Citrus Sinensis ID: 037952

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------15
TTIHKAAQLIYVHVSINYSGLLRCGKSCRSRWINYLHPHLKCGNFTNEEDKLIIKLHRRTDNEIKNCWNTHIKRKLLNHGLDPQTHHPLNQIHNHNIFNKYTINNNEEINQPKNLIKPKSESSFDNNTTTTNNKNYSTSGMTTDEEPP
cHHHHHHHHHHHHcccccHHcccccccHHHHcccccccccccccccHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
ccHHHHHHHHHHcccccHHHHHccHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHcccccccccccHHHHcccccccccccccHHHccccccccccccccccccccccccccccccccccccccc
TTIHKAAQLIYVHVSINYsgllrcgkSCRSRWinylhphlkcgnftneEDKLIIKLHRRTDNEIKNCWNTHIKRKLlnhgldpqthhplnqihnhnifnkytinnneeinqpknlikpksessfdnnttttnnknystsgmttdeepp
TTIHKAAQLIYVHVSINYSGLLRCGKSCRSRWINYLhphlkcgnftnEEDKLIIKLHRRTDNEIKNCWNTHIKRKLLNHGLDPQTHHPLNQIHNHNIFNKYTINNNEEINQPKNlikpksessfdnnttttnnknystsgmttdeepp
TTIHKAAQLIYVHVSINYSGLLRCGKSCRSRWINYLHPHLKCGNFTNEEDKLIIKLHRRTDNEIKNCWNTHIKRKLLNHGLDPQTHHPLNQIHNHNIFNKYTINNNEEINQPKNLIKPKsessfdnnttttnnknystsGMTTDEEPP
****KAAQLIYVHVSINYSGLLRCGKSCRSRWINYLHPHLKCGNFTNEEDKLIIKLHRRTDNEIKNCWNTHIKRKLLNHGLDPQTHHPLNQIHNHNIFNKYTIN********************************************
TTIHKAAQLIYVHVSINYSGLLRCGKSCRSRWINYLHPHLKCGNFTNEEDKLIIKLHRRTDNEIKNCWNTHIKRKLL***********************************************************************
TTIHKAAQLIYVHVSINYSGLLRCGKSCRSRWINYLHPHLKCGNFTNEEDKLIIKLHRRTDNEIKNCWNTHIKRKLLNHGLDPQTHHPLNQIHNHNIFNKYTINNNEEINQPKNLIKPKSESSFDNNTTTTNNKNYS***********
TTIHKAAQLIYVHVSINYSGLLRCGKSCRSRWINYLHPHLKCGNFTNEEDKLIIKLHRRTDNEIKNCWNTHIKRKLLNHGLDPQTHHPLNQIHN******************************************************
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
TTIHKAAQLIYVHVSINYSGLLRCGKSCRSRWINYLHPHLKCGNFTNEEDKLIIKLHRRTDNEIKNCWNTHIKRKLLNHGLDPQTHHPLNQIHNHNIFNKYTINNNEEINQPKNLIKPKSESSFDNNTTTTNNKNYSTSGMTTDEEPP
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query148 2.2.26 [Sep-21-2011]
Q38851236 Transcription repressor M yes no 0.810 0.508 0.520 6e-30
Q9SZP1282 Transcription repressor M no no 0.493 0.258 0.613 1e-24
P81395274 Myb-related protein 330 O N/A no 0.486 0.262 0.643 2e-24
P81393232 Myb-related protein 308 O N/A no 0.486 0.310 0.632 8e-24
O49608274 Transcription factor MYB3 no no 0.493 0.266 0.625 9e-24
P20025255 Myb-related protein Zm38 N/A no 0.479 0.278 0.604 3e-23
P20026267 Myb-related protein Hv1 O N/A no 0.506 0.280 0.6 9e-23
Q9S9K9257 Transcription factor MYB3 no no 0.493 0.284 0.602 1e-22
Q38850249 Transcription repressor M no no 0.506 0.301 0.554 3e-22
Q9SPG2 366 Transcription factor MYB2 no no 0.533 0.215 0.5 9e-22
>sp|Q38851|MYB6_ARATH Transcription repressor MYB6 OS=Arabidopsis thaliana GN=MYB6 PE=1 SV=1 Back     alignment and function desciption
 Score =  129 bits (324), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 75/144 (52%), Positives = 90/144 (62%), Gaps = 24/144 (16%)

Query: 19  SGLLRCGKSCRSRWINYLHPHLKCGNFTNEEDKLIIKLHR---------------RTDNE 63
           +GLLRCGKSCR RWINYL P LK GNFT++ED++IIKLH                RTDNE
Sbjct: 44  AGLLRCGKSCRLRWINYLRPDLKRGNFTDDEDQIIIKLHSLLGNKWSLIAGRLPGRTDNE 103

Query: 64  IKNCWNTHIKRKLLNHGLDPQTHHPLNQIHNHNIFNKYTINNNEEINQPKNL-IKPKSES 122
           IKN WNTHIKRKLL+HG+DPQTH  +N+    +      I N+       NL +KPK+E+
Sbjct: 104 IKNYWNTHIKRKLLSHGIDPQTHRQINESKTVSSQVVVPIQNDAVEYSFSNLAVKPKTEN 163

Query: 123 SFDNNTTTTNNKNYSTSGMTTDEE 146
           S DN          STSG TTDE+
Sbjct: 164 SSDNGA--------STSGTTTDED 179

Arabidopsis thaliana (taxid: 3702)
>sp|Q9SZP1|MYB4_ARATH Transcription repressor MYB4 OS=Arabidopsis thaliana GN=MYB4 PE=1 SV=1 Back     alignment and function description
>sp|P81395|MYB30_ANTMA Myb-related protein 330 OS=Antirrhinum majus GN=MYB330 PE=2 SV=1 Back     alignment and function description
>sp|P81393|MYB08_ANTMA Myb-related protein 308 OS=Antirrhinum majus GN=MYB308 PE=2 SV=1 Back     alignment and function description
>sp|O49608|MYB32_ARATH Transcription factor MYB32 OS=Arabidopsis thaliana GN=MYB32 PE=2 SV=1 Back     alignment and function description
>sp|P20025|MYB38_MAIZE Myb-related protein Zm38 OS=Zea mays PE=2 SV=1 Back     alignment and function description
>sp|P20026|MYB1_HORVU Myb-related protein Hv1 OS=Hordeum vulgare GN=MYB1 PE=2 SV=1 Back     alignment and function description
>sp|Q9S9K9|MYB3_ARATH Transcription factor MYB3 OS=Arabidopsis thaliana GN=MYB3 PE=1 SV=1 Back     alignment and function description
>sp|Q38850|MYB5_ARATH Transcription repressor MYB5 OS=Arabidopsis thaliana GN=MYB5 PE=1 SV=1 Back     alignment and function description
>sp|Q9SPG2|MYB28_ARATH Transcription factor MYB28 OS=Arabidopsis thaliana GN=MYB28 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query148
23476285 263 myb-like transcription factor 1 [Gossypi 0.831 0.467 0.512 1e-28
23476283 265 myb-like transcription factor 1 [Gossypi 0.864 0.483 0.516 2e-28
15233894236 transcription repressor MYB6 [Arabidopsi 0.810 0.508 0.520 4e-28
437327 294 MYB1 [Gossypium hirsutum] gi|23476277|gb 0.864 0.435 0.516 4e-28
297809121236 ATMYB6 [Arabidopsis lyrata subsp. lyrata 0.804 0.504 0.524 8e-28
23476281 268 myb-like transcription factor 1 [Gossypi 0.817 0.451 0.5 1e-27
23476279 294 myb-like transcription factor 1 [Gossypi 0.851 0.428 0.503 2e-27
223674391219 R2R3-MYB transcription factor MYB5, part 0.527 0.356 0.655 4e-26
168828717229 R2R3-Myb5 transcription factor [Pinus pi 0.527 0.340 0.655 4e-26
147744710 257 R2R3-MYB transcription factor MYB5 [Pice 0.527 0.303 0.645 5e-26
>gi|23476285|gb|AAN28273.1| myb-like transcription factor 1 [Gossypioides kirkii] Back     alignment and taxonomy information
 Score =  131 bits (329), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 80/156 (51%), Positives = 93/156 (59%), Gaps = 33/156 (21%)

Query: 19  SGLLRCGKSCRSRWINYLHPHLKCGNFTNEEDKLIIKLHR---------------RTDNE 63
           +GLLRCGKSCR RWINYL P LK GNFT EED+LIIKLH                RTDNE
Sbjct: 29  AGLLRCGKSCRLRWINYLRPDLKRGNFTEEEDELIIKLHSLLGNKWSLIAGRLPGRTDNE 88

Query: 64  IKNCWNTHIKRKLLNHGLDPQTHHPLNQIHNHNIFNKYTINNNEEI---NQPKNLIKPKS 120
           IKN WNTHIKRKL++ G+DPQTH PLNQ  N N     T+    E+   N P ++ K  S
Sbjct: 89  IKNYWNTHIKRKLISRGIDPQTHRPLNQTANTN-----TVTAPTELDFRNTPTSVSKSSS 143

Query: 121 ---------ESSFDNNTTTTNNKN-YSTSGMTTDEE 146
                    E  F +NT +    N  ++SGMTTDEE
Sbjct: 144 IKNPNFNYNEFQFKSNTDSLEEPNCTASSGMTTDEE 179

Source: Gossypioides kirkii

Species: Gossypioides kirkii

Genus: Gossypioides

Family: Malvaceae

Order: Malvales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|23476283|gb|AAN28272.1| myb-like transcription factor 1 [Gossypium herbaceum] Back     alignment and taxonomy information
>gi|15233894|ref|NP_192684.1| transcription repressor MYB6 [Arabidopsis thaliana] gi|75319413|sp|Q38851.1|MYB6_ARATH RecName: Full=Transcription repressor MYB6; AltName: Full=Myb-related protein 6; Short=AtMYB6 gi|1020155|gb|AAA98761.1| DNA-binding protein [Arabidopsis thaliana] gi|7267641|emb|CAB78069.1| DNA-binding protein [Arabidopsis thaliana] gi|21555452|gb|AAM63862.1| DNA-binding protein [Arabidopsis thaliana] gi|28393541|gb|AAO42191.1| putative myb family transcription factor [Arabidopsis thaliana] gi|28827548|gb|AAO50618.1| putative myb family transcription factor [Arabidopsis thaliana] gi|41619316|gb|AAS10074.1| MYB transcription factor [Arabidopsis thaliana] gi|332657350|gb|AEE82750.1| transcription repressor MYB6 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|437327|gb|AAA33067.1| MYB1 [Gossypium hirsutum] gi|23476277|gb|AAN28269.1| myb-like transcription factor 1 [Gossypium hirsutum] Back     alignment and taxonomy information
>gi|297809121|ref|XP_002872444.1| ATMYB6 [Arabidopsis lyrata subsp. lyrata] gi|297318281|gb|EFH48703.1| ATMYB6 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|23476281|gb|AAN28271.1| myb-like transcription factor 1 [Gossypium raimondii] Back     alignment and taxonomy information
>gi|23476279|gb|AAN28270.1| myb-like transcription factor 1 [Gossypium hirsutum] Back     alignment and taxonomy information
>gi|223674391|gb|ACN12960.1| R2R3-MYB transcription factor MYB5, partial [Pinus taeda] Back     alignment and taxonomy information
>gi|168828717|gb|ACA33845.1| R2R3-Myb5 transcription factor [Pinus pinaster] Back     alignment and taxonomy information
>gi|147744710|gb|ABQ51221.1| R2R3-MYB transcription factor MYB5 [Picea glauca] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query148
TAIR|locus:2133677236 MYB6 "myb domain protein 6" [A 0.682 0.427 0.538 1.8e-25
TAIR|locus:2121259282 MYB4 "myb domain protein 4" [A 0.493 0.258 0.613 6.8e-24
TAIR|locus:2059883269 MYB7 "myb domain protein 7" [A 0.493 0.271 0.625 1.1e-23
TAIR|locus:2131576274 MYB32 "myb domain protein 32" 0.493 0.266 0.625 1.8e-23
TAIR|locus:2009452257 MYB3 "myb domain protein 3" [A 0.493 0.284 0.602 1.3e-22
TAIR|locus:1005716764212 HOS10 "high response to osmoti 0.452 0.316 0.634 2.1e-22
TAIR|locus:2132584266 MYB85 "myb domain protein 85" 0.635 0.353 0.508 4.3e-22
TAIR|locus:2092820249 MYB5 "myb domain protein 5" [A 0.520 0.309 0.532 1.5e-21
TAIR|locus:2098906 299 MYB17 "myb domain protein 17" 0.479 0.237 0.569 3.9e-21
TAIR|locus:2012375 366 MYB61 "AT1G09540" [Arabidopsis 0.601 0.243 0.480 6.3e-21
TAIR|locus:2133677 MYB6 "myb domain protein 6" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 289 (106.8 bits), Expect = 1.8e-25, P = 1.8e-25
 Identities = 63/117 (53%), Positives = 75/117 (64%)

Query:    19 SGLLRCGKSCRSRWINYLHPHLKCGNFTNEEDKLIIKLHR---------------RTDNE 63
             +GLLRCGKSCR RWINYL P LK GNFT++ED++IIKLH                RTDNE
Sbjct:    44 AGLLRCGKSCRLRWINYLRPDLKRGNFTDDEDQIIIKLHSLLGNKWSLIAGRLPGRTDNE 103

Query:    64 IKNCWNTHIKRKLLNHGLDPQTHHPLNQIHNHNIFNKYTINNNEEINQPKNL-IKPK 119
             IKN WNTHIKRKLL+HG+DPQTH  +N+    +      I N+       NL +KPK
Sbjct:   104 IKNYWNTHIKRKLLSHGIDPQTHRQINESKTVSSQVVVPIQNDAVEYSFSNLAVKPK 160
GO:0003677 "DNA binding" evidence=IEA;ISS;TAS
GO:0005634 "nucleus" evidence=ISM
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=ISS
GO:0009739 "response to gibberellin stimulus" evidence=IEP
GO:0009751 "response to salicylic acid stimulus" evidence=IEP
GO:0009753 "response to jasmonic acid stimulus" evidence=IEP
GO:0006355 "regulation of transcription, DNA-dependent" evidence=ISS
TAIR|locus:2121259 MYB4 "myb domain protein 4" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2059883 MYB7 "myb domain protein 7" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2131576 MYB32 "myb domain protein 32" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2009452 MYB3 "myb domain protein 3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:1005716764 HOS10 "high response to osmotic stress 10" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2132584 MYB85 "myb domain protein 85" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2092820 MYB5 "myb domain protein 5" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2098906 MYB17 "myb domain protein 17" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2012375 MYB61 "AT1G09540" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
ATMYB6
ATMYB6; DNA binding / transcription factor; Encodes myb6 DNA-binding protein. (236 aa)
(Arabidopsis thaliana)
Predicted Functional Partners:
AT1G01240
unknown protein; unknown protein; INVOLVED IN- N-terminal protein myristoylation; EXPRESSED IN- [...] (331 aa)
    •   0.671
AT2G46550
unknown protein; unknown protein; FUNCTIONS IN- molecular_function unknown; INVOLVED IN- biolog [...] (397 aa)
    •   0.500
SDT
SDT (SPERMIDINE DISINAPOYL ACYLTRANSFERASE); sinapoyl spermidine-sinapoyl CoA N-acyltransferase [...] (451 aa)
      • 0.409

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query148
PLN03212249 PLN03212, PLN03212, Transcription repressor MYB5; 3e-28
PLN03091 459 PLN03091, PLN03091, hypothetical protein; Provisio 3e-25
COG5147 512 COG5147, REB1, Myb superfamily proteins, including 9e-05
smart0071749 smart00717, SANT, SANT SWI3, ADA2, N-CoR and TFIII 0.002
>gnl|CDD|178751 PLN03212, PLN03212, Transcription repressor MYB5; Provisional Back     alignment and domain information 
 Score =  104 bits (260), Expect = 3e-28
 Identities = 51/92 (55%), Positives = 63/92 (68%), Gaps = 17/92 (18%)

Query: 19  SGLLRCGKSCRSRWINYLHPHLKCGNFTNEEDKLIIKLHR---------------RTDNE 63
           +GLLRCGKSCR RW+NYL P +K G  T++E+ LI++LHR               RTDNE
Sbjct: 55  AGLLRCGKSCRLRWMNYLRPSVKRGGITSDEEDLILRLHRLLGNRWSLIAGRIPGRTDNE 114

Query: 64  IKNCWNTHIKRKLLNHGLDPQTHHPL--NQIH 93
           IKN WNTH+++KLL  G+DPQTH PL  N IH
Sbjct: 115 IKNYWNTHLRKKLLRQGIDPQTHKPLDANNIH 146

Length = 249
>gnl|CDD|215570 PLN03091, PLN03091, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|227476 COG5147, REB1, Myb superfamily proteins, including transcription factors and mRNA splicing factors [Transcription / RNA processing and modification / Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|197842 smart00717, SANT, SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 148
KOG0048238 consensus Transcription factor, Myb superfamily [T 99.95
PLN03212249 Transcription repressor MYB5; Provisional 99.94
PLN03091 459 hypothetical protein; Provisional 99.92
PF1392160 Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: 99.3
KOG0050 617 consensus mRNA splicing protein CDC5 (Myb superfam 99.08
COG5147 512 REB1 Myb superfamily proteins, including transcrip 98.97
KOG0049 939 consensus Transcription factor, Myb superfamily [T 98.77
KOG0049 939 consensus Transcription factor, Myb superfamily [T 98.72
KOG0051607 consensus RNA polymerase I termination factor, Myb 98.43
PF0024948 Myb_DNA-binding: Myb-like DNA-binding domain; Inte 98.32
PLN03212 249 Transcription repressor MYB5; Provisional 98.32
PF0024948 Myb_DNA-binding: Myb-like DNA-binding domain; Inte 98.22
KOG0048 238 consensus Transcription factor, Myb superfamily [T 98.06
smart0071749 SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-bindi 97.98
PF1392160 Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: 97.89
PLN03091 459 hypothetical protein; Provisional 97.86
cd0016745 SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding do 97.62
smart0071749 SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-bindi 97.44
cd0016745 SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding do 97.16
COG5147512 REB1 Myb superfamily proteins, including transcrip 96.84
TIGR02894161 DNA_bind_RsfA transcription factor, RsfA family. I 96.58
PF1383790 Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; 95.26
PF0891465 Myb_DNA-bind_2: Rap1 Myb domain; InterPro: IPR0150 94.95
PRK13923170 putative spore coat protein regulator protein YlbO 94.83
PF1387378 Myb_DNA-bind_5: Myb/SANT-like DNA-binding domain 93.27
PF1383790 Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; 93.21
PF09111118 SLIDE: SLIDE; InterPro: IPR015195 The SLIDE domain 92.53
KOG0051 607 consensus RNA polymerase I termination factor, Myb 90.9
PF1277696 Myb_DNA-bind_3: Myb/SANT-like DNA-binding domain; 90.11
PF13325199 MCRS_N: N-terminal region of micro-spherule protei 87.99
KOG0457 438 consensus Histone acetyltransferase complex SAGA/A 84.59
KOG4282 345 consensus Transcription factor GT-2 and related pr 83.86
>KOG0048 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information 
Probab=99.95  E-value=4.4e-28  Score=195.93  Aligned_cols=85  Identities=58%  Similarity=1.006  Sum_probs=77.0

Q ss_pred             HHHHHhhhhhhHHhhhccCCCCChhHHHHHhhhccCCCCCCCCCCHHHHHHHHHhhc---------------CchhHHHH
Q 037952            2 TIHKAAQLIYVHVSINYSGLLRCGKSCRSRWINYLHPHLKCGNFTNEEDKLIIKLHR---------------RTDNEIKN   66 (148)
Q Consensus         2 ~i~k~~~~~~~~~~~~~~g~~R~~kqCr~Rw~n~L~p~i~~~~wt~eEd~~l~~l~~---------------Rt~~~ikn   66 (148)
                      -|+++|..+|-.+ |+.+||+|||||||+||+|||+|+|++|.||+|||++||+||+               ||||+|||
T Consensus        23 ~V~~~G~~~W~~i-~k~~gl~R~GKSCRlRW~NyLrP~ikrg~fT~eEe~~Ii~lH~~~GNrWs~IA~~LPGRTDNeIKN  101 (238)
T KOG0048|consen   23 SIKSFGKHNGTAL-PKLAGLRRCGKSCRLRWTNYLRPDLKRGNFSDEEEDLIIKLHALLGNRWSLIAGRLPGRTDNEVKN  101 (238)
T ss_pred             HHHHhCCCCcchh-hhhcCCCccchHHHHHhhcccCCCccCCCCCHHHHHHHHHHHHHHCcHHHHHHhhCCCcCHHHHHH
Confidence            3788999866555 8899999999999999999999999999999999999999998               99999999


Q ss_pred             HHHHHHHHHHHhCCCCCCCCC
Q 037952           67 CWNTHIKRKLLNHGLDPQTHH   87 (148)
Q Consensus        67 rw~~~~~~~~~~~~~~~~~~~   87 (148)
                      +|+++||||+.....++.+..
T Consensus       102 ~Wnt~lkkkl~~~~~~~~~~~  122 (238)
T KOG0048|consen  102 HWNTHLKKKLLKMGIDPSTHR  122 (238)
T ss_pred             HHHHHHHHHHHHcCCCCCccc
Confidence            999999999998776666543

>PLN03212 Transcription repressor MYB5; Provisional Back     alignment and domain information
>PLN03091 hypothetical protein; Provisional Back     alignment and domain information
>PF13921 Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: 1A5J_A 1MBH_A 1GV5_A 1H89_C 1IDY_A 1MBK_A 1IDZ_A 1H88_C 1GVD_A 1MBG_A Back     alignment and domain information
>KOG0050 consensus mRNA splicing protein CDC5 (Myb superfamily) [RNA processing and modification; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>COG5147 REB1 Myb superfamily proteins, including transcription factors and mRNA splicing factors [Transcription / RNA processing and modification / Cell division and chromosome partitioning] Back     alignment and domain information
>KOG0049 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information
>KOG0049 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information
>KOG0051 consensus RNA polymerase I termination factor, Myb superfamily [Transcription] Back     alignment and domain information
>PF00249 Myb_DNA-binding: Myb-like DNA-binding domain; InterPro: IPR014778 The retroviral oncogene v-myb, and its cellular counterpart c-myb, encode nuclear DNA-binding proteins Back     alignment and domain information
>PLN03212 Transcription repressor MYB5; Provisional Back     alignment and domain information
>PF00249 Myb_DNA-binding: Myb-like DNA-binding domain; InterPro: IPR014778 The retroviral oncogene v-myb, and its cellular counterpart c-myb, encode nuclear DNA-binding proteins Back     alignment and domain information
>KOG0048 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information
>smart00717 SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains Back     alignment and domain information
>PF13921 Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: 1A5J_A 1MBH_A 1GV5_A 1H89_C 1IDY_A 1MBK_A 1IDZ_A 1H88_C 1GVD_A 1MBG_A Back     alignment and domain information
>PLN03091 hypothetical protein; Provisional Back     alignment and domain information
>cd00167 SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains Back     alignment and domain information
>smart00717 SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains Back     alignment and domain information
>cd00167 SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains Back     alignment and domain information
>COG5147 REB1 Myb superfamily proteins, including transcription factors and mRNA splicing factors [Transcription / RNA processing and modification / Cell division and chromosome partitioning] Back     alignment and domain information
>TIGR02894 DNA_bind_RsfA transcription factor, RsfA family Back     alignment and domain information
>PF13837 Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; PDB: 2EBI_A 2JMW_A Back     alignment and domain information
>PF08914 Myb_DNA-bind_2: Rap1 Myb domain; InterPro: IPR015010 Rap1 Myb adopts a canonical three-helix bundle tertiary structure, with the second and third helices forming a helix-turn-helix variant motif Back     alignment and domain information
>PRK13923 putative spore coat protein regulator protein YlbO; Provisional Back     alignment and domain information
>PF13873 Myb_DNA-bind_5: Myb/SANT-like DNA-binding domain Back     alignment and domain information
>PF13837 Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; PDB: 2EBI_A 2JMW_A Back     alignment and domain information
>PF09111 SLIDE: SLIDE; InterPro: IPR015195 The SLIDE domain adopts a secondary structure comprising a main core of three alpha-helices Back     alignment and domain information
>KOG0051 consensus RNA polymerase I termination factor, Myb superfamily [Transcription] Back     alignment and domain information
>PF12776 Myb_DNA-bind_3: Myb/SANT-like DNA-binding domain; InterPro: IPR024752 This domain, found in a range of uncharacterised proteins, may be related to Myb/SANT-like DNA binding domains Back     alignment and domain information
>PF13325 MCRS_N: N-terminal region of micro-spherule protein Back     alignment and domain information
>KOG0457 consensus Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] Back     alignment and domain information
>KOG4282 consensus Transcription factor GT-2 and related proteins, contains trihelix DNA-binding/SANT domain [Transcription] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query148
1a5j_A110 Chicken B-Myb Dna Binding Domain, Repeat 2 And Repe 3e-09
1gv2_A105 Crystal Structure Of C-Myb R2r3 Length = 105 3e-08
1h88_C159 Crystal Structure Of Ternary Protein-Dna Complex1 L 3e-08
1mse_C105 Solution Structure Of A Specific Dna Complex Of The 3e-08
1h8a_C128 Crystal Structure Of Ternary Protein-Dna Complex3 L 4e-08
3zqc_A131 Structure Of The Trichomonas Vaginalis Myb3 Dna-Bin 4e-05
>pdb|1A5J|A Chain A, Chicken B-Myb Dna Binding Domain, Repeat 2 And Repeat3, Nmr, 32 Structures Length = 110 Back     alignment and structure 
Iteration: 1

 Score = 57.4 bits (137), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 29/69 (42%), Positives = 41/69 (59%), Gaps = 15/69 (21%)
Query: 23  RCGKSCRSRWINYLHPHLKCGNFTNEEDKLIIKLHR---------------RTDNEIKNC 67
           R GK CR RW N+L+P +K  ++T EED++I + H+               RTDN +KN 
Sbjct: 40  RLGKQCRERWHNHLNPEVKKSSWTEEEDRIIFEAHKVLGNRWAEIAKLLPGRTDNAVKNH 99
Query: 68  WNTHIKRKL 76
           WN+ IKRK+
Sbjct: 100 WNSTIKRKV 108
>pdb|1GV2|A Chain A, Crystal Structure Of C-Myb R2r3 Length = 105 Back     alignment and structure
>pdb|1H88|C Chain C, Crystal Structure Of Ternary Protein-Dna Complex1 Length = 159 Back     alignment and structure
>pdb|1MSE|C Chain C, Solution Structure Of A Specific Dna Complex Of The Myb Dna- Binding Domain With Cooperative Recognition Helices Length = 105 Back     alignment and structure
>pdb|1H8A|C Chain C, Crystal Structure Of Ternary Protein-Dna Complex3 Length = 128 Back     alignment and structure
>pdb|3ZQC|A Chain A, Structure Of The Trichomonas Vaginalis Myb3 Dna-Binding Domain Bound To A Promoter Sequence Reveals A Unique C- Terminal Beta-Hairpin Conformation Length = 131 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query148
3zqc_A131 MYB3; transcription-DNA complex, DNA-binding prote 4e-28
1gv2_A105 C-MYB, MYB proto-oncogene protein; transcription, 3e-27
1h8a_C128 AMV V-MYB, MYB transforming protein; transcription 4e-26
1h8a_C128 AMV V-MYB, MYB transforming protein; transcription 6e-10
3osg_A126 MYB21; transcription-DNA complex, MYB2, R2R3 domai 2e-24
1h89_C159 C-MYB, MYB proto-oncogene protein; transcription/D 2e-22
1h89_C159 C-MYB, MYB proto-oncogene protein; transcription/D 2e-08
2k9n_A107 MYB24; R2R3 domain, DNA-binding, nucleus, DNA bind 1e-21
2dim_A70 Cell division cycle 5-like protein; MYB_DNA-bindin 2e-08
1gvd_A52 MYB proto-oncogene protein; transcription, transcr 1e-06
1guu_A52 C-MYB, MYB proto-oncogene protein; transcription, 3e-05
2d9a_A60 B-MYB, MYB-related protein B; DNA binding, structu 4e-04
>3zqc_A MYB3; transcription-DNA complex, DNA-binding protein, nucleus; 2.90A {Trichomonas vaginalis} Length = 131 Back     alignment and structure
 Score = 99.7 bits (249), Expect = 4e-28
 Identities = 25/88 (28%), Positives = 37/88 (42%), Gaps = 15/88 (17%)

Query: 22  LRCGKSCRSRWINYLHPHLKCGNFTNEEDKLIIKLHR---------------RTDNEIKN 66
            R  K CR RW N+L P +    +T EED+ I + +                RTDN IKN
Sbjct: 34  NRSPKQCRERWFNHLDPAVVKHAWTPEEDETIFRNYLKLGSKWSVIAKLIPGRTDNAIKN 93

Query: 67  CWNTHIKRKLLNHGLDPQTHHPLNQIHN 94
            WN+ I +++  +    +   P      
Sbjct: 94  RWNSSISKRISTNSNHKEILLPDRSKKR 121
>1gv2_A C-MYB, MYB proto-oncogene protein; transcription, DNA binding, ION binding; 1.68A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 PDB: 1mse_C* 1msf_C* 1a5j_A 1idy_A 1idz_A 1mbj_A 1mbk_A Length = 105 Back     alignment and structure
>1h8a_C AMV V-MYB, MYB transforming protein; transcription/DNA; 2.23A {Avian myeloblastosis virus} SCOP: a.4.1.3 a.4.1.3 Length = 128 Back     alignment and structure
>1h8a_C AMV V-MYB, MYB transforming protein; transcription/DNA; 2.23A {Avian myeloblastosis virus} SCOP: a.4.1.3 a.4.1.3 Length = 128 Back     alignment and structure
>3osg_A MYB21; transcription-DNA complex, MYB2, R2R3 domain, DNA binding PR transcription factor; 2.00A {Trichomonas vaginalis} PDB: 3osf_A Length = 126 Back     alignment and structure
>1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C Length = 159 Back     alignment and structure
>1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C Length = 159 Back     alignment and structure
>2k9n_A MYB24; R2R3 domain, DNA-binding, nucleus, DNA binding protein; NMR {Trichomonas vaginalis} PDB: 2kdz_A Length = 107 Back     alignment and structure
>2dim_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>1gvd_A MYB proto-oncogene protein; transcription, transcription regulation, C-MYB, DNA binding, ION binding, nuclear protein; 1.45A {Mus musculus} SCOP: a.4.1.3 PDB: 1gv5_A 1mbg_A 1mbh_A Length = 52 Back     alignment and structure
>1guu_A C-MYB, MYB proto-oncogene protein; transcription, transcription regulation, DNA binding, ION bindi proto-oncogene, nuclear protein, activator; 1.6A {Mus musculus} SCOP: a.4.1.3 PDB: 1mbe_A 1mbf_A Length = 52 Back     alignment and structure
>2d9a_A B-MYB, MYB-related protein B; DNA binding, structural genomics, unknown function, NPPSFA; NMR {Mus musculus} Length = 60 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query148
2k9n_A107 MYB24; R2R3 domain, DNA-binding, nucleus, DNA bind 99.9
1gv2_A105 C-MYB, MYB proto-oncogene protein; transcription, 99.89
3zqc_A131 MYB3; transcription-DNA complex, DNA-binding prote 99.88
3osg_A126 MYB21; transcription-DNA complex, MYB2, R2R3 domai 99.87
1h8a_C128 AMV V-MYB, MYB transforming protein; transcription 99.86
1h89_C159 C-MYB, MYB proto-oncogene protein; transcription/D 99.83
1h89_C159 C-MYB, MYB proto-oncogene protein; transcription/D 99.78
1h8a_C128 AMV V-MYB, MYB transforming protein; transcription 99.72
2dim_A70 Cell division cycle 5-like protein; MYB_DNA-bindin 99.63
2llk_A73 Cyclin-D-binding MYB-like transcription factor 1; 99.53
2din_A66 Cell division cycle 5-like protein; MYB_DNA-bindin 99.42
2cu7_A72 KIAA1915 protein; nuclear protein, SANT domain, DN 99.32
1ign_A246 Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, 99.13
1ity_A69 TRF1; helix-turn-helix, telomeres, DNA binding, MY 99.12
2juh_A121 Telomere binding protein TBP1; helix, nucleus, nuc 99.11
1gvd_A52 MYB proto-oncogene protein; transcription, transcr 99.1
2roh_A122 RTBP1, telomere binding protein-1; plant, nucleus, 99.09
2d9a_A60 B-MYB, MYB-related protein B; DNA binding, structu 99.07
2d9a_A60 B-MYB, MYB-related protein B; DNA binding, structu 99.06
1guu_A52 C-MYB, MYB proto-oncogene protein; transcription, 99.01
2ltp_A89 Nuclear receptor corepressor 2; SMRT, TRAC, SGC, s 98.54
1ity_A69 TRF1; helix-turn-helix, telomeres, DNA binding, MY 98.96
1guu_A52 C-MYB, MYB proto-oncogene protein; transcription, 98.95
1x41_A60 Transcriptional adaptor 2-like, isoform B; transcr 98.94
1gvd_A52 MYB proto-oncogene protein; transcription, transcr 98.94
3sjm_A64 Telomeric repeat-binding factor 2; human telomeric 98.94
2dim_A70 Cell division cycle 5-like protein; MYB_DNA-bindin 98.91
2yum_A75 ZZZ3 protein, zinc finger ZZ-type-containing prote 98.9
1w0t_A53 Telomeric repeat binding factor 1; telomere, DNA-b 98.89
3sjm_A64 Telomeric repeat-binding factor 2; human telomeric 98.8
2ckx_A83 NGTRF1, telomere binding protein TBP1; nuclear pro 98.77
2din_A66 Cell division cycle 5-like protein; MYB_DNA-bindin 98.77
1x41_A60 Transcriptional adaptor 2-like, isoform B; transcr 98.75
2yum_A75 ZZZ3 protein, zinc finger ZZ-type-containing prote 98.69
2elk_A58 SPCC24B10.08C protein; hypothetical protein, struc 98.65
1w0t_A53 Telomeric repeat binding factor 1; telomere, DNA-b 98.61
2elk_A58 SPCC24B10.08C protein; hypothetical protein, struc 98.6
1ign_A 246 Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, 98.59
3hm5_A93 DNA methyltransferase 1-associated protein 1; DNA 98.58
2juh_A121 Telomere binding protein TBP1; helix, nucleus, nuc 98.55
2cqr_A73 RSGI RUH-043, DNAJ homolog subfamily C member 1; m 98.51
2aje_A105 Telomere repeat-binding protein; DNA-binding, Trp, 98.46
2cu7_A72 KIAA1915 protein; nuclear protein, SANT domain, DN 98.42
1gv2_A105 C-MYB, MYB proto-oncogene protein; transcription, 98.38
2ckx_A83 NGTRF1, telomere binding protein TBP1; nuclear pro 98.35
1x58_A62 Hypothetical protein 4930532D21RIK; MUS musculus a 98.35
2roh_A122 RTBP1, telomere binding protein-1; plant, nucleus, 98.29
2aje_A105 Telomere repeat-binding protein; DNA-binding, Trp, 98.29
3osg_A126 MYB21; transcription-DNA complex, MYB2, R2R3 domai 98.26
3zqc_A131 MYB3; transcription-DNA complex, DNA-binding prote 98.24
2yus_A79 SWI/SNF-related matrix-associated actin- dependent 98.2
2cjj_A93 Radialis; plant development, DNA-binding protein, 98.17
2yus_A79 SWI/SNF-related matrix-associated actin- dependent 98.16
2k9n_A107 MYB24; R2R3 domain, DNA-binding, nucleus, DNA bind 98.05
2cqr_A73 RSGI RUH-043, DNAJ homolog subfamily C member 1; m 97.96
2ltp_A89 Nuclear receptor corepressor 2; SMRT, TRAC, SGC, s 97.19
2llk_A73 Cyclin-D-binding MYB-like transcription factor 1; 97.88
2cqq_A72 RSGI RUH-037, DNAJ homolog subfamily C member 1; m 97.74
2cjj_A93 Radialis; plant development, DNA-binding protein, 97.64
1ug2_A95 2610100B20RIK gene product; hypothetical protein, 97.27
2eqr_A61 N-COR1, N-COR, nuclear receptor corepressor 1; SAN 97.01
2lr8_A70 CAsp8-associated protein 2; structural genomics, n 95.93
4iej_A93 DNA methyltransferase 1-associated protein 1; DNA 96.68
2iw5_B235 Protein corest, REST corepressor 1; oxidoreductase 96.68
1fex_A59 TRF2-interacting telomeric RAP1 protein; helix tur 96.59
2eqr_A61 N-COR1, N-COR, nuclear receptor corepressor 1; SAN 95.91
1wgx_A73 KIAA1903 protein; MYB DNA-binding domain, human cD 95.82
2ebi_A86 DNA binding protein GT-1; DNA-binding domain, phos 95.8
1fex_A59 TRF2-interacting telomeric RAP1 protein; helix tur 95.76
1wgx_A73 KIAA1903 protein; MYB DNA-binding domain, human cD 95.63
2cqq_A72 RSGI RUH-037, DNAJ homolog subfamily C member 1; m 95.45
2iw5_B235 Protein corest, REST corepressor 1; oxidoreductase 95.29
2ebi_A86 DNA binding protein GT-1; DNA-binding domain, phos 93.42
1ofc_X304 ISWI protein; nuclear protein, chromatin remodelin 87.0
2yqk_A63 Arginine-glutamic acid dipeptide repeats protein; 86.9
1x58_A62 Hypothetical protein 4930532D21RIK; MUS musculus a 85.67
4eef_G74 F-HB80.4, designed hemagglutinin binding protein; 85.24
2xag_B482 REST corepressor 1; amine oxidase, chromatin regul 83.89
2y9y_A374 Imitation switch protein 1 (DEL_ATPase); transcrip 81.82
4eef_G74 F-HB80.4, designed hemagglutinin binding protein; 81.45
>2k9n_A MYB24; R2R3 domain, DNA-binding, nucleus, DNA binding protein; NMR {Trichomonas vaginalis} PDB: 2kdz_A Back     alignment and structure
Probab=99.90  E-value=5.9e-24  Score=151.66  Aligned_cols=75  Identities=25%  Similarity=0.503  Sum_probs=65.4

Q ss_pred             HHHHHhhhhhhHHhhhccCCCCChhHHHHHhhhccCCCCCCCCCCHHHHHHHHHhhc---------------CchhHHHH
Q 037952            2 TIHKAAQLIYVHVSINYSGLLRCGKSCRSRWINYLHPHLKCGNFTNEEDKLIIKLHR---------------RTDNEIKN   66 (148)
Q Consensus         2 ~i~k~~~~~~~~~~~~~~g~~R~~kqCr~Rw~n~L~p~i~~~~wt~eEd~~l~~l~~---------------Rt~~~ikn   66 (148)
                      +|.+||..+|-.| |..++ +|+++|||+||.+||+|+|++|+||+|||++|+++|.               ||+++|||
T Consensus        15 ~v~~~g~~~W~~I-a~~~~-~Rt~~qcr~Rw~~~L~p~i~~~~WT~eEd~~L~~~~~~~G~~W~~Ia~~l~gRt~~~~k~   92 (107)
T 2k9n_A           15 LVMRYGAKDWIRI-SQLMI-TRNPRQCRERWNNYINPALRTDPWSPEEDMLLDQKYAEYGPKWNKISKFLKNRSDNNIRN   92 (107)
T ss_dssp             HHHHHCSSCHHHH-HHHTT-TSCHHHHHHHHHHHSSSCCTTCCCCHHHHHHHHHHHHHTCSCHHHHHHHHSSSCHHHHHH
T ss_pred             HHHHHCCCCHHHH-hhhcC-CCCHHHHHHHHHHHHcccccccccCHHHHHHHHHHHHHhCcCHHHHHHHCCCCCHHHHHH
Confidence            5778887666555 55565 6999999999999999999999999999999999886               99999999


Q ss_pred             HHHHHHHHHHHh
Q 037952           67 CWNTHIKRKLLN   78 (148)
Q Consensus        67 rw~~~~~~~~~~   78 (148)
                      ||+.++++....
T Consensus        93 rw~~l~r~~~~~  104 (107)
T 2k9n_A           93 RWMMIARHRAKH  104 (107)
T ss_dssp             HHHHHHHHHHSS
T ss_pred             HHHHHHhhHHHh
Confidence            999998886544
>1gv2_A C-MYB, MYB proto-oncogene protein; transcription, DNA binding, ION binding; 1.68A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 PDB: 1mse_C* 1msf_C* 1a5j_A 1idy_A 1idz_A 1mbj_A 1mbk_A Back     alignment and structure
>3zqc_A MYB3; transcription-DNA complex, DNA-binding protein, nucleus; 2.90A {Trichomonas vaginalis} Back     alignment and structure
>3osg_A MYB21; transcription-DNA complex, MYB2, R2R3 domain, DNA binding PR transcription factor; 2.00A {Trichomonas vaginalis} PDB: 3osf_A Back     alignment and structure
>1h8a_C AMV V-MYB, MYB transforming protein; transcription/DNA; 2.23A {Avian myeloblastosis virus} SCOP: a.4.1.3 a.4.1.3 Back     alignment and structure
>1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C Back     alignment and structure
>1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C Back     alignment and structure
>1h8a_C AMV V-MYB, MYB transforming protein; transcription/DNA; 2.23A {Avian myeloblastosis virus} SCOP: a.4.1.3 a.4.1.3 Back     alignment and structure
>2dim_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2llk_A Cyclin-D-binding MYB-like transcription factor 1; helix bundle, SGC, structural genomics consortium, NESG, NOR structural genomics consortium; NMR {Homo sapiens} Back     alignment and structure
>2din_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cu7_A KIAA1915 protein; nuclear protein, SANT domain, DNA binding, regulation of transcription, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>1ign_A Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, DNA binding protein/DNA complex; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.6 a.4.1.6 PDB: 3ukg_A Back     alignment and structure
>1ity_A TRF1; helix-turn-helix, telomeres, DNA binding, MYB domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1iv6_A Back     alignment and structure
>2juh_A Telomere binding protein TBP1; helix, nucleus, nuclear protein; NMR {Nicotiana glutinosa} Back     alignment and structure
>1gvd_A MYB proto-oncogene protein; transcription, transcription regulation, C-MYB, DNA binding, ION binding, nuclear protein; 1.45A {Mus musculus} SCOP: a.4.1.3 PDB: 1gv5_A 1mbg_A 1mbh_A Back     alignment and structure
>2roh_A RTBP1, telomere binding protein-1; plant, nucleus, DNA binding protein; NMR {Oryza sativa} Back     alignment and structure
>2d9a_A B-MYB, MYB-related protein B; DNA binding, structural genomics, unknown function, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2d9a_A B-MYB, MYB-related protein B; DNA binding, structural genomics, unknown function, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1guu_A C-MYB, MYB proto-oncogene protein; transcription, transcription regulation, DNA binding, ION bindi proto-oncogene, nuclear protein, activator; 1.6A {Mus musculus} SCOP: a.4.1.3 PDB: 1mbe_A 1mbf_A Back     alignment and structure
>2ltp_A Nuclear receptor corepressor 2; SMRT, TRAC, SGC, structural genomics consortium, NESG, north structural genomics consortium; NMR {Homo sapiens} Back     alignment and structure
>1ity_A TRF1; helix-turn-helix, telomeres, DNA binding, MYB domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1iv6_A Back     alignment and structure
>1guu_A C-MYB, MYB proto-oncogene protein; transcription, transcription regulation, DNA binding, ION bindi proto-oncogene, nuclear protein, activator; 1.6A {Mus musculus} SCOP: a.4.1.3 PDB: 1mbe_A 1mbf_A Back     alignment and structure
>1x41_A Transcriptional adaptor 2-like, isoform B; transcriptional adaptor protein2, transcriptional activation, MYB domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1gvd_A MYB proto-oncogene protein; transcription, transcription regulation, C-MYB, DNA binding, ION binding, nuclear protein; 1.45A {Mus musculus} SCOP: a.4.1.3 PDB: 1gv5_A 1mbg_A 1mbh_A Back     alignment and structure
>3sjm_A Telomeric repeat-binding factor 2; human telomeric repeat binding protein 2, telomere, telomeri homeodomain proteins amino acid sequence; HET: DNA; 1.35A {Homo sapiens} PDB: 1xg1_A 1vfc_A 1vf9_A 1w0u_A Back     alignment and structure
>2dim_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yum_A ZZZ3 protein, zinc finger ZZ-type-containing protein 3; transcription, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1w0t_A Telomeric repeat binding factor 1; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle; 2.00A {Homo sapiens} SCOP: a.4.1.4 PDB: 1ba5_A Back     alignment and structure
>3sjm_A Telomeric repeat-binding factor 2; human telomeric repeat binding protein 2, telomere, telomeri homeodomain proteins amino acid sequence; HET: DNA; 1.35A {Homo sapiens} PDB: 1xg1_A 1vfc_A 1vf9_A 1w0u_A Back     alignment and structure
>2ckx_A NGTRF1, telomere binding protein TBP1; nuclear protein; 1.9A {Nicotiana tabacum} SCOP: a.4.1.3 PDB: 2qhb_A Back     alignment and structure
>2din_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x41_A Transcriptional adaptor 2-like, isoform B; transcriptional adaptor protein2, transcriptional activation, MYB domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2yum_A ZZZ3 protein, zinc finger ZZ-type-containing protein 3; transcription, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2elk_A SPCC24B10.08C protein; hypothetical protein, structural genomics, NPPSFA; NMR {Schizosaccharomyces pombe} Back     alignment and structure
>1w0t_A Telomeric repeat binding factor 1; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle; 2.00A {Homo sapiens} SCOP: a.4.1.4 PDB: 1ba5_A Back     alignment and structure
>2elk_A SPCC24B10.08C protein; hypothetical protein, structural genomics, NPPSFA; NMR {Schizosaccharomyces pombe} Back     alignment and structure
>1ign_A Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, DNA binding protein/DNA complex; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.6 a.4.1.6 PDB: 3ukg_A Back     alignment and structure
>3hm5_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin, structural genomics consortium, SGC, activator, chromatin regulator; HET: DNA; 1.80A {Homo sapiens} Back     alignment and structure
>2juh_A Telomere binding protein TBP1; helix, nucleus, nuclear protein; NMR {Nicotiana glutinosa} Back     alignment and structure
>2cqr_A RSGI RUH-043, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>2aje_A Telomere repeat-binding protein; DNA-binding, Trp, MYB motif, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.3 Back     alignment and structure
>2cu7_A KIAA1915 protein; nuclear protein, SANT domain, DNA binding, regulation of transcription, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>1gv2_A C-MYB, MYB proto-oncogene protein; transcription, DNA binding, ION binding; 1.68A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 PDB: 1mse_C* 1msf_C* 1a5j_A 1idy_A 1idz_A 1mbj_A 1mbk_A Back     alignment and structure
>2ckx_A NGTRF1, telomere binding protein TBP1; nuclear protein; 1.9A {Nicotiana tabacum} SCOP: a.4.1.3 PDB: 2qhb_A Back     alignment and structure
>1x58_A Hypothetical protein 4930532D21RIK; MUS musculus adult MALE testis cDNA, riken FULL-length enriched library, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2roh_A RTBP1, telomere binding protein-1; plant, nucleus, DNA binding protein; NMR {Oryza sativa} Back     alignment and structure
>2aje_A Telomere repeat-binding protein; DNA-binding, Trp, MYB motif, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.3 Back     alignment and structure
>3osg_A MYB21; transcription-DNA complex, MYB2, R2R3 domain, DNA binding PR transcription factor; 2.00A {Trichomonas vaginalis} PDB: 3osf_A Back     alignment and structure
>3zqc_A MYB3; transcription-DNA complex, DNA-binding protein, nucleus; 2.90A {Trichomonas vaginalis} Back     alignment and structure
>2yus_A SWI/SNF-related matrix-associated actin- dependent regulator of chromatin subfamily...; SWI/SNF complex 155 kDa subunit, BRG1-associated factor 155; NMR {Homo sapiens} Back     alignment and structure
>2cjj_A Radialis; plant development, DNA-binding protein, MYB transcription FA DNA-binding, nuclear protein, floral asymmetry; 1.9A {Antirrhinum majus} SCOP: a.4.1.3 Back     alignment and structure
>2yus_A SWI/SNF-related matrix-associated actin- dependent regulator of chromatin subfamily...; SWI/SNF complex 155 kDa subunit, BRG1-associated factor 155; NMR {Homo sapiens} Back     alignment and structure
>2k9n_A MYB24; R2R3 domain, DNA-binding, nucleus, DNA binding protein; NMR {Trichomonas vaginalis} PDB: 2kdz_A Back     alignment and structure
>2cqr_A RSGI RUH-043, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>2ltp_A Nuclear receptor corepressor 2; SMRT, TRAC, SGC, structural genomics consortium, NESG, north structural genomics consortium; NMR {Homo sapiens} Back     alignment and structure
>2llk_A Cyclin-D-binding MYB-like transcription factor 1; helix bundle, SGC, structural genomics consortium, NESG, NOR structural genomics consortium; NMR {Homo sapiens} Back     alignment and structure
>2cqq_A RSGI RUH-037, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>2cjj_A Radialis; plant development, DNA-binding protein, MYB transcription FA DNA-binding, nuclear protein, floral asymmetry; 1.9A {Antirrhinum majus} SCOP: a.4.1.3 Back     alignment and structure
>1ug2_A 2610100B20RIK gene product; hypothetical protein, MYB-like DNA binding domain, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: a.4.1.3 Back     alignment and structure
>2eqr_A N-COR1, N-COR, nuclear receptor corepressor 1; SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2lr8_A CAsp8-associated protein 2; structural genomics, northeast structural genomics consortiu PSI-biology, apoptosis; NMR {Homo sapiens} Back     alignment and structure
>4iej_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin regulator, repressor, structural joint center for structural genomics; HET: DNA; 1.45A {Homo sapiens} PDB: 3hm5_A* Back     alignment and structure
>2iw5_B Protein corest, REST corepressor 1; oxidoreductase-transcription regulator complex, oxidoreductase/repressor complex, histone demethylase, FAD; HET: FAD; 2.57A {Homo sapiens} SCOP: a.4.1.3 PDB: 2uxn_B* 2uxx_B* 2y48_B* 2v1d_B* 2x0l_B* Back     alignment and structure
>1fex_A TRF2-interacting telomeric RAP1 protein; helix turn helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Synthetic} SCOP: a.4.1.3 Back     alignment and structure
>2eqr_A N-COR1, N-COR, nuclear receptor corepressor 1; SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wgx_A KIAA1903 protein; MYB DNA-binding domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>2ebi_A DNA binding protein GT-1; DNA-binding domain, phosphorylation; HET: DNA; NMR {Arabidopsis thaliana} PDB: 2jmw_A* Back     alignment and structure
>1fex_A TRF2-interacting telomeric RAP1 protein; helix turn helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Synthetic} SCOP: a.4.1.3 Back     alignment and structure
>1wgx_A KIAA1903 protein; MYB DNA-binding domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>2cqq_A RSGI RUH-037, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>2iw5_B Protein corest, REST corepressor 1; oxidoreductase-transcription regulator complex, oxidoreductase/repressor complex, histone demethylase, FAD; HET: FAD; 2.57A {Homo sapiens} SCOP: a.4.1.3 PDB: 2uxn_B* 2uxx_B* 2y48_B* 2v1d_B* 2x0l_B* Back     alignment and structure
>2ebi_A DNA binding protein GT-1; DNA-binding domain, phosphorylation; HET: DNA; NMR {Arabidopsis thaliana} PDB: 2jmw_A* Back     alignment and structure
>1ofc_X ISWI protein; nuclear protein, chromatin remodeling factor, ATPase, SANT domain, nucleosome recognition; HET: GLC G4D; 1.9A {Drosophila melanogaster} SCOP: a.4.1.3 a.4.1.13 a.187.1.1 PDB: 2nog_A Back     alignment and structure
>2yqk_A Arginine-glutamic acid dipeptide repeats protein; structure genomics, SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x58_A Hypothetical protein 4930532D21RIK; MUS musculus adult MALE testis cDNA, riken FULL-length enriched library, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>4eef_G F-HB80.4, designed hemagglutinin binding protein; immunoglobulin, fusion of virus membrane with membrane, membrane fusion, sialic acid, virion; HET: NAG BMA; 2.70A {Artificial gene} Back     alignment and structure
>2xag_B REST corepressor 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_B* 2xah_B* 2xaj_B* 2xaq_B* 2xas_B* Back     alignment and structure
>2y9y_A Imitation switch protein 1 (DEL_ATPase); transcription, nuclear protein complex, chromatin remodeling nucleosome remodeling; 3.25A {Saccharomyces cerevisiae} PDB: 2y9z_A Back     alignment and structure
>4eef_G F-HB80.4, designed hemagglutinin binding protein; immunoglobulin, fusion of virus membrane with membrane, membrane fusion, sialic acid, virion; HET: NAG BMA; 2.70A {Artificial gene} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 148
d1igna186 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Ba 2e-05
d1igna186 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Ba 0.002
d1guua_50 a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus 2e-04
d1gvda_52 a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus 3e-04
d1gv2a247 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mou 3e-04
d2cu7a165 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sap 8e-04
>d1igna1 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 86 Back     information, alignment and structure

class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: DNA-binding domain of rap1
domain: DNA-binding domain of rap1
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

 Score = 38.8 bits (90), Expect = 2e-05
 Identities = 9/35 (25%), Positives = 14/35 (40%)

Query: 23 RCGKSCRSRWINYLHPHLKCGNFTNEEDKLIIKLH 57
            G S R R+  YL   L+     ++  KL+    
Sbjct: 39 HTGNSIRHRFRVYLSKRLEYVYEVDKFGKLVRDDD 73
>d1igna1 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 86 Back     information, alignment and structure
>d1guua_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 50 Back     information, alignment and structure
>d1gvda_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 52 Back     information, alignment and structure
>d1gv2a2 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 47 Back     information, alignment and structure
>d2cu7a1 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query148
d1igna186 DNA-binding domain of rap1 {Baker's yeast (Sacchar 99.57
d1gv2a247 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.13
d1guua_50 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.12
d1gvda_52 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.09
d1gvda_52 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.03
d2ckxa183 Telomere binding protein TBP1 {Tobacco (Nicotiana 98.9
d1w0ta_52 DNA-binding domain of human telomeric protein, hTR 98.83
d1igna186 DNA-binding domain of rap1 {Baker's yeast (Sacchar 98.78
d1guua_50 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 98.73
d1w0ua_55 Telomeric repeat binding factor 2, TRF2 {Human (Ho 98.71
d1w0ua_55 Telomeric repeat binding factor 2, TRF2 {Human (Ho 98.69
d1x41a147 Transcriptional adaptor 2-like, TADA2L, isoform b 98.62
d1ug2a_95 2610100b20rik gene product {Mouse (Mus musculus) [ 98.52
d2cqra160 DnaJ homolog subfamily C member 1 {Human (Homo sap 98.44
d2cu7a165 MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 960 98.42
d1w0ta_52 DNA-binding domain of human telomeric protein, hTR 98.35
d2ckxa183 Telomere binding protein TBP1 {Tobacco (Nicotiana 98.31
d2cjja163 Radialis {Garden snapdragon (Antirrhinum majus) [T 98.31
d2cu7a165 MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 960 98.3
d1x41a147 Transcriptional adaptor 2-like, TADA2L, isoform b 98.19
d2cjja163 Radialis {Garden snapdragon (Antirrhinum majus) [T 98.17
d1gv2a247 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 98.1
d2cqra160 DnaJ homolog subfamily C member 1 {Human (Homo sap 98.05
d2iw5b165 REST corepressor 1, CoREST {Human (Homo sapiens) [ 97.66
d1xc5a168 Nuclear receptor corepressor 2 {Human (Homo sapien 97.66
d2iw5b165 REST corepressor 1, CoREST {Human (Homo sapiens) [ 97.23
d1xc5a168 Nuclear receptor corepressor 2 {Human (Homo sapien 96.57
d1fexa_59 Rap1 {Human (Homo sapiens) [TaxId: 9606]} 96.14
d1ug2a_95 2610100b20rik gene product {Mouse (Mus musculus) [ 94.25
d2cqqa159 DnaJ homolog subfamily C member 1 {Human (Homo sap 92.59
d1ofcx2128 SLIDE domain of the nucleosome remodeling ATPase I 92.55
d2crga157 Metastasis associated protein MTA3 {Mouse (Mus mus 83.4
d2cqqa159 DnaJ homolog subfamily C member 1 {Human (Homo sap 81.72
>d1igna1 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: DNA-binding domain of rap1
domain: DNA-binding domain of rap1
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

Probab=99.57  E-value=3.2e-17  Score=111.79  Aligned_cols=56  Identities=20%  Similarity=0.176  Sum_probs=46.9

Q ss_pred             HHHHHhhh----hhhHHhhhccCCCCChhHHHHHhhhccCCCCCCCCCCHHHHHHHHHhhc
Q 037952            2 TIHKAAQL----IYVHVSINYSGLLRCGKSCRSRWINYLHPHLKCGNFTNEEDKLIIKLHR   58 (148)
Q Consensus         2 ~i~k~~~~----~~~~~~~~~~g~~R~~kqCr~Rw~n~L~p~i~~~~wt~eEd~~l~~l~~   58 (148)
                      +|.++|..    .-|..||+.++ +||++|||+||.+||+|.|++++||++||.+|+++++
T Consensus        15 ~v~~~g~~~~~~~~W~~IA~~lp-gRt~~qcr~Rw~~~L~p~l~~~~~t~~ed~ll~d~~~   74 (86)
T d1igna1          15 VVRKNPTRRTTHTLYDEISHYVP-NHTGNSIRHRFRVYLSKRLEYVYEVDKFGKLVRDDDG   74 (86)
T ss_dssp             HHHTSGGGTTCSHHHHHHTTTST-TSCHHHHHHHHHHTTGGGCCCEECBCTTSCBCBCTTS
T ss_pred             HHHHhCcCcCCccCHHHHHHHcC-CCCHHHHHHHHHHHcCccccCCCCCCchhHHHHHHhh
Confidence            35566654    24666677776 7999999999999999999999999999999988764
>d1gv2a2 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1guua_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gvda_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gvda_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ckxa1 a.4.1.3 (A:578-660) Telomere binding protein TBP1 {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1w0ta_ a.4.1.4 (A:) DNA-binding domain of human telomeric protein, hTRF1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1igna1 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1guua_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1w0ua_ a.4.1.4 (A:) Telomeric repeat binding factor 2, TRF2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w0ua_ a.4.1.4 (A:) Telomeric repeat binding factor 2, TRF2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x41a1 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, TADA2L, isoform b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ug2a_ a.4.1.3 (A:) 2610100b20rik gene product {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqra1 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cu7a1 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w0ta_ a.4.1.4 (A:) DNA-binding domain of human telomeric protein, hTRF1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ckxa1 a.4.1.3 (A:578-660) Telomere binding protein TBP1 {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d2cjja1 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Antirrhinum majus) [TaxId: 4151]} Back     information, alignment and structure
>d2cu7a1 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x41a1 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, TADA2L, isoform b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cjja1 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Antirrhinum majus) [TaxId: 4151]} Back     information, alignment and structure
>d1gv2a2 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqra1 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2iw5b1 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xc5a1 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2iw5b1 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xc5a1 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fexa_ a.4.1.3 (A:) Rap1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ug2a_ a.4.1.3 (A:) 2610100b20rik gene product {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqqa1 a.4.1.3 (A:8-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ofcx2 a.4.1.13 (X:851-978) SLIDE domain of the nucleosome remodeling ATPase ISWI {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2crga1 a.4.1.3 (A:8-64) Metastasis associated protein MTA3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqqa1 a.4.1.3 (A:8-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure