Citrus Sinensis ID: 037904


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------19
MSSYEKWGRQIVRRQFPQEPGNCSRLWEEADTLWEVLSDGTDIKEPLSIELLFGLVQLTLNGCKNLEHLPRTISALKYLSTLNLSGLLKFREFPEKTSSRDELLEIHLEGTAIRGLPASIELLFGNAAPNLKNVPETLGNVESLEVRLSCHKRAKMQNDFDCVEQIAKKDSDSWKKNVDEGIKLSATAI
ccHHHHHHHHHHHHcccccccccccccHHcHHHHHHHcccccccccccccccccccEEccccccccccccccccccccccEEEcccccccccccccccccccccEEEccccccccccHHHHHHccccccccccccccccccccccccccccccccccccccccccccEEccccccccccHHcccccccc
cccHHHHHHHHHHHHcccccccHHHHHHcHHHHHHHHHccccccccccHHHHHcccEEEccccHHHHHcccHHHHHHHHHEEEccccHHHHHcHHHHccHHHHHHcccccccHHcccHHHHHHccccHHHHHccccHcccccEEEEEEccHHHHHccHHHHHHHHHHHHccccccccHHHcccccHccc
MSSYEKWGRQIVrrqfpqepgncsrlWEEADTLWEVlsdgtdikeplSIELLFGLVQLTLngcknlehlPRTISALKYLSTLNLSgllkfrefpektssrDELLEIHLEGTAIRGLPASIELLfgnaapnlknvpetlgnvESLEVRLSCHKRAKMQNDFDCVEQIAKKDSDSWKKNVDEGIKLSATAI
mssyekwgrqivrrqfpqepgncsRLWEEADTLWEVLSDGTDIKEPLSIELLFGLVQLTLNGCKNLEHLPRTISALKYLSTLNLSGLLKFREFPEKTSSRDELLEIHLEGTAIRGLPASIELLFGNAAPNLKNVPETLGNVESLEVRLSCHKRAKMQNDFDCVEQiakkdsdswkknvdegiklsatai
MSSYEKWGRQIVRRQFPQEPGNCSRLWEEADTLWEVLSDGTDIKEPLSIELLFGLVQLTLNGCKNLEHLPRTISALKYLSTLNLSGLLKFREFPEKTSSRDELLEIHLEGTAIRGLPASIELLFGNAAPNLKNVPETLGNVESLEVRLSCHKRAKMQNDFDCVEQIAKKDSDSWKKNVDEGIKLSATAI
**********IV********GNCSRLWEEADTLWEVLSDGTDIKEPLSIELLFGLVQLTLNGCKNLEHLPRTISALKYLSTLNLSGLLKFREFPE*****DELLEIHLEGTAIRGLPASIELLFGNAAPNLKNVPETLGNVESLEVRLSCHKRAKMQNDFDCVEQ************************
MSSYEKWGRQIVRRQFPQEPGNCSRLWEEADTLWEVLSDGTDIKEPLSIELLFGLVQLTLNGCKNLEHLPRTISALKYLSTLNLSGLLKFREFPEKTSSRDELLEIHLEGTAIRGLPASIELLFGNAAPNLKNVPETLGNVESLEVRLSCHKRAKMQNDFDCVEQIAKKDSDSWKKNVDEGIKLSATAI
MSSYEKWGRQIVRRQFPQEPGNCSRLWEEADTLWEVLSDGTDIKEPLSIELLFGLVQLTLNGCKNLEHLPRTISALKYLSTLNLSGLLKFREFPEKTSSRDELLEIHLEGTAIRGLPASIELLFGNAAPNLKNVPETLGNVESLEVRLSCHKRAKMQNDFDCVEQIAKKDSDSWKKNVDEGIKLSATAI
**SYEKWGRQIVRRQFPQEPGNCSRLWEEADTLWEVLSDGTDIKEPLSIELLFGLVQLTLNGCKNLEHLPRTISALKYLSTLNLSGLLKFREFPEKTSSRDELLEIHLEGTAIRGLPASIELLFGNAAPNLKNVPETLGNVESLEVRLSCHKRAKMQNDFDCVEQIAKKDSDSWKKNVDEGIKLSAT**
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSSYEKWGRQIVRRQFPQEPGNCSRLWEEADTLWEVLSDGTDIKEPLSIELLFGLVQLTLNGCKNLEHLPRTISALKYLSTLNLSGLLKFREFPEKTSSRDELLEIHLEGTAIRGLPASIELLFGNAAPNLKNVPETLGNVESLEVRLSCHKRAKMQNDFDCVEQIAKKDSDSWKKNVDEGIKLSATAI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query189 2.2.26 [Sep-21-2011]
Q9SZ67 1895 Probable WRKY transcripti no no 0.534 0.053 0.380 2e-07
P23466 1839 Adenylate cyclase OS=Lach N/A no 0.629 0.064 0.345 3e-05
O23530 1301 Protein SUPPRESSOR OF npr no no 0.624 0.090 0.323 0.0001
>sp|Q9SZ67|WRK19_ARATH Probable WRKY transcription factor 19 OS=Arabidopsis thaliana GN=WRKY19 PE=2 SV=1 Back     alignment and function desciption
 Score = 55.5 bits (132), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 40/105 (38%), Positives = 59/105 (56%), Gaps = 4/105 (3%)

Query: 23   CSRLW---EEADTLWEVLSDGTDIKE-PLSIELLFGLVQLTLNGCKNLEHLPRTISALKY 78
            CS+L    E +  + E+   GT I+E P SI+ L  L +L L   ++L++LP +I  LK+
Sbjct: 1338 CSKLGNFPEISPNVKELYMGGTMIQEIPSSIKNLVLLEKLDLENSRHLKNLPTSIYKLKH 1397

Query: 79   LSTLNLSGLLKFREFPEKTSSRDELLEIHLEGTAIRGLPASIELL 123
            L TLNLSG +    FP+ +     L  + L  T I+ LP+SI  L
Sbjct: 1398 LETLNLSGCISLERFPDSSRRMKCLRFLDLSRTDIKELPSSISYL 1442




Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element. May act also as a disease resistance protein with a serine/threonine-protein kinase activity.
Arabidopsis thaliana (taxid: 3702)
>sp|P23466|CYAA_LACKL Adenylate cyclase OS=Lachancea kluyveri GN=CYR1 PE=3 SV=1 Back     alignment and function description
>sp|O23530|SNC1_ARATH Protein SUPPRESSOR OF npr1-1, CONSTITUTIVE 1 OS=Arabidopsis thaliana GN=SNC1 PE=1 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query189
297734815 1651 unnamed protein product [Vitis vinifera] 0.671 0.076 0.398 3e-14
297734813 2101 unnamed protein product [Vitis vinifera] 0.656 0.059 0.4 5e-14
297734812 610 unnamed protein product [Vitis vinifera] 0.560 0.173 0.437 3e-13
147802475 1244 hypothetical protein VITISV_027841 [Viti 0.804 0.122 0.351 4e-13
147856100 762 hypothetical protein VITISV_003327 [Viti 0.571 0.141 0.434 7e-13
359493208 1695 PREDICTED: TMV resistance protein N-like 0.613 0.068 0.414 8e-13
296089437 1486 unnamed protein product [Vitis vinifera] 0.666 0.084 0.380 1e-12
147789262 1256 hypothetical protein VITISV_038321 [Viti 0.666 0.100 0.380 1e-12
225460287 1554 PREDICTED: TMV resistance protein N-like 0.666 0.081 0.380 1e-12
297734818 867 unnamed protein product [Vitis vinifera] 0.671 0.146 0.383 1e-12
>gi|297734815|emb|CBI17049.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score = 84.0 bits (206), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 53/133 (39%), Positives = 74/133 (55%), Gaps = 6/133 (4%)

Query: 20  PGNCSRLWEEADTLWEVLSDGTDIKEPLSIELLFGLVQLTLNGCKNLEHLPRTISALKYL 79
           P  C +   +  +  ++   G+ I E  +IE       L L  CKNLE LP +I  LK L
Sbjct: 734 PTICRKCQADVQSRRKLCLKGSAINELPTIECPLEFDSLCLRECKNLERLPSSICELKSL 793

Query: 80  STLNLSGLLKFREFPEKTSSRDELLEIHLEGTAIRGLPASIELLFG----NAA--PNLKN 133
           +TLN SG  + R FPE     + L  +HL+GTAI+ LPASI+ L G    N A   NL +
Sbjct: 794 TTLNCSGCSRLRSFPEILEDVENLRNLHLDGTAIKELPASIQYLRGLQCLNLADCTNLVS 853

Query: 134 VPETLGNVESLEV 146
           +PET+ N+ SL++
Sbjct: 854 LPETICNLSSLKI 866




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|297734813|emb|CBI17047.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|297734812|emb|CBI17046.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|147802475|emb|CAN61853.1| hypothetical protein VITISV_027841 [Vitis vinifera] Back     alignment and taxonomy information
>gi|147856100|emb|CAN82453.1| hypothetical protein VITISV_003327 [Vitis vinifera] Back     alignment and taxonomy information
>gi|359493208|ref|XP_002269054.2| PREDICTED: TMV resistance protein N-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|296089437|emb|CBI39256.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|147789262|emb|CAN62576.1| hypothetical protein VITISV_038321 [Vitis vinifera] Back     alignment and taxonomy information
>gi|225460287|ref|XP_002279207.1| PREDICTED: TMV resistance protein N-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|297734818|emb|CBI17052.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query189
TAIR|locus:2170333 1197 CSA1 "constitutive shade-avoid 0.613 0.096 0.369 1.2e-10
TAIR|locus:2153363 1261 AT5G45200 [Arabidopsis thalian 0.507 0.076 0.42 2.3e-09
TAIR|locus:2175991 1294 AT5G17680 [Arabidopsis thalian 0.502 0.073 0.371 1e-08
TAIR|locus:2153328 1231 AT5G45230 [Arabidopsis thalian 0.624 0.095 0.392 1.3e-08
TAIR|locus:2081810 1226 AT3G51570 [Arabidopsis thalian 0.650 0.100 0.328 3.3e-08
TAIR|locus:2153207 1165 AT5G45060 [Arabidopsis thalian 0.640 0.103 0.348 4e-08
TAIR|locus:2118116 1895 WRKY19 [Arabidopsis thaliana ( 0.534 0.053 0.380 4.3e-08
TAIR|locus:2122199 1607 AT4G36140 [Arabidopsis thalian 0.465 0.054 0.405 9.4e-07
TAIR|locus:2174900 968 AT5G40060 [Arabidopsis thalian 0.449 0.087 0.413 1.7e-06
TAIR|locus:2155322 1170 LAZ5 "LAZARUS 5" [Arabidopsis 0.767 0.123 0.307 4.4e-06
TAIR|locus:2170333 CSA1 "constitutive shade-avoidance1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 163 (62.4 bits), Expect = 1.2e-10, P = 1.2e-10
 Identities = 44/119 (36%), Positives = 60/119 (50%)

Query:    30 ADTLWEVLSDGTDIKE-PLSIELLFGLVQLTLNGCKNLEHLPRTISALKYLSTLNLSGLL 88
             +D L  +  DGT IKE P  I  L  LV L + GCK L+ LP ++  LK L  L LSG  
Sbjct:   749 SDKLEALYLDGTAIKELPCDIGRLQRLVMLNMKGCKKLKRLPDSLGQLKALEELILSGCS 808

Query:    89 KFREFPEKTSSRDELLEIHLEGTAIRGLPA--SIELLFGNAAPNLKNVPETLGNVESLE 145
             K  EFPE   +   L  + L+ TAI+ +P   S+  L  N    +  +P+ L     L+
Sbjct:   809 KLNEFPETWGNMSRLEILLLDETAIKDMPKILSVRRLCLNKNEKISRLPDLLNKFSQLQ 867




GO:0005622 "intracellular" evidence=IEA
GO:0005737 "cytoplasm" evidence=ISM
GO:0006952 "defense response" evidence=IEA;ISS
GO:0007165 "signal transduction" evidence=IEA
GO:0043531 "ADP binding" evidence=IEA
GO:0009416 "response to light stimulus" evidence=IMP
GO:0010114 "response to red light" evidence=IMP
GO:0042742 "defense response to bacterium" evidence=IMP
TAIR|locus:2153363 AT5G45200 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2175991 AT5G17680 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2153328 AT5G45230 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2081810 AT3G51570 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2153207 AT5G45060 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2118116 WRKY19 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2122199 AT4G36140 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2174900 AT5G40060 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2155322 LAZ5 "LAZARUS 5" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
GSVIVG00032058001
SubName- Full=Chromosome chr18 scaffold_61, whole genome shotgun sequence; (264 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query189
PLN03210 1153 PLN03210, PLN03210, Resistant to P 2e-07
PLN03210 1153 PLN03210, PLN03210, Resistant to P 9e-07
PLN03210 1153 PLN03210, PLN03210, Resistant to P 5e-04
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information
 Score = 49.9 bits (119), Expect = 2e-07
 Identities = 34/88 (38%), Positives = 51/88 (57%), Gaps = 5/88 (5%)

Query: 36  VLSDGTDIKE-PLSIELLFGLVQLTLNGCKNLEHLPRTISALKYLSTLNLSGLLKFREFP 94
            LSD + + E P SI+ L  L  L ++ C+NLE LP  I+ LK L  LNLSG  + + FP
Sbjct: 663 KLSDCSSLVELPSSIQYLNKLEDLDMSRCENLEILPTGIN-LKSLYRLNLSGCSRLKSFP 721

Query: 95  EKTSSRDELLEIHLEGTAIRGLPASIEL 122
           + +++   L    L+ TAI   P+++ L
Sbjct: 722 DISTNISWLD---LDETAIEEFPSNLRL 746


syringae 6; Provisional. Length = 1153

>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 189
KOG0617264 consensus Ras suppressor protein (contains leucine 99.59
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.52
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.52
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.46
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.43
KOG0617264 consensus Ras suppressor protein (contains leucine 99.43
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.43
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.28
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.24
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.17
KOG0472 565 consensus Leucine-rich repeat protein [Function un 99.12
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.08
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.02
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.01
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.01
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 98.94
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 98.89
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.87
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 98.84
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 98.79
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 98.77
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.75
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.71
KOG4658 889 consensus Apoptotic ATPase [Signal transduction me 98.69
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.68
PLN03150623 hypothetical protein; Provisional 98.66
COG4886 394 Leucine-rich repeat (LRR) protein [Function unknow 98.6
KOG4237 498 consensus Extracellular matrix protein slit, conta 98.53
PLN03150623 hypothetical protein; Provisional 98.5
KOG4237 498 consensus Extracellular matrix protein slit, conta 98.49
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.38
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 98.36
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.36
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.33
KOG4658 889 consensus Apoptotic ATPase [Signal transduction me 98.32
PRK15386 426 type III secretion protein GogB; Provisional 98.28
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 98.24
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.1
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.03
PRK15386 426 type III secretion protein GogB; Provisional 98.02
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 97.89
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.63
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.6
KOG0531 414 consensus Protein phosphatase 1, regulatory subuni 97.58
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 97.49
KOG0531 414 consensus Protein phosphatase 1, regulatory subuni 97.09
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 97.05
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.02
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 96.99
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 96.94
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 96.89
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 96.85
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 96.76
KOG2123 388 consensus Uncharacterized conserved protein [Funct 96.23
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 96.03
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 95.99
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.95
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 95.91
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 95.86
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 95.54
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 95.39
KOG2982 418 consensus Uncharacterized conserved protein [Funct 95.26
KOG2123 388 consensus Uncharacterized conserved protein [Funct 95.24
KOG2982 418 consensus Uncharacterized conserved protein [Funct 95.03
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 94.28
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 94.24
KOG4341483 consensus F-box protein containing LRR [General fu 94.09
KOG3864221 consensus Uncharacterized conserved protein [Funct 93.18
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 92.76
smart0037026 LRR Leucine-rich repeats, outliers. 91.96
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 91.96
COG5238 388 RNA1 Ran GTPase-activating protein (RanGAP) involv 87.51
KOG0473 326 consensus Leucine-rich repeat protein [Function un 85.79
KOG0473 326 consensus Leucine-rich repeat protein [Function un 85.44
KOG1947 482 consensus Leucine rich repeat proteins, some prote 85.12
smart0036726 LRR_CC Leucine-rich repeat - CC (cysteine-containi 84.99
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
Probab=99.59  E-value=5.3e-17  Score=114.63  Aligned_cols=142  Identities=18%  Similarity=0.256  Sum_probs=124.1

Q ss_pred             cCCCCcEEEccCCCccCCC-CccCCCCCcEEeccCCcCCccCcccccCCCCCCEEeccCCCCCccCccccCCCCCCcEEE
Q 037904           29 EADTLWEVLSDGTDIKEPL-SIELLFGLVQLTLNGCKNLEHLPRTISALKYLSTLNLSGLLKFREFPEKTSSRDELLEIH  107 (189)
Q Consensus        29 ~l~~L~~L~l~~~~l~~~p-~~~~l~~L~~L~l~~~~~l~~lp~~~~~l~~L~~L~l~~~~~~~~lp~~~~~l~~L~~l~  107 (189)
                      .+.+++.|.+++|.++.+| .++.+.+|++|++.+ ++++++|..++.+++|+.|++.- +++..+|.+++.++.|+.|+
T Consensus        31 ~~s~ITrLtLSHNKl~~vppnia~l~nlevln~~n-nqie~lp~~issl~klr~lnvgm-nrl~~lprgfgs~p~levld  108 (264)
T KOG0617|consen   31 NMSNITRLTLSHNKLTVVPPNIAELKNLEVLNLSN-NQIEELPTSISSLPKLRILNVGM-NRLNILPRGFGSFPALEVLD  108 (264)
T ss_pred             chhhhhhhhcccCceeecCCcHHHhhhhhhhhccc-chhhhcChhhhhchhhhheecch-hhhhcCccccCCCchhhhhh
Confidence            5667888999999999998 999999999999988 78999999999999999999986 67888999999999999999


Q ss_pred             ccCccCCC--CChhchhccCCC-----CCCCCCccccccCcccccc-ccCCcCccccC---cccccccceeccCCc
Q 037904          108 LEGTAIRG--LPASIELLFGNA-----APNLKNVPETLGNVESLEV-RLSCHKRAKMQ---NDFDCVEQIAKKDSD  172 (189)
Q Consensus       108 l~~~~~~~--lp~~~~~L~~L~-----~~~l~~lp~~~~~l~~L~~-l~~~~~l~~~~---~~l~~L~~L~l~~~~  172 (189)
                      +..|.+.+  +|..|-.++.|+     .+.++.+|..++.+++|+. ...-+.+-++|   +.+..|+.|++.+..
T Consensus       109 ltynnl~e~~lpgnff~m~tlralyl~dndfe~lp~dvg~lt~lqil~lrdndll~lpkeig~lt~lrelhiqgnr  184 (264)
T KOG0617|consen  109 LTYNNLNENSLPGNFFYMTTLRALYLGDNDFEILPPDVGKLTNLQILSLRDNDLLSLPKEIGDLTRLRELHIQGNR  184 (264)
T ss_pred             ccccccccccCCcchhHHHHHHHHHhcCCCcccCChhhhhhcceeEEeeccCchhhCcHHHHHHHHHHHHhcccce
Confidence            99998754  788887777776     7899999999999999999 44446677888   788889999988865



>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query189
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-09
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-06
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-06
4fcg_A 328 Uncharacterized protein; structural genomics, PSI- 8e-06
4fcg_A 328 Uncharacterized protein; structural genomics, PSI- 2e-05
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-05
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 7e-04
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 1e-04
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 1e-04
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-04
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
 Score = 54.6 bits (132), Expect = 2e-09
 Identities = 40/152 (26%), Positives = 60/152 (39%), Gaps = 31/152 (20%)

Query: 14  RQFPQEPGNCSRLWEEADTLWEVLS-DGTDIKE-PLSIELLFGLVQLTLNGCKNLEHLPR 71
            QFP +    S L        + ++ D   + E P +++   GL  LTL     L  LP 
Sbjct: 94  PQFPDQAFRLSHL--------QHMTIDAAGLMELPDTMQQFAGLETLTLARNP-LRALPA 144

Query: 72  TISALKYLSTLNLSGLLKFREFPEKTSSRDELLEI---------HLEGTAIRGLPASIEL 122
           +I++L  L  L++    +  E PE  +S D   E           LE T IR LPASI  
Sbjct: 145 SIASLNRLRELSIRACPELTELPEPLASTDASGEHQGLVNLQSLRLEWTGIRSLPASIAN 204

Query: 123 L--------FGNAAPNLKNVPETLGNVESLEV 146
           L          +    L  +   + ++  LE 
Sbjct: 205 LQNLKSLKIRNS---PLSALGPAIHHLPKLEE 233


>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query189
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.82
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.82
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 99.67
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 99.66
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.66
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 99.65
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.64
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.64
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 99.64
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.63
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.63
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 99.63
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.62
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.62
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.61
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.61
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.61
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.61
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.59
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.59
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.59
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.59
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.59
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.58
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.58
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.58
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 99.57
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.57
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.56
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.55
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.55
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.55
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.54
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.54
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.54
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.54
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.54
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 99.54
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 99.53
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.53
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.53
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.51
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.51
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.51
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.51
1xku_A 330 Decorin; proteoglycan, leucine-rich repeat, struct 99.5
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.5
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.5
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.5
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 99.5
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 99.5
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 99.5
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.5
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.49
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 99.49
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.49
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.48
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.48
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.48
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.48
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.47
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 99.47
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 99.47
2ft3_A 332 Biglycan; proteoglycan, dimer interface, structura 99.47
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.47
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 99.46
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.46
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.46
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.46
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.45
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 99.45
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 99.45
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.45
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 99.45
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.44
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.44
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.44
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.43
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.43
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.42
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.42
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 99.42
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.42
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.42
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.42
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 99.41
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.41
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.41
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.41
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.4
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.4
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.4
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.39
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.39
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.39
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.38
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.38
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.37
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.37
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.37
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.37
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.36
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.36
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.35
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.35
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.35
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.34
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.33
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 99.32
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.31
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.31
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.3
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 99.29
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.29
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.27
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.27
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.26
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.24
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.23
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.23
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.21
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.2
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.18
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.18
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.16
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.1
2ca6_A 386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.06
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.03
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.03
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.03
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 98.95
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 98.85
3goz_A 362 Leucine-rich repeat-containing protein; LEGL7, NES 98.83
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 98.79
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 98.76
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 98.69
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 98.6
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 98.55
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 98.53
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 98.49
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 98.43
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 98.43
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.25
3un9_A 372 NLR family member X1; leucine rich repeat (LRR), a 98.1
4fdw_A401 Leucine rich hypothetical protein; putative cell s 98.1
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.92
4fdw_A401 Leucine rich hypothetical protein; putative cell s 97.83
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 97.74
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.7
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 97.46
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 97.32
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 97.27
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.18
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 96.58
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 96.36
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 96.34
4fs7_A 394 Uncharacterized protein; leucine-rich repeats, pro 96.22
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 96.0
4gt6_A394 Cell surface protein; leucine rich repeats, putati 95.81
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 95.75
4gt6_A394 Cell surface protein; leucine rich repeats, putati 95.56
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 95.23
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 88.11
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 82.85
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
Probab=99.82  E-value=8.2e-20  Score=143.46  Aligned_cols=158  Identities=24%  Similarity=0.299  Sum_probs=88.7

Q ss_pred             cchhhhcCCCCcEEEccCCCccCCC-CccCCCCCcEEeccCCcCCccCcccccCCCCCCEEeccCCCCCccCccccCC--
Q 037904           23 CSRLWEEADTLWEVLSDGTDIKEPL-SIELLFGLVQLTLNGCKNLEHLPRTISALKYLSTLNLSGLLKFREFPEKTSS--   99 (189)
Q Consensus        23 ~~~~~~~l~~L~~L~l~~~~l~~~p-~~~~l~~L~~L~l~~~~~l~~lp~~~~~l~~L~~L~l~~~~~~~~lp~~~~~--   99 (189)
                      .+..+.++++|++|++++|.++.+| .+..+++|++|++++| .+..+|..+.++++|++|++++|+..+.+|..++.  
T Consensus        96 lp~~l~~l~~L~~L~L~~n~l~~lp~~~~~l~~L~~L~Ls~n-~l~~lp~~l~~l~~L~~L~L~~n~~~~~~p~~~~~~~  174 (328)
T 4fcg_A           96 FPDQAFRLSHLQHMTIDAAGLMELPDTMQQFAGLETLTLARN-PLRALPASIASLNRLRELSIRACPELTELPEPLASTD  174 (328)
T ss_dssp             CCSCGGGGTTCSEEEEESSCCCCCCSCGGGGTTCSEEEEESC-CCCCCCGGGGGCTTCCEEEEEEETTCCCCCSCSEEEC
T ss_pred             cChhhhhCCCCCEEECCCCCccchhHHHhccCCCCEEECCCC-ccccCcHHHhcCcCCCEEECCCCCCccccChhHhhcc
Confidence            3333455666777777776666666 6666666777777664 34466666666666666666666555555554432  


Q ss_pred             -------CCCCcEEEccCccCCCCChhchhccCCC-----CCCCCC------------------------ccccccCccc
Q 037904          100 -------RDELLEIHLEGTAIRGLPASIELLFGNA-----APNLKN------------------------VPETLGNVES  143 (189)
Q Consensus       100 -------l~~L~~l~l~~~~~~~lp~~~~~L~~L~-----~~~l~~------------------------lp~~~~~l~~  143 (189)
                             +++|+.|++++|.+..+|..++.++.|+     .+.+..                        +|..+..+++
T Consensus       175 ~~~~~~~l~~L~~L~L~~n~l~~lp~~l~~l~~L~~L~L~~N~l~~l~~~l~~l~~L~~L~Ls~n~~~~~~p~~~~~l~~  254 (328)
T 4fcg_A          175 ASGEHQGLVNLQSLRLEWTGIRSLPASIANLQNLKSLKIRNSPLSALGPAIHHLPKLEELDLRGCTALRNYPPIFGGRAP  254 (328)
T ss_dssp             -CCCEEESTTCCEEEEEEECCCCCCGGGGGCTTCCEEEEESSCCCCCCGGGGGCTTCCEEECTTCTTCCBCCCCTTCCCC
T ss_pred             chhhhccCCCCCEEECcCCCcCcchHhhcCCCCCCEEEccCCCCCcCchhhccCCCCCEEECcCCcchhhhHHHhcCCCC
Confidence                   5555555555555555555555554444     334444                        4444555555


Q ss_pred             ccc--ccCCcCccccC---cccccccceeccCCcchhhcccccc
Q 037904          144 LEV--RLSCHKRAKMQ---NDFDCVEQIAKKDSDSWKKNVDEGI  182 (189)
Q Consensus       144 L~~--l~~~~~l~~~~---~~l~~L~~L~l~~~~~l~~~~~~~~  182 (189)
                      |+.  +.+|+..+.+|   ..+++|++|++++|..+.. +|+++
T Consensus       255 L~~L~L~~n~~~~~~p~~~~~l~~L~~L~L~~n~~~~~-iP~~l  297 (328)
T 4fcg_A          255 LKRLILKDCSNLLTLPLDIHRLTQLEKLDLRGCVNLSR-LPSLI  297 (328)
T ss_dssp             CCEEECTTCTTCCBCCTTGGGCTTCCEEECTTCTTCCC-CCGGG
T ss_pred             CCEEECCCCCchhhcchhhhcCCCCCEEeCCCCCchhh-ccHHH
Confidence            555  44555555555   4455556666666553332 44443



>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query189
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.59
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.58
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.57
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.52
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.51
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.5
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.47
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.45
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.45
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.4
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.4
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.36
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.36
d1xkua_ 305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.35
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.31
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.31
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.3
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.29
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.29
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.27
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.2
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.18
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.12
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.07
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.01
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.0
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 98.99
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.94
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 98.87
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 98.86
d1jl5a_ 353 Leucine rich effector protein YopM {Yersinia pesti 98.74
d1jl5a_ 353 Leucine rich effector protein YopM {Yersinia pesti 98.4
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.9
d1z7xw1 460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 97.26
d1z7xw1 460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 97.21
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 97.18
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.15
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 96.71
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 96.16
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 94.52
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 93.09
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 92.36
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Ngr ectodomain-like
domain: von Willebrand factor binding domain of glycoprotein Ib alpha
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.59  E-value=8.5e-15  Score=109.74  Aligned_cols=136  Identities=17%  Similarity=0.126  Sum_probs=71.2

Q ss_pred             CCcEEEccCCCccCCC--CccCCCCCcEEeccCCcCCccCcccccCCCCCCEEeccCCCCCccCccccCCCCCCcEEEcc
Q 037904           32 TLWEVLSDGTDIKEPL--SIELLFGLVQLTLNGCKNLEHLPRTISALKYLSTLNLSGLLKFREFPEKTSSRDELLEIHLE  109 (189)
Q Consensus        32 ~L~~L~l~~~~l~~~p--~~~~l~~L~~L~l~~~~~l~~lp~~~~~l~~L~~L~l~~~~~~~~lp~~~~~l~~L~~l~l~  109 (189)
                      ++++|++++|.++.+|  .+.++++|++|++++| .++.+|. ++.+++|+.|++++| .+...+..+..+++|+.++++
T Consensus        32 ~l~~L~Ls~N~i~~l~~~~f~~l~~L~~L~L~~N-~l~~l~~-~~~l~~L~~L~Ls~N-~l~~~~~~~~~l~~L~~L~l~  108 (266)
T d1p9ag_          32 DTTILHLSENLLYTFSLATLMPYTRLTQLNLDRA-ELTKLQV-DGTLPVLGTLDLSHN-QLQSLPLLGQTLPALTVLDVS  108 (266)
T ss_dssp             TCCEEECTTSCCSEEEGGGGTTCTTCCEEECTTS-CCCEEEC-CSCCTTCCEEECCSS-CCSSCCCCTTTCTTCCEEECC
T ss_pred             CCCEEECcCCcCCCcCHHHhhccccccccccccc-ccccccc-ccccccccccccccc-ccccccccccccccccccccc
Confidence            4566666666666654  4556666666666663 3454443 345556666666653 444455555555555555555


Q ss_pred             CccCCC------------------------CChh-chhccCCC-----CCCCCCccc-cccCcccccc-ccCCcCccccC
Q 037904          110 GTAIRG------------------------LPAS-IELLFGNA-----APNLKNVPE-TLGNVESLEV-RLSCHKRAKMQ  157 (189)
Q Consensus       110 ~~~~~~------------------------lp~~-~~~L~~L~-----~~~l~~lp~-~~~~l~~L~~-l~~~~~l~~~~  157 (189)
                      ++.+..                        +|.. +..++.|+     .+.++.+|. .+..+++|+. ....|.++.+|
T Consensus       109 ~~~~~~~~~~~~~~l~~l~~L~l~~n~l~~l~~~~~~~l~~l~~l~l~~N~l~~~~~~~~~~l~~L~~L~Ls~N~L~~lp  188 (266)
T d1p9ag_         109 FNRLTSLPLGALRGLGELQELYLKGNELKTLPPGLLTPTPKLEKLSLANNNLTELPAGLLNGLENLDTLLLQENSLYTIP  188 (266)
T ss_dssp             SSCCCCCCSSTTTTCTTCCEEECTTSCCCCCCTTTTTTCTTCCEEECTTSCCSCCCTTTTTTCTTCCEEECCSSCCCCCC
T ss_pred             ccccceeeccccccccccccccccccccceeccccccccccchhcccccccccccCccccccccccceeecccCCCcccC
Confidence            554444                        3322 22333333     455555554 3555566666 33334555665


Q ss_pred             ---cccccccceeccC
Q 037904          158 ---NDFDCVEQIAKKD  170 (189)
Q Consensus       158 ---~~l~~L~~L~l~~  170 (189)
                         ..+++|+.|++++
T Consensus       189 ~~~~~~~~L~~L~L~~  204 (266)
T d1p9ag_         189 KGFFGSHLLPFAFLHG  204 (266)
T ss_dssp             TTTTTTCCCSEEECCS
T ss_pred             hhHCCCCCCCEEEecC
Confidence               3345566666654



>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure