLCNGRLAIQCLNV
ccccccHHHHHHHHcccHHHHHHHHHHcccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccccHHHHHHHcccHHHHHHHHHcccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccHHHHHHHHcccHHHHHHHHHHccHHHHHccccccccHHHHHHHccccccHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHcccHHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHccccHHHHHcccccccccHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccHHHHHHHHHcccccEEEEEccc
cccccccHHHHHHHcccHHHHHHHHHccccccEEEcccccccHHHHHHHcccHHHHHHHHHcccccHHcccccccccHHHHHHHcccHHHHHHHHHcccccccccccccccHHHHHHHcccHHHHHHHHHccccHccccccccHHHHHHHccHHHHHHHHHHccccHHHHHHHcccccHHHHHHccccccEHHHHcccccHHHHHccccccHHHHHHHHccHHHHHHHcccccccccccccHHHHHHHcccHHHHHHHHHccccHHcccccccccHHHHHHHcccHHHHHHHHHcccccccEEEccccccccHHHHHHHcccHHHHHHHcccHHHHHHHcccccHHHHHccHHHHHHHHccccccHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccEEccccHHEEEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccHHHHHHHHHHcccEEEEEEc
PIRRRRLKLYRAALTGDwavargiydvhegeirapiskrKDTALHIAAAAKQYGFVKELVQrmepgdlaqennvGYTALFFAAASGMVELAREIMTHNKaiateqddkrvlpIDLAASLGHEDMVVYLYGQtknslndedRSHLLVTLIQTDLYDVALRVFEDLHEKSAIGRAANEETALHALARKNLNYSHFTKQYqrgffsakDIENKRQKALKLVQRLWEKVVLLSDsrisnliaepeLIFDAARQGNLEFLLILIREYPdliwnidengytIFHTAVLHRRKRIFKLIYQIGAAKDLilkfedpkknnilhlaamlppqdrlnIVSGAALQMQRELLWFEEVEKAVQRRSAeaknedglspralftRKHENLREQGEKWMKDTATSCMLVATLIATVVFAAaftvpggnkgdtgfpffLEKVSFKIFAISEAISLVSSSASIVNFLSILTSRYTEKDFLRLLPKKLLIGLATLFVSIAAMMVVFSAAFFIVFKDSRLWVAILVTVIASIPVIMFIVQHCQLLCDVVRSTYvsnslfqrdkislfhkedEASERQRMTKLCNGRLAIQCLNV
pirrrrlklyraaltgdwavargiydvhEGEIRAPISKRKDTALHIAAAAKQYGFVKELVQRMEPGDLAQENNVGYTALFFAAASGMVELAREIMTHNKaiateqddkrvLPIDLAASLGHEDMVVYLYGQTKNSLNDEDRSHLLVTLIQTDLYDVALRVFEDLHEKSAIGRAANEETALHALARKNLNYSHFTKQYQRGFFSAKDIENKRQKALKLVQRLWEKVVLLSDSRISNLIAEPELIFDAARQGNLEFLLILIREYPDLIWNIDENGYTIFHTAVLHRRKRIFKLIYQIGAAKDLILKFEDPKKNNILHLAAMLPPQDRLNIVSGAALQMQRELLWFEEVEKAVQRRsaeaknedglspralftrkheNLREQGEKWMKDTATSCMLVATLIATVVFAAAFTVPGGNKGDTGFPFFLEKVSFKIFAISEAISLVSSSASIVNFLSILTSRYTEKDFLRLLPKKLLIGLATLFVSIAAMMVVFSAAFFIVFKDSRLWVAILVTVIASIPVIMFIVQHCQLLCDVVRSTYVSNslfqrdkislfhkedeaseRQRMtklcngrlaiqclnv
PIrrrrlklyraalTGDWAVARGIYDVHEGEIRAPISKRKDTALHIAAAAKQYGFVKELVQRMEPGDLAQENNVGYTALFFAAASGMVELAREIMTHNKAIATEQDDKRVLPIDLAASLGHEDMVVYLYGQTKNSLNDEDRSHLLVTLIQTDLYDVALRVFEDLHEKSAIGRAANEETALHALARKNLNYSHFTKQYQRGFFSAKDIENKRQKALKLVQRLWEKVVLLSDSRISNLIAEPELIFDAARQGNLEFLLILIREYPDLIWNIDENGYTIFHTAVLHRRKRIFKLIYQIGAAKDLILKFEDPKKNNILHLAAMLPPQDRLNIVSGAALQMQRELLWFEEVEKAVQRRSAEAKNEDGLSPRALFTRKHENLREQGEKWMKDTATSCMlvatliatvvfaaaftvPGGNKGDTGFPFFLEKVSFKIFaiseaislvsssasiVNFLSILTSRYTEkdflrllpkklliglatlFvsiaammvvfsaaffivfKDSRLWVAILVTVIASIPVIMFIVQHCQLLCDVVRSTYVSNSLFQRDKISLFHKEDEASERQRMTKLCNGRLAIQCLNV
******LKLYRAALTGDWAVARGIYDVHEGEIRAPISKRKDTALHIAAAAKQYGFVKELVQRMEPGDLAQENNVGYTALFFAAASGMVELAREIMTHNKAIATEQDDKRVLPIDLAASLGHEDMVVYLYGQTKNSLNDEDRSHLLVTLIQTDLYDVALRVFEDLHEKSAIGRAANEETALHALARKNLNYSHFTKQYQRGFFSAKDIENKRQKALKLVQRLWEKVVLLSDSRISNLIAEPELIFDAARQGNLEFLLILIREYPDLIWNIDENGYTIFHTAVLHRRKRIFKLIYQIGAAKDLILKFEDPKKNNILHLAAMLPPQDRLNIVSGAALQMQRELLWFEEV*****************************************ATSCMLVATLIATVVFAAAFTVPGGNKGDTGFPFFLEKVSFKIFAISEAISLVSSSASIVNFLSILTSRYTEKDFLRLLPKKLLIGLATLFVSIAAMMVVFSAAFFIVFKDSRLWVAILVTVIASIPVIMFIVQHCQLLCDVVRSTYVSNSLFQRDKISLFH*************LCNGRLAIQC***
**RRRRLKLYRAALTGDWAVARGIYDVHEGEIRAPISKRKDTALHIAAAAKQYGFVKELVQRMEPGDLAQENNVGYTALFFAAASGMVELAREIMTHNKAIATEQDDKRVLPIDLAASLGHEDMVVYLYGQTKNSLNDEDRSHLLVTLIQTDLYDVALRVFEDLHEKSAIGRAANEETALHALARKNLNYSHFTKQYQRGFFSAKDIENKRQKALKLVQRLWEKVVLLSDSRISNLIAEPELIFDAARQGNLEFLLILIREYPDLIWNIDENGYTIFHTAVLHRRKRIFKLIYQIGAAKDLILKFEDPKKNNILHLAAMLPPQDRLNIVSGAALQMQRELLWFEEVEKAVQRRSAEAKNEDGLSP********************DTATSCMLVATLIATVVFAAAFTVPGGNKGDTGFPFFLEKVSFKIFAISEAISLVSSSASIVNFLSILTSRYTEKDFLRLLPKKLLIGLATLFVSIAAMMVVFSAAFFIVFKDSRLWVAILVTVIASIPVIMFIVQHCQLLCDVVRSTYVS************************TKLCNGRLAIQCLNV
PIRRRRLKLYRAALTGDWAVARGIYDVHEGEIRAPISKRKDTALHIAAAAKQYGFVKELVQRMEPGDLAQENNVGYTALFFAAASGMVELAREIMTHNKAIATEQDDKRVLPIDLAASLGHEDMVVYLYGQTKNSLNDEDRSHLLVTLIQTDLYDVALRVFEDLHEKSAIGRAANEETALHALARKNLNYSHFTKQYQRGFFSAKDIENKRQKALKLVQRLWEKVVLLSDSRISNLIAEPELIFDAARQGNLEFLLILIREYPDLIWNIDENGYTIFHTAVLHRRKRIFKLIYQIGAAKDLILKFEDPKKNNILHLAAMLPPQDRLNIVSGAALQMQRELLWFEEVEK**************LSPRALFTRKHENLREQGEKWMKDTATSCMLVATLIATVVFAAAFTVPGGNKGDTGFPFFLEKVSFKIFAISEAISLVSSSASIVNFLSILTSRYTEKDFLRLLPKKLLIGLATLFVSIAAMMVVFSAAFFIVFKDSRLWVAILVTVIASIPVIMFIVQHCQLLCDVVRSTYVSNSLFQRDKISLFHKEDEASERQRMTKLCNGRLAIQCLNV
****RRLKLYRAALTGDWAVARGIYDVHEGEIRAPISKRKDTALHIAAAAKQYGFVKELVQRMEPGDLAQENNVGYTALFFAAASGMVELAREIMTHNKAIATEQDDKRVLPIDLAASLGHEDMVVYLYGQTKNSLNDEDRSHLLVTLIQTDLYDVALRVFEDLHEKSAIGRAANEETALHALARKNLNYSHFTKQYQRGFFSAKDIENKRQKALKLVQRLWEKVVLLSDSRISNLIAEPELIFDAARQGNLEFLLILIREYPDLIWNIDENGYTIFHTAVLHRRKRIFKLIYQIGAAKDLILKFEDPKKNNILHLAAMLPPQDRLNIVSGAALQMQRELLWFEEVEKAVQRRSAEAKNEDGLSPRALFTRKHENLREQGEKWMKDTATSCMLVATLIATVVFAAAFTVPGGNKGDTGFPFFLEKVSFKIFAISEAISLVSSSASIVNFLSILTSRYTEKDFLRLLPKKLLIGLATLFVSIAAMMVVFSAAFFIVFKDSRLWVAILVTVIASIPVIMFIVQHCQLLCDVVRSTYVSNSLFQ*DKISL*****EASERQRMTKLCNGRLAIQCLNV
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHoooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PIRRRRLKLYRAALTGDWAVARGIYDVHEGEIRAPISKRKDTALHIAAAAKQYGFVKELVQRMEPGDLAQENNVGYTALFFAAASGMVELAREIMTHNKAIATEQDDKRVLPIDLAASLGHEDMVVYLYGQTKNSLNDEDRSHLLVTLIQTDLYDVALRVFEDLHEKSAIGRAANEETALHALARKNLNYSHFTKQYQRGFFSAKDIENKRQKALKLVQRLWEKVVLLSDSRISNLIAEPELIFDAARQGNLEFLLILIREYPDLIWNIDENGYTIFHTAVLHRRKRIFKLIYQIGAAKDLILKFEDPKKNNILHLAAMLPPQDRLNIVSGAALQMQRELLWFEEVEKAVQRRSAEAKNEDGLSPRALFTRKHENLREQGEKWMKDTATSCMLVATLIATVVFAAAFTVPGGNKGDTGFPFFLEKVSFKIFAISEAISLVSSSASIVNFLSILTSRYTEKDFLRLLPKKLLIGLATLFVSIAAMMVVFSAAFFIVFKDSRLWVAILVTVIASIPVIMFIVQHCQLLCDVVRSTYVSNSLFQRDKISLFHKEDEASERQRMTKLCNGRLAIQCLNV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query575 2.2.26 [Sep-21-2011]
Q9C7A2590 Ankyrin repeat-containing no no 0.443 0.432 0.291 2e-15
Q6AWW5524 Ankyrin repeat-containing no no 0.768 0.843 0.221 5e-09
O75179 2603 Ankyrin repeat domain-con no no 0.246 0.054 0.262 0.0002
Q04749426 Target of rapamycin compl yes no 0.140 0.190 0.390 0.0003
Q02357 1862 Ankyrin-1 OS=Mus musculus yes no 0.154 0.047 0.336 0.0003
P16157 1881 Ankyrin-1 OS=Homo sapiens no no 0.154 0.047 0.336 0.0003
Q99NH0 2603 Ankyrin repeat domain-con no no 0.246 0.054 0.255 0.0005
Q9VCA8 4001 Ankyrin repeat and KH dom yes no 0.149 0.021 0.329 0.0006
Q8IWZ3 2542 Ankyrin repeat and KH dom yes no 0.172 0.038 0.323 0.0007
>sp|Q9C7A2|Y3236_ARATH Ankyrin repeat-containing protein At3g12360 OS=Arabidopsis thaliana GN=At3g12360 PE=2 SV=1 Back     alignment and function desciption
 Score = 84.7 bits (208), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 91/312 (29%), Positives = 140/312 (44%), Gaps = 57/312 (18%)

Query: 246 AARQGNLEFLLILIREYPDLIWNIDENGYTIFHTAVLHRRKRIFKLIYQIGAAKDLILKF 305
           AARQG++E +  L+ + P L   ID+ G T  H AV  +   + KL+     A   I+  
Sbjct: 239 AARQGHVEVIKALLSKDPQLARRIDKKGQTALHMAVKGQSSEVVKLLLD---ADPAIVMQ 295

Query: 306 EDPKKNNILHLAA-----------MLPPQDRLNIVS---GAALQMQRELLWFEE---VEK 348
            D   N  LH+A            +  P    N ++     AL +   L   EE   +++
Sbjct: 296 PDKSCNTALHVATRKKRAEIVELLLSLPDTNANTLTRDHKTALDIAEGLPLSEESSYIKE 355

Query: 349 AVQRRSAEAKNE-----DGLSPRALFT--------------RKHEN-------LREQGEK 382
            + R  A   NE     D L  R+  T              R ++N       LR+   +
Sbjct: 356 CLARSGALRANELNQPRDEL--RSTVTQIKNDVHIQLEQTKRTNKNVHNISKELRKLHRE 413

Query: 383 WMKDTATSCMLVATLIATVVFAAAFTVPGGNKGDTGFPFFLEKVSFKIFAISEAISLVSS 442
            + +   S  +VA L ATV FAA FTVPGG+  D G    + + SFKIF I  A++L +S
Sbjct: 414 GINNATNSVTVVAVLFATVAFAAIFTVPGGDNND-GSAVVVGRASFKIFFIFNALALFTS 472

Query: 443 SASIVNFLSILTSRY-TEKDFLRLLPKKLLIGLATLFVSIAAMMVVFSAAFFIVFKDSRL 501
            A +V  ++++      EK  + ++ K  L+ LA++  S+A     F A+ +IV      
Sbjct: 473 LAVVVVQITLVRGETKAEKRVVEVINK--LMWLASMCTSVA-----FLASSYIVVGRKNE 525

Query: 502 WVAILVTVIASI 513
           W A LVTV+  +
Sbjct: 526 WAAELVTVVGGV 537





Arabidopsis thaliana (taxid: 3702)
>sp|Q6AWW5|Y5262_ARATH Ankyrin repeat-containing protein At5g02620 OS=Arabidopsis thaliana GN=At5g02620 PE=1 SV=1 Back     alignment and function description
>sp|O75179|ANR17_HUMAN Ankyrin repeat domain-containing protein 17 OS=Homo sapiens GN=ANKRD17 PE=1 SV=3 Back     alignment and function description
>sp|Q04749|AVO2_YEAST Target of rapamycin complex 2 subunit AVO2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AVO2 PE=1 SV=1 Back     alignment and function description
>sp|Q02357|ANK1_MOUSE Ankyrin-1 OS=Mus musculus GN=Ank1 PE=1 SV=2 Back     alignment and function description
>sp|P16157|ANK1_HUMAN Ankyrin-1 OS=Homo sapiens GN=ANK1 PE=1 SV=3 Back     alignment and function description
>sp|Q99NH0|ANR17_MOUSE Ankyrin repeat domain-containing protein 17 OS=Mus musculus GN=Ankrd17 PE=1 SV=2 Back     alignment and function description
>sp|Q9VCA8|ANKHM_DROME Ankyrin repeat and KH domain-containing protein mask OS=Drosophila melanogaster GN=mask PE=1 SV=2 Back     alignment and function description
>sp|Q8IWZ3|ANKH1_HUMAN Ankyrin repeat and KH domain-containing protein 1 OS=Homo sapiens GN=ANKHD1 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query575
224120488610 predicted protein [Populus trichocarpa] 0.953 0.898 0.516 1e-152
359472754 789 PREDICTED: ankyrin repeat-containing pro 0.933 0.680 0.497 1e-142
147784800 1697 hypothetical protein VITISV_029434 [Viti 0.932 0.315 0.465 1e-137
297737987 1855 unnamed protein product [Vitis vinifera] 0.906 0.280 0.486 1e-136
359483665 762 PREDICTED: ankyrin repeat-containing pro 0.932 0.703 0.471 1e-135
224136692 743 predicted protein [Populus trichocarpa] 0.937 0.725 0.462 1e-134
225425076563 PREDICTED: ankyrin repeat-containing pro 0.88 0.898 0.489 1e-131
359473665602 PREDICTED: LOW QUALITY PROTEIN: ankyrin 0.939 0.897 0.485 1e-129
147860696 891 hypothetical protein VITISV_011174 [Viti 0.916 0.591 0.452 1e-126
356532648 739 PREDICTED: uncharacterized protein LOC10 0.911 0.709 0.464 1e-125
>gi|224120488|ref|XP_002331060.1| predicted protein [Populus trichocarpa] gi|222872990|gb|EEF10121.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  544 bits (1402), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 289/560 (51%), Positives = 388/560 (69%), Gaps = 12/560 (2%)

Query: 3   RRRRLKLYRAALTGDWAVARGIYDVHEGEIRAPISKRKDTALHIAAAAKQYGFVKELVQR 62
           R+R L+LY+AAL+GDW  A GIY +  GE+ A I+KR +TALHIAAAA+   FVK+LV  
Sbjct: 46  RKRHLQLYQAALSGDWDTAEGIYKLCPGEVNARITKRGETALHIAAAAEHTHFVKQLVGM 105

Query: 63  MEPGDLAQENNVGYTALFFAAASGMVELAREIMTHNKAIATEQDDKRVLPIDLAASLGHE 122
           M    LA  ++ G TA  FAA SG+  LA+ +M     +A  +    +LPI +A  LGH 
Sbjct: 106 MSIEALAYRSSAGNTAFCFAAISGVEALAKVMMDKKPDLAMTRGRGNLLPIYMATLLGHR 165

Query: 123 DMVVYLYGQTKNSLNDEDRSHLLVTLIQTDLYDVALRVFEDLHEKSAIGRAANEETALHA 182
            MV YLY +TK  L D DR  LLV LI +D+YDVA ++ ++ H   A  R  ++ TALHA
Sbjct: 166 GMVSYLYDETKEQLTDGDRIKLLVALINSDIYDVAWKMLKE-HRGLAYARDEHQLTALHA 224

Query: 183 LARKNLNYSHFTKQYQRGFFS---------AKDIENKRQKALKLVQRLWEKVVLLSDSRI 233
            ++K+   S+   Q   GF++         A+  +   ++AL L+Q LWE+VVLL DS I
Sbjct: 225 FSQKSCMPSNVVDQSPPGFWNKCLNPCFKLAQMKKLMHKQALDLIQYLWEQVVLLDDSTI 284

Query: 234 SNLIAEP-ELIFDAARQGNLEFLLILIREYPDLIWNIDENGYTIFHTAVLHRRKRIFKLI 292
           S+ I +P  LIF AA +GNL+ L ILIR YP+LI+ +D+N Y+IFH A+L+R + I K+I
Sbjct: 285 SSQIGKPWPLIFTAAERGNLDLLTILIRLYPELIFKVDQNTYSIFHIAILNRHEDILKMI 344

Query: 293 YQIGAAKDLILKFEDPKKNNILHLAA-MLPPQDRLNIVSGAALQMQRELLWFEEVEKAVQ 351
           YQIG+ K+++  ++D + NN+LHLAA +L    RLN + GAALQ+QRELLWFEEV+K VQ
Sbjct: 345 YQIGSIKNVMTIYKDREGNNMLHLAAKVLESPSRLNAIPGAALQLQRELLWFEEVKKVVQ 404

Query: 352 RRSAEAKNEDGLSPRALFTRKHENLREQGEKWMKDTATSCMLVATLIATVVFAAAFTVPG 411
            R  E KN  G +P ALF  +H +L ++GE+WM+DTA SCMLVATLIATVVFAAAFTVPG
Sbjct: 405 PRHIEEKNFHGKTPGALFIEQHRDLMKEGEQWMRDTADSCMLVATLIATVVFAAAFTVPG 464

Query: 412 GNKGDTGFPFFLEKVSFKIFAISEAISLVSSSASIVNFLSILTSRYTEKDFLRLLPKKLL 471
           GN  D G P FL++++FK FAIS+AISLV+S++S++ FLS  TSRY E++FL  LP +L+
Sbjct: 465 GNFQDKGTPVFLKEIAFKFFAISDAISLVTSASSLLTFLSTRTSRYAEQNFLWSLPNRLI 524

Query: 472 IGLATLFVSIAAMMVVFSAAFFIVFKDSRLWVAILVTVIASIPVIMFIVQHCQLLCDVVR 531
           IGL TLF+SI AMMV F A FF+VF +  L  +I + V+AS+PVI FI QH +L  D++ 
Sbjct: 525 IGLTTLFISIGAMMVAFMATFFLVFGNKLLPYSIPIAVVASLPVIFFIWQHFRLFVDMIH 584

Query: 532 STYVSNSLFQRDKISLFHKE 551
           STY S SLF+ +K  LF K+
Sbjct: 585 STYTSRSLFKPNKSPLFSKK 604




Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|359472754|ref|XP_002276402.2| PREDICTED: ankyrin repeat-containing protein At3g12360-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|147784800|emb|CAN68568.1| hypothetical protein VITISV_029434 [Vitis vinifera] Back     alignment and taxonomy information
>gi|297737987|emb|CBI27188.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|359483665|ref|XP_003632996.1| PREDICTED: ankyrin repeat-containing protein At3g12360-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|224136692|ref|XP_002322392.1| predicted protein [Populus trichocarpa] gi|222869388|gb|EEF06519.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|225425076|ref|XP_002271486.1| PREDICTED: ankyrin repeat-containing protein At3g12360-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|359473665|ref|XP_003631341.1| PREDICTED: LOW QUALITY PROTEIN: ankyrin repeat-containing protein At3g12360-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|147860696|emb|CAN81449.1| hypothetical protein VITISV_011174 [Vitis vinifera] Back     alignment and taxonomy information
>gi|356532648|ref|XP_003534883.1| PREDICTED: uncharacterized protein LOC100814269 [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query575
TAIR|locus:2165174347 AT5G35810 "AT5G35810" [Arabido 0.587 0.974 0.388 3.4e-61
TAIR|locus:2080240574 AT3G54070 "AT3G54070" [Arabido 0.829 0.831 0.304 4.9e-53
TAIR|locus:2175413669 AT5G04700 "AT5G04700" [Arabido 0.570 0.490 0.297 6.1e-46
TAIR|locus:2180228625 AT5G04690 "AT5G04690" [Arabido 0.871 0.801 0.277 2.7e-45
TAIR|locus:2175448603 AT5G04730 "AT5G04730" [Arabido 0.594 0.567 0.300 3.3e-45
TAIR|locus:2165194282 AT5G35830 [Arabidopsis thalian 0.241 0.492 0.421 6.9e-22
TAIR|locus:2046628601 AT2G24600 "AT2G24600" [Arabido 0.436 0.417 0.237 5e-05
TAIR|locus:2075009607 AT3G09550 [Arabidopsis thalian 0.186 0.176 0.259 6.3e-05
UNIPROTKB|F1MY81 1136 ANK1 "Uncharacterized protein" 0.459 0.232 0.277 6.9e-05
UNIPROTKB|F1SE30 1885 ANK1 "Uncharacterized protein" 0.459 0.140 0.277 0.00012
TAIR|locus:2165174 AT5G35810 "AT5G35810" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 626 (225.4 bits), Expect = 3.4e-61, P = 3.4e-61
 Identities = 134/345 (38%), Positives = 184/345 (53%)

Query:   211 RQKALKLVQRLWEKVVLLSDSRISNLI-AEPELIFDAARQGNLEFLLILIREYPDLIWNI 269
             R  A  +V+ LW  V+ L    IS  + + P L+FDAA+ GNLE LLILIR YPDLIW +
Sbjct:     2 RTLAHMVVEELWSFVIKLPVEEISQFVGSSPMLLFDAAQSGNLELLLILIRSYPDLIWTV 61

Query:   270 DENGYTIFHTAVLHRRKRIFKLIYQIGAAKDLILKFEDPKKN-NILHLAAMLPPQDRLNI 328
             D    ++FH A ++R ++IF  IY++GA KDLI  +++ + N N+LHL A LPP +RL +
Sbjct:    62 DHKNQSLFHIAAINRHEKIFNRIYELGAIKDLIAMYKEKESNDNLLHLVARLPPPNRLQV 121

Query:   329 VSGAALQMQRELLWFEEVEKAVQRRSAEAKNEDGLSPRALFTRKHENLREQGEKWMKDTA 388
             VSGAALQMQRE+LW++ V++ V R   + KN+       LFT++H+NLR++GEKWMK+TA
Sbjct:   122 VSGAALQMQREILWYKAVKEIVPRVYIKTKNKKEEVAHDLFTKEHDNLRKEGEKWMKETA 181

Query:   389 TSCMXXXXXXXXXXXXXXXXXPGGN--KGDT---GFPFFLEKVSFKIFXXXXXXXXXXXX 443
             T+C+                 PGGN   GD    GFP F ++  F++F            
Sbjct:   182 TACILVSTLIATVVFAAAFTLPGGNDTSGDIKTLGFPTFRKEFWFEVFIISDSVALLSSV 241

Query:   444 XXXVNFLSILTSRYTEXXXXXXXXXXXXXXXXXXFXXXXXXXXXXXXXXXXXXKDSRLWV 503
                + FLSILTSRY E                  F                       W 
Sbjct:   242 TSIMIFLSILTSRYAEASFQTTLPTKLMLGLLALFVSIISMVLAFTATLILIRDQEPKWS 301

Query:   504 AILVTVIASIPVIMFIVQHCQLLCDVVRSTYVSNSLFQRDKISLF 548
              IL+  +AS   + F+V H QL  D +RS Y+S  LF   K  L+
Sbjct:   302 LILLVYVASATALSFVVLHFQLWFDTLRSAYLSKFLFHGRKSGLY 346




GO:0003674 "molecular_function" evidence=ND
GO:0008150 "biological_process" evidence=ND
TAIR|locus:2080240 AT3G54070 "AT3G54070" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2175413 AT5G04700 "AT5G04700" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2180228 AT5G04690 "AT5G04690" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2175448 AT5G04730 "AT5G04730" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2165194 AT5G35830 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2046628 AT2G24600 "AT2G24600" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2075009 AT3G09550 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|F1MY81 ANK1 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1SE30 ANK1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query575
pfam13962114 pfam13962, PGG, Domain of unknown function 1e-28
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 2e-11
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 3e-11
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 1e-07
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 4e-06
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 5e-06
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 2e-05
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 1e-04
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 6e-04
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 0.001
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 0.002
>gnl|CDD|222475 pfam13962, PGG, Domain of unknown function Back     alignment and domain information
 Score =  109 bits (275), Expect = 1e-28
 Identities = 42/121 (34%), Positives = 62/121 (51%), Gaps = 13/121 (10%)

Query: 381 EKWMKDTATSCMLVATLIATVVFAAAFTVPGG-----NKGDTGFPFFLEK-VSFKIFAIS 434
            +W++ T  S ++VATLIATV FAA FT PGG          G P    K   FK F +S
Sbjct: 1   SEWLEKTRNSLLVVATLIATVTFAAGFTPPGGYWQDDGGHHAGTPILAGKPRRFKAFFVS 60

Query: 435 EAISLVSSSASIVNFLSILTSRYTEKDFLRLLPKKLLIGLATLFVSIAAMMVVFSAAFFI 494
             I+ V+S  +++  L I+ S             +LL  L  L++S+ ++MV F+A  + 
Sbjct: 61  NTIAFVASLVAVILLLYIVPSFSRRL-------PRLLALLTLLWLSLLSLMVAFAAGSYR 113

Query: 495 V 495
           V
Sbjct: 114 V 114


The PGG domain is named for the highly conserved sequence motif found at the startt of the domain. The function is not known. Length = 114

>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 575
KOG0510 929 consensus Ankyrin repeat protein [General function 100.0
PHA02876682 ankyrin repeat protein; Provisional 100.0
PHA02946446 ankyin-like protein; Provisional 100.0
PHA02946446 ankyin-like protein; Provisional 100.0
PHA02874434 ankyrin repeat protein; Provisional 100.0
PHA02730672 ankyrin-like protein; Provisional 100.0
PHA02716764 CPXV016; CPX019; EVM010; Provisional 100.0
PHA03095471 ankyrin-like protein; Provisional 100.0
PHA02876682 ankyrin repeat protein; Provisional 100.0
PHA02716764 CPXV016; CPX019; EVM010; Provisional 100.0
KOG0510 929 consensus Ankyrin repeat protein [General function 100.0
PHA03100480 ankyrin repeat protein; Provisional 100.0
PHA02874434 ankyrin repeat protein; Provisional 100.0
PHA03100480 ankyrin repeat protein; Provisional 100.0
PHA03095471 ankyrin-like protein; Provisional 100.0
PHA02878477 ankyrin repeat protein; Provisional 100.0
PHA02917661 ankyrin-like protein; Provisional 100.0
PHA02878477 ankyrin repeat protein; Provisional 100.0
PHA02989494 ankyrin repeat protein; Provisional 100.0
KOG4412226 consensus 26S proteasome regulatory complex, subun 100.0
PHA02875413 ankyrin repeat protein; Provisional 100.0
PHA02875413 ankyrin repeat protein; Provisional 100.0
PHA02791284 ankyrin-like protein; Provisional 100.0
PHA02791284 ankyrin-like protein; Provisional 100.0
KOG4177 1143 consensus Ankyrin [Cell wall/membrane/envelope bio 100.0
PHA02989494 ankyrin repeat protein; Provisional 100.0
KOG4177 1143 consensus Ankyrin [Cell wall/membrane/envelope bio 100.0
KOG0508615 consensus Ankyrin repeat protein [General function 100.0
PHA02730672 ankyrin-like protein; Provisional 100.0
PHA02798489 ankyrin-like protein; Provisional 100.0
PHA02798489 ankyrin-like protein; Provisional 100.0
PHA02917661 ankyrin-like protein; Provisional 100.0
KOG4412226 consensus 26S proteasome regulatory complex, subun 100.0
KOG0508615 consensus Ankyrin repeat protein [General function 99.98
PHA02792631 ankyrin-like protein; Provisional 99.98
KOG0509600 consensus Ankyrin repeat and DHHC-type Zn-finger d 99.97
KOG0509 600 consensus Ankyrin repeat and DHHC-type Zn-finger d 99.97
PHA02792631 ankyrin-like protein; Provisional 99.97
PHA02859209 ankyrin repeat protein; Provisional 99.95
PHA02859209 ankyrin repeat protein; Provisional 99.94
TIGR00870 743 trp transient-receptor-potential calcium channel p 99.93
PHA02795437 ankyrin-like protein; Provisional 99.93
PHA02795437 ankyrin-like protein; Provisional 99.92
PF13962113 PGG: Domain of unknown function 99.92
KOG0502296 consensus Integral membrane ankyrin-repeat protein 99.92
KOG0507 854 consensus CASK-interacting adaptor protein (caskin 99.91
KOG4369 2131 consensus RTK signaling protein MASK/UNC-44 [Signa 99.9
KOG0502296 consensus Integral membrane ankyrin-repeat protein 99.9
PLN03192823 Voltage-dependent potassium channel; Provisional 99.9
TIGR00870 743 trp transient-receptor-potential calcium channel p 99.9
KOG0507 854 consensus CASK-interacting adaptor protein (caskin 99.9
KOG4369 2131 consensus RTK signaling protein MASK/UNC-44 [Signa 99.89
PLN03192823 Voltage-dependent potassium channel; Provisional 99.89
KOG0505527 consensus Myosin phosphatase, regulatory subunit [ 99.85
KOG0505527 consensus Myosin phosphatase, regulatory subunit [ 99.85
PHA02741169 hypothetical protein; Provisional 99.84
KOG3676 782 consensus Ca2+-permeable cation channel OSM-9 and 99.83
PHA02743166 Viral ankyrin protein; Provisional 99.82
KOG0514452 consensus Ankyrin repeat protein [General function 99.82
PHA02736154 Viral ankyrin protein; Provisional 99.81
KOG0514452 consensus Ankyrin repeat protein [General function 99.81
KOG0512228 consensus Fetal globin-inducing factor (contains a 99.81
PHA02743166 Viral ankyrin protein; Provisional 99.81
PHA02741169 hypothetical protein; Provisional 99.8
PHA02884300 ankyrin repeat protein; Provisional 99.8
PHA02884300 ankyrin repeat protein; Provisional 99.79
PHA02736154 Viral ankyrin protein; Provisional 99.75
KOG0195448 consensus Integrin-linked kinase [Signal transduct 99.74
KOG0512228 consensus Fetal globin-inducing factor (contains a 99.74
KOG3676782 consensus Ca2+-permeable cation channel OSM-9 and 99.71
KOG0195448 consensus Integrin-linked kinase [Signal transduct 99.69
PF1279689 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 99.66
cd00204126 ANK ankyrin repeats; ankyrin repeats mediate prote 99.66
cd00204126 ANK ankyrin repeats; ankyrin repeats mediate prote 99.64
PF1279689 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 99.64
KOG4214117 consensus Myotrophin and similar proteins [Transcr 99.58
KOG4214117 consensus Myotrophin and similar proteins [Transcr 99.47
COG0666235 Arp FOG: Ankyrin repeat [General function predicti 99.45
COG0666235 Arp FOG: Ankyrin repeat [General function predicti 99.43
PF1363754 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 99.39
KOG1710396 consensus MYND Zn-finger and ankyrin repeat protei 99.39
KOG0515752 consensus p53-interacting protein 53BP/ASPP, conta 99.34
PF1385756 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 99.33
PF1385756 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 99.32
PTZ00322664 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas 99.3
PF1363754 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 99.29
PTZ00322664 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas 99.27
KOG1710396 consensus MYND Zn-finger and ankyrin repeat protei 99.2
KOG0515752 consensus p53-interacting protein 53BP/ASPP, conta 99.2
KOG07821004 consensus Predicted diacylglycerol kinase [Signal 99.0
KOG0783 1267 consensus Uncharacterized conserved protein, conta 98.82
KOG0506622 consensus Glutaminase (contains ankyrin repeat) [A 98.75
KOG0818669 consensus GTPase-activating proteins of the GIT fa 98.57
KOG0818669 consensus GTPase-activating proteins of the GIT fa 98.57
KOG0506622 consensus Glutaminase (contains ankyrin repeat) [A 98.56
PF1360630 Ank_3: Ankyrin repeat 98.51
KOG0522560 consensus Ankyrin repeat protein [General function 98.5
KOG3609 822 consensus Receptor-activated Ca2+-permeable cation 98.5
PF0002333 Ank: Ankyrin repeat Hereditary spherocytosis; Inte 98.48
PF1360630 Ank_3: Ankyrin repeat 98.42
KOG0522560 consensus Ankyrin repeat protein [General function 98.39
KOG07821004 consensus Predicted diacylglycerol kinase [Signal 98.38
PF0002333 Ank: Ankyrin repeat Hereditary spherocytosis; Inte 98.33
KOG0783 1267 consensus Uncharacterized conserved protein, conta 98.3
KOG3609 822 consensus Receptor-activated Ca2+-permeable cation 98.21
KOG0705749 consensus GTPase-activating protein Centaurin gamm 98.16
KOG0705749 consensus GTPase-activating protein Centaurin gamm 98.05
KOG0520975 consensus Uncharacterized conserved protein, conta 98.01
KOG0520975 consensus Uncharacterized conserved protein, conta 97.8
KOG0511516 consensus Ankyrin repeat protein [General function 97.79
KOG0521785 consensus Putative GTPase activating proteins (GAP 97.76
KOG2384223 consensus Major histocompatibility complex protein 97.74
KOG2384223 consensus Major histocompatibility complex protein 97.74
KOG0521785 consensus Putative GTPase activating proteins (GAP 97.69
KOG0511516 consensus Ankyrin repeat protein [General function 97.58
smart0024830 ANK ankyrin repeats. Ankyrin repeats are about 33 96.09
smart0024830 ANK ankyrin repeats. Ankyrin repeats are about 33 95.93
KOG2505591 consensus Ankyrin repeat protein [General function 95.3
KOG2505591 consensus Ankyrin repeat protein [General function 95.03
PF03158192 DUF249: Multigene family 530 protein; InterPro: IP 94.55
PF06128284 Shigella_OspC: Shigella flexneri OspC protein; Int 92.94
PF06128284 Shigella_OspC: Shigella flexneri OspC protein; Int 92.35
PF03158192 DUF249: Multigene family 530 protein; InterPro: IP 90.17
cd07920322 Pumilio Pumilio-family RNA binding domain. Puf rep 89.23
PF1192976 DUF3447: Domain of unknown function (DUF3447); Int 89.03
cd07920322 Pumilio Pumilio-family RNA binding domain. Puf rep 88.44
PF1192976 DUF3447: Domain of unknown function (DUF3447); Int 87.44
>KOG0510 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
Probab=100.00  E-value=1.7e-43  Score=361.75  Aligned_cols=310  Identities=19%  Similarity=0.203  Sum_probs=275.6

Q ss_pred             cccchHHHHHHHcCCHHHHHHHHhhCCCcccccCCCCCChHHhHHHHcCCHHHHHHHHHcCCCCCccccccCCChHHHHH
Q 037778            3 RRRRLKLYRAALTGDWAVARGIYDVHEGEIRAPISKRKDTALHIAAAAKQYGFVKELVQRMEPGDLAQENNVGYTALFFA   82 (575)
Q Consensus         3 ~~~~t~L~~Aa~~g~~~~v~~lL~~~~~~~~~~~~~~g~TpLh~Aa~~g~~~~v~~Ll~~~~~~~l~~~d~~g~TpLh~A   82 (575)
                      ..|++|||+|+....++.++.+++ .|++.... +.++.+|+|+|+..|+.+..+.|+++  +.|++..|..|.||||.|
T Consensus        86 ~~~n~~l~~a~~~~~~~~i~~Lls-~gad~~~~-n~~~~aplh~A~~~~~~s~L~~Ll~~--~~dvnl~de~~~TpLh~A  161 (929)
T KOG0510|consen   86 SADNTPLHAAVEYNQGDKIQVLLS-YGADTPLR-NLNKNAPLHLAADSGNYSCLKLLLDY--GADVNLEDENGFTPLHLA  161 (929)
T ss_pred             cccCchhHHHhhcchHHHHHHHHh-cCCCCChh-hhhccCchhhccccchHHHHHHHHHh--cCCccccccCCCchhhHH
Confidence            478999999999999999999998 58998887 99999999999999999999999999  899999999999999999


Q ss_pred             HHcCCHHHHHHHHhcCccccccCCCCCCcHHHHHHHcCChHHHHHHHh-----ccc-cccCcCchhhHHHHHHHhCcHHH
Q 037778           83 AASGMVELAREIMTHNKAIATEQDDKRVLPIDLAASLGHEDMVVYLYG-----QTK-NSLNDEDRSHLLVTLIQTDLYDV  156 (575)
Q Consensus        83 a~~g~~~iv~~Ll~~~~~~~~~~~~~g~tpL~~A~~~g~~~~v~~Ll~-----~~~-~~~~~~~g~t~L~~a~~~~~~~~  156 (575)
                      |..++.|..+.|++.|++. ...|.+|.+|+|.|+++|..|..+..+.     +.. .+..+.++.+|||.|+..|+.++
T Consensus       162 ~~~~~~E~~k~Li~~~a~~-~K~~~~~~~~iH~aa~s~s~e~mEi~l~~~g~~r~~~in~~~n~~~~pLhlAve~g~~e~  240 (929)
T KOG0510|consen  162 ARKNKVEAKKELINKGADP-CKSDIDGNFPIHEAARSGSKECMEIFLPEHGYERQTHINFDNNEKATPLHLAVEGGDIEM  240 (929)
T ss_pred             HhcChHHHHHHHHhcCCCC-CcccCcCCchHHHHHHhcchhhhhhhhccccchhhcccccccCCCCcchhhhhhcCCHHH
Confidence            9999999989999999996 8999999999999999999999999998     333 77889999999999999999999


Q ss_pred             HHHHHHhh-------------hccccccccCCCCcHHHHHHhcCCCCcccchhhhhhhccchhhhHhhHHHHHHHHHHHH
Q 037778          157 ALRVFEDL-------------HEKSAIGRAANEETALHALARKNLNYSHFTKQYQRGFFSAKDIENKRQKALKLVQRLWE  223 (575)
Q Consensus       157 ~~~Ll~~~-------------~~~~~~~~d~~g~tpLh~a~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~e~v~~L~~  223 (575)
                      ++..|+..             ...+++..|.+|.||||+|++.|+                          .+.++.|+.
T Consensus       241 lk~~L~n~~~~a~~~~~~~~q~kelv~~~d~dg~tpLH~a~r~G~--------------------------~~svd~Ll~  294 (929)
T KOG0510|consen  241 LKMCLQNGKKIADVQLDAMQQEKELVNDEDNDGCTPLHYAARQGG--------------------------PESVDNLLG  294 (929)
T ss_pred             HHHHHhCccccchhhhHHHHHHHHHhhcccccCCchHHHHHHcCC--------------------------hhHHHHHHH
Confidence            99998761             123455679999999999999994                          899999999


Q ss_pred             HhhhCChhhhhcccCCChHHHHHHHcCCHHHHHHHHH-HCCCccccccCCCCchHHHHHHcCChhHHHHHHhcCcchhhh
Q 037778          224 KVVLLSDSRISNLIAEPELIFDAARQGNLEFLLILIR-EYPDLIWNIDENGYTIFHTAVLHRRKRIFKLIYQIGAAKDLI  302 (575)
Q Consensus       224 ~~~~~~~~~~~~~~~~~tpLh~Aa~~g~~~iv~~Ll~-~~~d~~~~~d~~G~t~Lh~A~~~~~~~iv~~Ll~~~~~~~~l  302 (575)
                      .|++++.++    ..+.||||.||..|+.+.++.|++ .+-.+.+..|..|+||||+|+++||.+++++|++.|++...+
T Consensus       295 ~Ga~I~~kn----~d~~spLH~AA~yg~~ntv~rLL~~~~~rllne~D~~g~tpLHlaa~~gH~~v~qlLl~~GA~~~~~  370 (929)
T KOG0510|consen  295 FGASINSKN----KDEESPLHFAAIYGRINTVERLLQESDTRLLNESDLHGMTPLHLAAKSGHDRVVQLLLNKGALFLNM  370 (929)
T ss_pred             cCCcccccC----CCCCCchHHHHHcccHHHHHHHHhCcCccccccccccCCCchhhhhhcCHHHHHHHHHhcChhhhcc
Confidence            999999887    344599999999999999999999 666667888999999999999999999999999999987521


Q ss_pred             hhcccCCCCcHHHHHhhCCCCCccccccchhHhhHHHHHHHHHHHHhhcccccccccCCCCChhH
Q 037778          303 LKFEDPKKNNILHLAAMLPPQDRLNIVSGAALQMQRELLWFEEVEKAVQRRSAEAKNEDGLSPRA  367 (575)
Q Consensus       303 ~~~~d~~G~T~LHlAa~~~~~~~~~~l~~~~l~~~~~l~w~~~v~~~~~~~~~~~~n~~G~Tpl~  367 (575)
                       .+.|.+|+||||+|+..|+...++.+                   +.+|+++..+|++|+|+++
T Consensus       371 -~e~D~dg~TaLH~Aa~~g~~~av~~L-------------------i~~Ga~I~~~n~~g~SA~~  415 (929)
T KOG0510|consen  371 -SEADSDGNTALHLAAKYGNTSAVQKL-------------------ISHGADIGVKNKKGKSAFD  415 (929)
T ss_pred             -cccccCCchhhhHHHHhccHHHHHHH-------------------HHcCCceeecccccccccc
Confidence             24699999999999999998877665                   4466666666666666666



>PHA02876 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02946 ankyin-like protein; Provisional Back     alignment and domain information
>PHA02946 ankyin-like protein; Provisional Back     alignment and domain information
>PHA02874 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02730 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02716 CPXV016; CPX019; EVM010; Provisional Back     alignment and domain information
>PHA03095 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02876 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02716 CPXV016; CPX019; EVM010; Provisional Back     alignment and domain information
>KOG0510 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA03100 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02874 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA03100 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA03095 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02878 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02917 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02878 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02989 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG4412 consensus 26S proteasome regulatory complex, subunit PSMD10 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA02875 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02875 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02791 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02791 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG4177 consensus Ankyrin [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>PHA02989 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG4177 consensus Ankyrin [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>KOG0508 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA02730 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02798 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02798 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02917 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG4412 consensus 26S proteasome regulatory complex, subunit PSMD10 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0508 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA02792 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0509 consensus Ankyrin repeat and DHHC-type Zn-finger domain containing proteins [General function prediction only] Back     alignment and domain information
>KOG0509 consensus Ankyrin repeat and DHHC-type Zn-finger domain containing proteins [General function prediction only] Back     alignment and domain information
>PHA02792 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02859 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02859 ankyrin repeat protein; Provisional Back     alignment and domain information
>TIGR00870 trp transient-receptor-potential calcium channel protein Back     alignment and domain information
>PHA02795 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02795 ankyrin-like protein; Provisional Back     alignment and domain information
>PF13962 PGG: Domain of unknown function Back     alignment and domain information
>KOG0502 consensus Integral membrane ankyrin-repeat protein Kidins220 (protein kinase D substrate) [General function prediction only] Back     alignment and domain information
>KOG0507 consensus CASK-interacting adaptor protein (caskin) and related proteins with ankyrin repeats and SAM domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG4369 consensus RTK signaling protein MASK/UNC-44 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0502 consensus Integral membrane ankyrin-repeat protein Kidins220 (protein kinase D substrate) [General function prediction only] Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>TIGR00870 trp transient-receptor-potential calcium channel protein Back     alignment and domain information
>KOG0507 consensus CASK-interacting adaptor protein (caskin) and related proteins with ankyrin repeats and SAM domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG4369 consensus RTK signaling protein MASK/UNC-44 [Signal transduction mechanisms] Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>KOG0505 consensus Myosin phosphatase, regulatory subunit [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG0505 consensus Myosin phosphatase, regulatory subunit [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PHA02741 hypothetical protein; Provisional Back     alignment and domain information
>KOG3676 consensus Ca2+-permeable cation channel OSM-9 and related channels (OTRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>PHA02743 Viral ankyrin protein; Provisional Back     alignment and domain information
>KOG0514 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA02736 Viral ankyrin protein; Provisional Back     alignment and domain information
>KOG0514 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0512 consensus Fetal globin-inducing factor (contains ankyrin repeats) [Transcription] Back     alignment and domain information
>PHA02743 Viral ankyrin protein; Provisional Back     alignment and domain information
>PHA02741 hypothetical protein; Provisional Back     alignment and domain information
>PHA02884 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02884 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02736 Viral ankyrin protein; Provisional Back     alignment and domain information
>KOG0195 consensus Integrin-linked kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0512 consensus Fetal globin-inducing factor (contains ankyrin repeats) [Transcription] Back     alignment and domain information
>KOG3676 consensus Ca2+-permeable cation channel OSM-9 and related channels (OTRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>KOG0195 consensus Integrin-linked kinase [Signal transduction mechanisms] Back     alignment and domain information
>PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>KOG4214 consensus Myotrophin and similar proteins [Transcription] Back     alignment and domain information
>KOG4214 consensus Myotrophin and similar proteins [Transcription] Back     alignment and domain information
>COG0666 Arp FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>COG0666 Arp FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A Back     alignment and domain information
>KOG1710 consensus MYND Zn-finger and ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0515 consensus p53-interacting protein 53BP/ASPP, contains ankyrin and SH3 domains [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A Back     alignment and domain information
>PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A Back     alignment and domain information
>PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A Back     alignment and domain information
>PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>KOG1710 consensus MYND Zn-finger and ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0515 consensus p53-interacting protein 53BP/ASPP, contains ankyrin and SH3 domains [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0782 consensus Predicted diacylglycerol kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0783 consensus Uncharacterized conserved protein, contains ankyrin and BTB/POZ domains [Function unknown] Back     alignment and domain information
>KOG0506 consensus Glutaminase (contains ankyrin repeat) [Amino acid transport and metabolism] Back     alignment and domain information
>KOG0818 consensus GTPase-activating proteins of the GIT family [Signal transduction mechanisms] Back     alignment and domain information
>KOG0818 consensus GTPase-activating proteins of the GIT family [Signal transduction mechanisms] Back     alignment and domain information
>KOG0506 consensus Glutaminase (contains ankyrin repeat) [Amino acid transport and metabolism] Back     alignment and domain information
>PF13606 Ank_3: Ankyrin repeat Back     alignment and domain information
>KOG0522 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG3609 consensus Receptor-activated Ca2+-permeable cation channels (STRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature Back     alignment and domain information
>PF13606 Ank_3: Ankyrin repeat Back     alignment and domain information
>KOG0522 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0782 consensus Predicted diacylglycerol kinase [Signal transduction mechanisms] Back     alignment and domain information
>PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature Back     alignment and domain information
>KOG0783 consensus Uncharacterized conserved protein, contains ankyrin and BTB/POZ domains [Function unknown] Back     alignment and domain information
>KOG3609 consensus Receptor-activated Ca2+-permeable cation channels (STRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>KOG0705 consensus GTPase-activating protein Centaurin gamma (contains Ras-like GTPase, PH and ankyrin repeat domains) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0705 consensus GTPase-activating protein Centaurin gamma (contains Ras-like GTPase, PH and ankyrin repeat domains) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0520 consensus Uncharacterized conserved protein, contains IPT/TIG domain [Function unknown] Back     alignment and domain information
>KOG0520 consensus Uncharacterized conserved protein, contains IPT/TIG domain [Function unknown] Back     alignment and domain information
>KOG0511 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0521 consensus Putative GTPase activating proteins (GAPs) [Signal transduction mechanisms] Back     alignment and domain information
>KOG2384 consensus Major histocompatibility complex protein BAT4, contains G-patch and ankyrin domains [General function prediction only] Back     alignment and domain information
>KOG2384 consensus Major histocompatibility complex protein BAT4, contains G-patch and ankyrin domains [General function prediction only] Back     alignment and domain information
>KOG0521 consensus Putative GTPase activating proteins (GAPs) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0511 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>smart00248 ANK ankyrin repeats Back     alignment and domain information
>smart00248 ANK ankyrin repeats Back     alignment and domain information
>KOG2505 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG2505 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PF03158 DUF249: Multigene family 530 protein; InterPro: IPR004858 This entry represents multigene family 530 proteins from African swine fever virus (ASFV) viruses Back     alignment and domain information
>PF06128 Shigella_OspC: Shigella flexneri OspC protein; InterPro: IPR010366 This family consists of the Shigella flexneri specific protein OspC Back     alignment and domain information
>PF06128 Shigella_OspC: Shigella flexneri OspC protein; InterPro: IPR010366 This family consists of the Shigella flexneri specific protein OspC Back     alignment and domain information
>PF03158 DUF249: Multigene family 530 protein; InterPro: IPR004858 This entry represents multigene family 530 proteins from African swine fever virus (ASFV) viruses Back     alignment and domain information
>cd07920 Pumilio Pumilio-family RNA binding domain Back     alignment and domain information
>PF11929 DUF3447: Domain of unknown function (DUF3447); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>cd07920 Pumilio Pumilio-family RNA binding domain Back     alignment and domain information
>PF11929 DUF3447: Domain of unknown function (DUF3447); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query575
1mj0_A166 Sank E3_5: An Artificial Ankyrin Repeat Protein Len 1e-04
>pdb|1MJ0|A Chain A, Sank E3_5: An Artificial Ankyrin Repeat Protein Length = 166 Back     alignment and structure

Iteration: 1

Score = 45.1 bits (105), Expect = 1e-04, Method: Composition-based stats. Identities = 31/113 (27%), Positives = 58/113 (51%), Gaps = 5/113 (4%) Query: 66 GDLAQENNVGYTALFFAAASGMVELAREIMTHNKAIATEQDDKRVLPIDLAASLGHEDMV 125 D+ +N GYT L AA++G +E+ E++ N A D + P+ LAA+ GH ++V Sbjct: 38 ADVNATDNDGYTPLHLAASNGHLEIV-EVLLKNGADVNASDLTGITPLHLAAATGHLEIV 96 Query: 126 VYL--YGQTKNSLNDEDRS--HLLVTLIQTDLYDVALRVFEDLHEKSAIGRAA 174 L +G N+ +++ + HL ++ +V L+ D++ + G+ A Sbjct: 97 EVLLKHGADVNAYDNDGHTPLHLAAKYGHLEIVEVLLKHGADVNAQDKFGKTA 149

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query575
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 4e-09
2pnn_A273 Transient receptor potential cation channel subfa 5e-09
2pnn_A273 Transient receptor potential cation channel subfa 3e-05
2pnn_A273 Transient receptor potential cation channel subfa 8e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 8e-09
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-07
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 2e-08
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 2e-07
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 9e-07
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 7e-05
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 6e-04
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 7e-04
2etb_A256 Transient receptor potential cation channel subfam 2e-08
2etb_A256 Transient receptor potential cation channel subfam 2e-05
3jxi_A260 Vanilloid receptor-related osmotically activated p 5e-08
3jxi_A260 Vanilloid receptor-related osmotically activated p 1e-04
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 8e-08
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 1e-07
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 1e-07
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 2e-07
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 1e-05
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 9e-08
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 2e-07
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 1e-04
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 1e-04
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 1e-07
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 1e-07
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 2e-05
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 1e-07
3v30_A172 DNA-binding protein rfxank; structural genomics co 2e-07
3v30_A172 DNA-binding protein rfxank; structural genomics co 9e-07
3v30_A172 DNA-binding protein rfxank; structural genomics co 3e-05
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 2e-07
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 5e-06
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 7e-06
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 1e-05
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 1e-04
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 3e-04
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 2e-07
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 5e-07
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 1e-06
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 2e-06
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 8e-06
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 1e-05
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 3e-05
3v31_A167 Ankyrin repeat family A protein 2; structural geno 7e-07
3v31_A167 Ankyrin repeat family A protein 2; structural geno 2e-06
3v31_A167 Ankyrin repeat family A protein 2; structural geno 3e-04
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 8e-07
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 2e-06
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 2e-06
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 5e-04
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 9e-07
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 1e-04
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 5e-04
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 1e-06
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 3e-05
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 1e-06
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 2e-05
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 5e-05
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 2e-06
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 2e-05
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 6e-05
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 2e-06
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 3e-05
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 8e-05
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 8e-05
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 2e-06
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 2e-05
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 6e-05
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 2e-06
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 6e-05
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 3e-06
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 1e-05
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 3e-05
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 7e-04
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 4e-06
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 2e-05
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 2e-04
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 4e-06
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 6e-05
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 7e-05
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 9e-05
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 8e-06
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 2e-05
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 8e-05
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 9e-06
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 8e-05
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 1e-05
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 1e-05
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 8e-04
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 1e-05
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 3e-05
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 4e-05
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 1e-04
3hra_A201 Ankyrin repeat family protein; structural protein; 1e-05
3hra_A201 Ankyrin repeat family protein; structural protein; 4e-04
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 1e-05
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 3e-04
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 1e-05
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 2e-05
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 2e-05
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 5e-05
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 2e-04
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 5e-04
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 2e-05
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 4e-05
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 8e-04
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 4e-05
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 5e-05
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 9e-05
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 2e-04
1awc_B153 Protein (GA binding protein beta 1); complex (tran 6e-05
1awc_B153 Protein (GA binding protein beta 1); complex (tran 6e-05
1awc_B153 Protein (GA binding protein beta 1); complex (tran 3e-04
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 6e-05
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 2e-04
2rfa_A232 Transient receptor potential cation channel subfa 7e-05
2rfa_A232 Transient receptor potential cation channel subfa 3e-04
2rfa_A232 Transient receptor potential cation channel subfa 3e-04
2rfa_A232 Transient receptor potential cation channel subfa 5e-04
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 8e-05
1sw6_A327 Regulatory protein SWI6; transcription regulation, 8e-05
3deo_A183 Signal recognition particle 43 kDa protein; chloro 9e-05
3deo_A183 Signal recognition particle 43 kDa protein; chloro 6e-04
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 2e-04
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 2e-04
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 3e-04
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 2e-04
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 5e-04
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 5e-04
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 5e-04
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
 Score = 57.6 bits (139), Expect = 4e-09
 Identities = 27/180 (15%), Positives = 52/180 (28%), Gaps = 20/180 (11%)

Query: 27  VHEGEIRAPISKRKDTALHIAAAAKQYGF---VKELVQRMEPGDLAQENNVGYTALFFAA 83
           +   EI   I      A  +AA   + G    +  L +      +A      Y A   AA
Sbjct: 115 LTSDEIVKVIQAENYQAFRLAA---ENGHLHVLNRLCELAPTEIMAMIQAENYHAFRLAA 171

Query: 84  ASGMVELAREIMTH--NKAIATEQDDKRVLPIDLAASLGHEDMVVYLYGQ----TKNSLN 137
            +G + +   +      +A A  Q +        A   GH +++ +L           ++
Sbjct: 172 ENGHLHVLNRLCELAPTEATAMIQAENYYAFRWAAVGRGHHNVINFLLDCPVMLAYAEIH 231

Query: 138 DEDRSHLLVTLIQTDLYDVALRVFEDLHEKSAIG--------RAANEETALHALARKNLN 189
           + +     V        +    + +     +  G                L  L R+N  
Sbjct: 232 EFEYGEKYVNPFIARHVNRLKEMHDAFKLSNPDGVFDLVTKSECLQGFYMLRNLIRRNDE 291


>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query575
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 100.0
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 100.0
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 100.0
4g8k_A337 2-5A-dependent ribonuclease; ankyrin-repeat domain 100.0
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 100.0
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 100.0
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 100.0
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 100.0
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 100.0
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 100.0
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 100.0
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 100.0
4g8k_A337 2-5A-dependent ribonuclease; ankyrin-repeat domain 100.0
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 100.0
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 100.0
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 100.0
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 100.0
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 100.0
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 100.0
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 100.0
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 100.0
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 100.0
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 100.0
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 100.0
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 100.0
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 100.0
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 100.0
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 100.0
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 100.0
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 100.0
4b93_B269 Ankyrin repeat domain-containing protein 27; endoc 100.0
4b93_B269 Ankyrin repeat domain-containing protein 27; endoc 100.0
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 100.0
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 100.0
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 100.0
1sw6_A327 Regulatory protein SWI6; transcription regulation, 100.0
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 100.0
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 100.0
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 100.0
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 100.0
2rfa_A232 Transient receptor potential cation channel subfa 100.0
2rfa_A232 Transient receptor potential cation channel subfa 100.0
3hra_A201 Ankyrin repeat family protein; structural protein; 99.98
1sw6_A327 Regulatory protein SWI6; transcription regulation, 99.97
3hra_A201 Ankyrin repeat family protein; structural protein; 99.97
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 99.97
2etb_A256 Transient receptor potential cation channel subfam 99.97
2etb_A256 Transient receptor potential cation channel subfam 99.97
2pnn_A273 Transient receptor potential cation channel subfa 99.97
2pnn_A273 Transient receptor potential cation channel subfa 99.97
4gpm_A169 Engineered protein OR264; de novo protein, structu 99.97
3jxi_A260 Vanilloid receptor-related osmotically activated p 99.97
3jxi_A260 Vanilloid receptor-related osmotically activated p 99.96
4gpm_A169 Engineered protein OR264; de novo protein, structu 99.96
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 99.96
3v30_A172 DNA-binding protein rfxank; structural genomics co 99.96
3v31_A167 Ankyrin repeat family A protein 2; structural geno 99.95
4hbd_A276 KN motif and ankyrin repeat domain-containing Pro; 99.95
3v30_A172 DNA-binding protein rfxank; structural genomics co 99.95
4hbd_A276 KN motif and ankyrin repeat domain-containing Pro; 99.95
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 99.95
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 99.95
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 99.95
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 99.95
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 99.95
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 99.95
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 99.94
3v31_A167 Ankyrin repeat family A protein 2; structural geno 99.94
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 99.94
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 99.94
1awc_B153 Protein (GA binding protein beta 1); complex (tran 99.94
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 99.94
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 99.94
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 99.93
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 99.93
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 99.93
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 99.93
1awc_B153 Protein (GA binding protein beta 1); complex (tran 99.93
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 99.93
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 99.92
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 99.91
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 99.91
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 99.91
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 99.9
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 99.9
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 99.9
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 99.89
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 99.88
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 99.88
3deo_A183 Signal recognition particle 43 kDa protein; chloro 99.88
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 99.87
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 99.87
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 99.87
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 99.86
3deo_A183 Signal recognition particle 43 kDa protein; chloro 99.86
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 99.86
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 99.86
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 99.85
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 99.85
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 99.85
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 99.83
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 99.83
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 99.82
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 99.82
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 99.82
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 99.8
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 99.8
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 99.79
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 99.77
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 99.77
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 99.77
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 99.76
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 99.71
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 99.67
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
Probab=100.00  E-value=2.6e-48  Score=408.75  Aligned_cols=350  Identities=16%  Similarity=0.151  Sum_probs=290.0

Q ss_pred             CcccchHHHHHHHcCCHHHHHHHHhhCCCcccccCCCCCChHHhHHHHcCCHHHHHHHHHcCCCCCccccccCCChHHHH
Q 037778            2 IRRRRLKLYRAALTGDWAVARGIYDVHEGEIRAPISKRKDTALHIAAAAKQYGFVKELVQRMEPGDLAQENNVGYTALFF   81 (575)
Q Consensus         2 ~~~~~t~L~~Aa~~g~~~~v~~lL~~~~~~~~~~~~~~g~TpLh~Aa~~g~~~~v~~Ll~~~~~~~l~~~d~~g~TpLh~   81 (575)
                      ...|.||||.|+..|+.++|+.|++. +.+++.. +..|.||||+|+..|+.++|++|++.  +.+++.+|.+|.||||+
T Consensus        11 ~~~g~t~L~~Aa~~g~~~~v~~Ll~~-g~~~~~~-~~~~~t~L~~A~~~g~~~~v~~Ll~~--g~~~~~~~~~g~t~L~~   86 (437)
T 1n11_A           11 GESGLTPLHVASFMGHLPIVKNLLQR-GASPNVS-NVKVETPLHMAARAGHTEVAKYLLQN--KAKVNAKAKDDQTPLHC   86 (437)
T ss_dssp             ----CCHHHHHHHHTCHHHHHHHHHT-TCCSCCS-SSCCCCHHHHHHHHTCHHHHHHHHHH--TCCSSCCCTTSCCHHHH
T ss_pred             CCCCCCHHHHHHHCCCHHHHHHHHHc-CCCCCCC-CCCCCCHHHHHHHcCCHHHHHHHHhC--CCCCCCCCCCCCCHHHH
Confidence            45789999999999999999999984 8888887 88999999999999999999999999  89999999999999999


Q ss_pred             HHHcCCHHHHHHHHhcCccccccCCCCCCcHHHHHHHcCChHHHHHHHhccc-cccCcCchhhHHHHHHHhCcHHHHHHH
Q 037778           82 AAASGMVELAREIMTHNKAIATEQDDKRVLPIDLAASLGHEDMVVYLYGQTK-NSLNDEDRSHLLVTLIQTDLYDVALRV  160 (575)
Q Consensus        82 Aa~~g~~~iv~~Ll~~~~~~~~~~~~~g~tpL~~A~~~g~~~~v~~Ll~~~~-~~~~~~~g~t~L~~a~~~~~~~~~~~L  160 (575)
                      |+..|+.+++++|+++|+++ +..+..|.||||+|+..|+.+++++|++.+. ....+..|.||||.|+..|+.+++++|
T Consensus        87 A~~~g~~~~v~~Ll~~ga~~-~~~~~~g~t~L~~A~~~g~~~~v~~Ll~~~~~~~~~~~~g~t~L~~A~~~g~~~~v~~L  165 (437)
T 1n11_A           87 AARIGHTNMVKLLLENNANP-NLATTAGHTPLHIAAREGHVETVLALLEKEASQACMTKKGFTPLHVAAKYGKVRVAELL  165 (437)
T ss_dssp             HHHHTCHHHHHHHHHHTCCT-TCCCTTCCCHHHHHHHHTCHHHHHHHHHTTCCSCCCCTTSCCHHHHHHHTTCHHHHHHH
T ss_pred             HHHCCCHHHHHHHHhCCCCC-CCCCCCCCcHHHHHHHcCCHHHHHHHHhCCCCCcCCCCCCCCHHHHHHHcCCHHHHHHH
Confidence            99999999999999999996 8899999999999999999999999999988 677888999999999999999999999


Q ss_pred             HHhhhccccccccCCCCcHHHHHHhcCCCCcccchhhhhhhcc---------chhhhHhhHHH----HHHHHHHHHHhhh
Q 037778          161 FEDLHEKSAIGRAANEETALHALARKNLNYSHFTKQYQRGFFS---------AKDIENKRQKA----LKLVQRLWEKVVL  227 (575)
Q Consensus       161 l~~~~~~~~~~~d~~g~tpLh~a~~~~~~~~~~~~~~~~~~~~---------~~~~~~~~~~~----~e~v~~L~~~~~~  227 (575)
                      +++  +.+++..+.+|.||||+|+..++      ...++.+++         ....++.|.++    .++++.|++.|.+
T Consensus       166 l~~--g~~~~~~~~~g~t~L~~A~~~~~------~~~v~~Ll~~g~~~~~~~~~g~t~L~~A~~~~~~~~~~~Ll~~g~~  237 (437)
T 1n11_A          166 LER--DAHPNAAGKNGLTPLHVAVHHNN------LDIVKLLLPRGGSPHSPAWNGYTPLHIAAKQNQVEVARSLLQYGGS  237 (437)
T ss_dssp             HHT--TCCTTCCCSSCCCHHHHHHHTTC------HHHHHHHGGGTCCSCCCCTTCCCHHHHHHHTTCHHHHHHHHHTTCC
T ss_pred             HhC--CCCCCCCCCCCCCHHHHHHHcCC------HHHHHHHHhCCCCCCCcCCCCCCHHHHHHHcCCHHHHHHHHHcCCC
Confidence            997  88888999999999999999885      222222221         11233444433    6788888888887


Q ss_pred             CChhhhhcccCCChHHHHHHHcCCHHHHHHHHHHCCCccccccCCCCchHHHHHHcCChhHHHHHHhcCcchhhhhhccc
Q 037778          228 LSDSRISNLIAEPELIFDAARQGNLEFLLILIREYPDLIWNIDENGYTIFHTAVLHRRKRIFKLIYQIGAAKDLILKFED  307 (575)
Q Consensus       228 ~~~~~~~~~~~~~tpLh~Aa~~g~~~iv~~Ll~~~~d~~~~~d~~G~t~Lh~A~~~~~~~iv~~Ll~~~~~~~~l~~~~d  307 (575)
                      ++..+    ..+.||||.|+..|+.+++++|++++++ ++..|..|+||||+|+..|+.+++++|+++|++++.    +|
T Consensus       238 ~~~~~----~~g~t~L~~A~~~g~~~~v~~Ll~~~~~-~~~~~~~g~t~L~~A~~~~~~~~~~~Ll~~g~~~~~----~~  308 (437)
T 1n11_A          238 ANAES----VQGVTPLHLAAQEGHAEMVALLLSKQAN-GNLGNKSGLTPLHLVAQEGHVPVADVLIKHGVMVDA----TT  308 (437)
T ss_dssp             TTCCC----TTCCCHHHHHHHTTCHHHHHHHHTTTCC-TTCCCTTCCCHHHHHHHHTCHHHHHHHHHHTCCTTC----CC
T ss_pred             CCCCC----CCCCCHHHHHHHCCCHHHHHHHHhcCCC-CCCCCCCCCCHHHHHHHcCCHHHHHHHHhCCccCCC----CC
Confidence            77654    3345888888888888888888888888 678888888888888888888888888888887754    78


Q ss_pred             CCCCcHHHHHhhCCCCCcccccc-------------chhHhhHHHHHHHHHHHHhh-cccccccccCCCCChhHHHHHhh
Q 037778          308 PKKNNILHLAAMLPPQDRLNIVS-------------GAALQMQRELLWFEEVEKAV-QRRSAEAKNEDGLSPRALFTRKH  373 (575)
Q Consensus       308 ~~G~T~LHlAa~~~~~~~~~~l~-------------~~~l~~~~~l~w~~~v~~~~-~~~~~~~~n~~G~Tpl~~a~~~~  373 (575)
                      ..|+||||+|+..|+.+++++|.             .++++.+......+.|+.++ .|++++.+|.+|+||+++|.+..
T Consensus       309 ~~g~t~L~~A~~~g~~~~v~~Ll~~gad~n~~~~~g~t~L~~A~~~g~~~iv~~Ll~~ga~~~~~~~~g~t~l~~A~~~g  388 (437)
T 1n11_A          309 RMGYTPLHVASHYGNIKLVKFLLQHQADVNAKTKLGYSPLHQAAQQGHTDIVTLLLKNGASPNEVSSDGTTPLAIAKRLG  388 (437)
T ss_dssp             SSCCCHHHHHHHSSCSHHHHHHHHTTCCTTCCCTTSCCHHHHHHHTTCHHHHHHHHHTTCCSCCCCSSSCCHHHHHHHTT
T ss_pred             CCCCCHHHHHHHcCcHHHHHHHHhcCCCCCCCCCCCCCHHHHHHHCChHHHHHHHHHCcCCCCCCCCCCCCHHHHHHHcC
Confidence            88888888888888887776652             13566666666667777666 78889999999999999987643



>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Back     alignment and structure
>4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Back     alignment and structure
>4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Back     alignment and structure
>4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} Back     alignment and structure
>4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Back     alignment and structure
>4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* Back     alignment and structure
>4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Back     alignment and structure
>4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Back     alignment and structure
>4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 575
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 6e-13
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 8e-04
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 8e-10
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 9e-09
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 1e-08
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 6e-06
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 3e-05
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 3e-08
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 3e-06
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 7e-04
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 0.002
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 6e-07
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 9e-06
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 1e-04
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 2e-06
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 3e-05
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 7e-04
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 0.001
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 4e-05
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 6e-05
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 7e-04
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 0.002
d1dcqa1154 d.211.1.1 (A:369-522) Pyk2-associated protein beta 7e-05
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 8e-05
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 6e-04
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 0.001
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 1e-04
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 1e-04
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 2e-04
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 0.004
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 5e-04
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: beta-hairpin-alpha-hairpin repeat
superfamily: Ankyrin repeat
family: Ankyrin repeat
domain: Transcription factor inhibitor I-kappa-B-beta, IKBB
species: Mouse (Mus musculus) [TaxId: 10090]
 Score = 66.7 bits (161), Expect = 6e-13
 Identities = 41/266 (15%), Positives = 76/266 (28%), Gaps = 19/266 (7%)

Query: 36  ISKRKDTALHIAAAAKQYGFVKELVQRM-EPGDLAQENNVGYTALFFAAASGMVELAREI 94
           +++  DTALH+A   +   F+  L+        L  +N++G TAL  AA  G      ++
Sbjct: 5   VTEDGDTALHLAVIHQHEPFLDFLLGFSAGHEYLDLQNDLGQTALHLAAILGEASTVEKL 64

Query: 95  MTHNKAIATEQDDKRVLPIDLAASLGHEDMVVYLYGQTKNSLNDEDRSHLLVTLIQTDLY 154
                 +   +       + LA  +        L     +   D   ++L      T   
Sbjct: 65  YAAGAGVLVAERGGHT-ALHLACRVRAHTCACVLLQPRPSHPRDASDTYL------TQSQ 117

Query: 155 DVALRVFEDLHEKSAIGRAANEETALHALARKNLNYSHFTKQYQRGFFSAKDIENKRQKA 214
           D             +     NEE       R  L   ++                  +  
Sbjct: 118 DCTPDTSHAPAAVDSQPNPENEEEPRDEDWRLQLEAENYDGHTPLHVAVIHKDAEMVRLL 177

Query: 215 LKLVQRLWEKVVLLSDSRISNLIAEPELIFDAARQGNLEFLLILIREYPDLIWNIDENGY 274
                 L +       + +            A        L +L++   D        G 
Sbjct: 178 RDAGADLNKPEPTCGRTPL----------HLAVEAQAASVLELLLKAGAD-PTARMYGGR 226

Query: 275 TIFHTAVLHRRKRIFKLIYQIGAAKD 300
           T   +A+L     + +L+   GA + 
Sbjct: 227 TPLGSALLRPNPILARLLRAHGAPEP 252


>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query575
d1n11a_408 Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1n11a_408 Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1oy3d_255 Transcription factor inhibitor I-kappa-B-beta, IKB 100.0
d1uoha_223 26S proteasome non-ATPase regulatory subunit 10, g 100.0
d1wdya_285 RNase L, 2-5a-dependent ribonuclease {Human (Homo 100.0
d2fo1e1277 Lin-12 {Caenorhabditis elegans [TaxId: 6239]} 100.0
d1uoha_223 26S proteasome non-ATPase regulatory subunit 10, g 100.0
d1ixva_229 26S proteasome non-ATPase regulatory subunit 10, g 100.0
d1oy3d_255 Transcription factor inhibitor I-kappa-B-beta, IKB 100.0
d1s70b_291 Myosin phosphatase targeting subunit 1, MYPT1 {Chi 100.0
d1wdya_285 RNase L, 2-5a-dependent ribonuclease {Human (Homo 100.0
d1ixva_229 26S proteasome non-ATPase regulatory subunit 10, g 99.98
d1s70b_291 Myosin phosphatase targeting subunit 1, MYPT1 {Chi 99.97
d1k1aa_228 bcl-3 {Human (Homo sapiens) [TaxId: 9606]} 99.97
d2fo1e1277 Lin-12 {Caenorhabditis elegans [TaxId: 6239]} 99.97
d1iknd_221 I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 99.96
d1k1aa_228 bcl-3 {Human (Homo sapiens) [TaxId: 9606]} 99.96
d1ot8a_209 Neurogenic locus notch receptor domain {Fruit fly 99.95
d1iknd_221 I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 99.95
d2ajaa1346 Hypothetical protein LPG2416 {Legionella pneumophi 99.95
d1ot8a_209 Neurogenic locus notch receptor domain {Fruit fly 99.94
d2ajaa1346 Hypothetical protein LPG2416 {Legionella pneumophi 99.94
d1bd8a_156 Cell cycle inhibitor p19ink4D {Human (Homo sapiens 99.93
d1ihba_156 p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] 99.92
d1ihba_156 p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] 99.92
d1sw6a_301 Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch 99.91
d1awcb_153 GA bindinig protein (GABP) beta 1 {Mouse (Mus musc 99.9
d1bd8a_156 Cell cycle inhibitor p19ink4D {Human (Homo sapiens 99.9
d1awcb_153 GA bindinig protein (GABP) beta 1 {Mouse (Mus musc 99.89
d1sw6a_301 Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch 99.89
d1bi7b_125 Cell cycle inhibitor p16ink4A {Human (Homo sapiens 99.88
d1myoa_118 Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] 99.87
d1ycsb1130 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 99.87
d1bi7b_125 Cell cycle inhibitor p16ink4A {Human (Homo sapiens 99.86
d1myoa_118 Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] 99.85
d1dcqa1154 Pyk2-associated protein beta {Mouse (Mus musculus) 99.85
d1ycsb1130 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 99.83
d1dcqa1154 Pyk2-associated protein beta {Mouse (Mus musculus) 99.78
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: beta-hairpin-alpha-hairpin repeat
superfamily: Ankyrin repeat
family: Ankyrin repeat
domain: Ankyrin-R
species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00  E-value=6.4e-43  Score=361.22  Aligned_cols=333  Identities=19%  Similarity=0.180  Sum_probs=280.9

Q ss_pred             chHHHHHHHcCCHHHHHHHHhhCCCcccccCCCCCChHHhHHHHcCCHHHHHHHHHcCCCCCccccccCCChHHHHHHHc
Q 037778            6 RLKLYRAALTGDWAVARGIYDVHEGEIRAPISKRKDTALHIAAAAKQYGFVKELVQRMEPGDLAQENNVGYTALFFAAAS   85 (575)
Q Consensus         6 ~t~L~~Aa~~g~~~~v~~lL~~~~~~~~~~~~~~g~TpLh~Aa~~g~~~~v~~Ll~~~~~~~l~~~d~~g~TpLh~Aa~~   85 (575)
                      .||||.||..|+.++|+.|++ .|++++.. |.+|+||||+|+..|+.++|++|+++  |++++.+|.+|.||||+|+..
T Consensus         1 ~TpL~~Aa~~g~~~~v~~Ll~-~g~~in~~-d~~g~TpL~~A~~~g~~~iv~~Ll~~--gadi~~~~~~g~t~L~~A~~~   76 (408)
T d1n11a_           1 LTPLHVASFMGHLPIVKNLLQ-RGASPNVS-NVKVETPLHMAARAGHTEVAKYLLQN--KAKVNAKAKDDQTPLHCAARI   76 (408)
T ss_dssp             CCHHHHHHHHTCHHHHHHHHH-TTCCSCCS-SSCCCCHHHHHHHHTCHHHHHHHHHH--TCCSSCCCTTSCCHHHHHHHH
T ss_pred             CChHHHHHHCcCHHHHHHHHH-CCCCCCCC-CCCCCCHHHHHHHcCCHHHHHHHHHC--cCCCCCCCCCCCCHHHHHHHc
Confidence            389999999999999999998 48899987 99999999999999999999999999  899999999999999999999


Q ss_pred             CCHHHHHHHHhcCccc--------------------------------cccCCCCCCcHHHHHHHcCChHHHHHHHhccc
Q 037778           86 GMVELAREIMTHNKAI--------------------------------ATEQDDKRVLPIDLAASLGHEDMVVYLYGQTK  133 (575)
Q Consensus        86 g~~~iv~~Ll~~~~~~--------------------------------~~~~~~~g~tpL~~A~~~g~~~~v~~Ll~~~~  133 (575)
                      |+.++++.|++.+++.                                ....+..+.++++.|+..++.+++++|++.+.
T Consensus        77 g~~~~~~~Ll~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~a~~~~~~~~v~~ll~~~~  156 (408)
T d1n11a_          77 GHTNMVKLLLENNANPNLATTAGHTPLHIAAREGHVETVLALLEKEASQACMTKKGFTPLHVAAKYGKVRVAELLLERDA  156 (408)
T ss_dssp             TCHHHHHHHHHHTCCTTCCCTTCCCHHHHHHHHTCHHHHHHHHHTTCCSCCCCTTSCCHHHHHHHTTCHHHHHHHHHTTC
T ss_pred             CCHHHHHHHHHhhhccccccccccchhhhhhhhcccccccccccccccccccccccchHHHHHHHcCCHHHHHHHHHcCC
Confidence            9999999999765532                                13457789999999999999999999999998


Q ss_pred             -cccCcCchhhHHHHHHHhCcHHHHHHHHHhhhccccccccCCCCcHHHHHHhcCCCCcccch-hhhhhh--ccchhhhH
Q 037778          134 -NSLNDEDRSHLLVTLIQTDLYDVALRVFEDLHEKSAIGRAANEETALHALARKNLNYSHFTK-QYQRGF--FSAKDIEN  209 (575)
Q Consensus       134 -~~~~~~~g~t~L~~a~~~~~~~~~~~Ll~~~~~~~~~~~d~~g~tpLh~a~~~~~~~~~~~~-~~~~~~--~~~~~~~~  209 (575)
                       .+..+.+|.+|||.|+..++.++++.|+++  +.+++..+.+|.||+|.+...........+ ......  ......+.
T Consensus       157 ~~~~~~~~~~~~L~~A~~~~~~~~~~~Ll~~--g~~~~~~~~~~~t~l~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~t~  234 (408)
T d1n11a_         157 HPNAAGKNGLTPLHVAVHHNNLDIVKLLLPR--GGSPHSPAWNGYTPLHIAAKQNQVEVARSLLQYGGSANAESVQGVTP  234 (408)
T ss_dssp             CTTCCCSSCCCHHHHHHHTTCHHHHHHHGGG--TCCSCCCCTTCCCHHHHHHHTTCHHHHHHHHHTTCCTTCCCTTCCCH
T ss_pred             CCCcCCCcCchHHHHHHHcCCHHHHHHHHhc--CCcccccCCCCCCcchhhhccchhhhhhhhhhccccccccCCCCCCH
Confidence             788899999999999999999999999997  888899999999999999987641100000 000000  00011122


Q ss_pred             hhHH----HHHHHHHHHHHhhhCChhhhhcccCCChHHHHHHHcCCHHHHHHHHHHCCCccccccCCCCchHHHHHHcCC
Q 037778          210 KRQK----ALKLVQRLWEKVVLLSDSRISNLIAEPELIFDAARQGNLEFLLILIREYPDLIWNIDENGYTIFHTAVLHRR  285 (575)
Q Consensus       210 ~~~~----~~e~v~~L~~~~~~~~~~~~~~~~~~~tpLh~Aa~~g~~~iv~~Ll~~~~d~~~~~d~~G~t~Lh~A~~~~~  285 (575)
                      .+.+    ..++++.+.+.+...+..+    ..+.||++.|++.++.+++++|+++|++ ++..+..+.||||.|+..++
T Consensus       235 l~~a~~~~~~~~~~~~~~~~~~~~~~~----~~g~~~l~~a~~~~~~~i~~~Ll~~g~~-~~~~~~~~~t~L~~~~~~~~  309 (408)
T d1n11a_         235 LHLAAQEGHAEMVALLLSKQANGNLGN----KSGLTPLHLVAQEGHVPVADVLIKHGVM-VDATTRMGYTPLHVASHYGN  309 (408)
T ss_dssp             HHHHHHTTCHHHHHHHHTTTCCTTCCC----TTCCCHHHHHHHHTCHHHHHHHHHHTCC-TTCCCSSCCCHHHHHHHSSC
T ss_pred             HHHHHHhCcHhHhhhhhcccccccccc----CCCCChhhhhhhcCcHHHHHHHHHCCCc-cccccccccccchhhcccCc
Confidence            2222    2567777777776666544    3455999999999999999999999999 78899999999999999999


Q ss_pred             hhHHHHHHhcCcchhhhhhcccCCCCcHHHHHhhCCCCCccccccchhHhhHHHHHHHHHHHHhhcccccccccCCCCCh
Q 037778          286 KRIFKLIYQIGAAKDLILKFEDPKKNNILHLAAMLPPQDRLNIVSGAALQMQRELLWFEEVEKAVQRRSAEAKNEDGLSP  365 (575)
Q Consensus       286 ~~iv~~Ll~~~~~~~~l~~~~d~~G~T~LHlAa~~~~~~~~~~l~~~~l~~~~~l~w~~~v~~~~~~~~~~~~n~~G~Tp  365 (575)
                      .++++++++.|++++    .+|.+|+||||+|++.|+.+++++|                   +..|++++.+|++|+||
T Consensus       310 ~~~~~~ll~~g~~in----~~d~~G~T~Lh~A~~~g~~~iv~~L-------------------l~~GAd~n~~d~~G~t~  366 (408)
T d1n11a_         310 IKLVKFLLQHQADVN----AKTKLGYSPLHQAAQQGHTDIVTLL-------------------LKNGASPNEVSSDGTTP  366 (408)
T ss_dssp             SHHHHHHHHTTCCTT----CCCTTSCCHHHHHHHTTCHHHHHHH-------------------HHTTCCSCCCCSSSCCH
T ss_pred             ceeeeeecccccccc----ccCCCCCCHHHHHHHcCCHHHHHHH-------------------HHCCCCCCCCCCCCCCH
Confidence            999999999999875    4999999999999999998877666                   55899999999999999


Q ss_pred             hHHHHHh
Q 037778          366 RALFTRK  372 (575)
Q Consensus       366 l~~a~~~  372 (575)
                      +++|.+.
T Consensus       367 L~~A~~~  373 (408)
T d1n11a_         367 LAIAKRL  373 (408)
T ss_dssp             HHHHHHT
T ss_pred             HHHHHHc
Confidence            9999875



>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure