Citrus Sinensis ID: 038031

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------73

MPVGIGKLTCLQTLCNFVVGKDSGSGLSELKLLMHLRGALEISKLENVKDIGDAKEAGLDGKKNLKELSLNWTCSTDGSSSREAETEMGVLDMLKPHKNLDQFCVCGYGGTKFPTWLGDSSFSNLVTLKFEDCGMCTALPSVGQLPSLKHLTVRGMSRVKRLGSEFYGDDSPIPFPCLETLRFEDMQEWEDWIPHGSSQGVERFPKLRELQILRCSKLQGTLPEHLPALQMLAIYKCEKLSISITSLPALCKLVIGGCKKVVLRSATDHLGLQNSVVCRDTSNQVFLAGPLKPRIPKLEELEIKNIKNETHIWKSYNELLQDICSLKRLTIRRCPKIQSLVVEEEKDQQQQLCELSCRLEYLGLLYCEGLVKLPQSSLSLCSLREIEIYNCSSLVSFPEVALPSKLKKIQIRHCDALKSLPEAWMCDTNSSLEILNIQYCCSLRYIVEVQLPPSLKQLTIWRCDNIRTLTVEEGIQSSSSRRYTSSLLEKLEIWDCPSLTCIFSKNELPATLESLEVGNLPPSLKSLSRLEALPKGLHNLSCLQELTIIGGALPSLEEEDGLPTNLQSLDIRGNMEICKSLIERGRGFHRFSSLRHLTIGGCDDDTVMVSFPLEDKRLGTALPLPASLTSLSISRFPNLERLSSSIVDLQNLTELHLWDCPKLKYFPEKGLPSSLLQLWISGCPLIEEKCRKDGGQYWDLLTHIPCVKIDWERLFDWKRLFDDDSTGDE

ccccccccccccccccEEEcccccccHHHHccccccccEEEEccccccccHHHHHHHcccccccccEEEEEEcccccccccccHHHHHHHHcccccccccccEEEEccccccccccccccccccEEEEEEEccccccccccccccccccEEEEccccccEEEcccccccccccccccccEEEEEccccccccccccccccccccccccEEEEcccccccccccccccccEEEEEEEcccccccccccccccEEEEcccccEEEcccccccccccEEEEcccccccccccccccccccccEEEEEEcccccccccccHHHccccccccEEEEEccccccccccccHHHHHHHHHcccccccEEEEEcccccccccccccccccccEEEEEcccccEEcccccccccccEEEEccccccccccccccccccccccEEEEEEcccccccccccccccccEEEEEccccccccccccccccccccccccccccEEEEEcccccccccccccccccccEEEEcccccccccccccccccccccccccccEEEEEccccccccccccccccccEEEEcccccHHHHHHHccccccccccccEEEEEcccccccccccccccccccccccccccccEEEEEcccccccccccccccccccEEEEEccccccccccccccccccEEEEEccHHHHHHHcccccccccccccccEEEEccEEcccEEEcccccccccc

ccccccccHHHHHccEEEEcccccccHHHHHHHHHcccEEEEEcccccccHHHHHHHHHcccccccEEEEEEccccccccccccHHHHHHHHHccccccccEEEEEccccccccccccccccHccEEEEEcccccccccccccccccccEEEEcccccEEEEcHHHcccccccccHHHcEEEccccHHHHHcccccccccccccccccEEEEcccHHHHHccccccccccEEEEccccccccccccccccEEEEEEcccccEccccccccccccEEEEEccccccccccccccccccccEEEEccccccHcccHcccccccccccccEEEEccccccccccHHHcccccHHHccccccccEEEEcccccHccccccccccccccEEEEcccccccccccccccccccEEEEcccHHHHcccHHHcccccccccEEEEcccccccccccccccccccEEEEcccHHHHccccccccccccccccccccccEEEEccccccccccccccccccccEEEEccccccccccHHHHcccccccccccccEEEEcccccccccccccccccccEEEEcccHHHHHHHHHccccccccccccEEEEccccccccccccccHcccccccccccccccEEEEcccHHHHHccHHccccccccEEEEcccccccccccccccccccEEEEcccHHHHHHHHcccccccccEEEccEEEEcccEEcccEEEEcccccccc

MPVGIGKLTCLQTLCnfvvgkdsgsglSELKLLMHLRGaleisklenvkdigdakeagldgkknlkelslnwtcstdgsssreaeTEMGvldmlkphknldqfcvcgyggtkfptwlgdssfsnlvtlkfedcgmctalpsvgqlpslkhltVRGMSRVkrlgsefygddspipfpcletlrfedmqewedwiphgssqgverfpkLRELQILRCSKlqgtlpehlpALQMLAIYKCEKLSISITSLPALCKLVIGGCKKVVLRSAtdhlglqnsvvcrdtsnqvflagplkpripkleeLEIKNIKNETHIWKSYNELLQDICSLkrltirrcpkiqsLVVEEEKDQQQQLCELSCRLEYLGLLYCEglvklpqsslslcslreieiyncsslvsfpevalpsklkKIQIRHCDAlkslpeawmcdtnssleilNIQYCCSLRYIvevqlppslkqltiwrcdnirTLTVEegiqssssrrYTSSLLekleiwdcpsltcifsknelpatleslevgnlppslkslSRLEalpkglhnlsCLQELTIiggalpsleeedglptnlqsldirGNMEICKSLIErgrgfhrfsslrhltiggcdddtvmvsfpledkrlgtalplpasltslsisrfpnlerlsssivdlqnltelhlwdcpklkyfpekglpssLLQLWISgcplieekcrkdggqywdllthipcvkidwerlfdwkrlfdddstgde

MPVGIGKLTCLQTLCNFVVGKDSGSGLSELKLLMHLRGAleisklenvkdigdakeagldgkknlkelslnwtcstdgsssreAETEMGVLDMLKPHKNLDQFCVCGYGGTKFPTWLGDSSFSNLVTLKFEDCGMCTALpsvgqlpslkhlTVRGMSRVKRLGsefygddspipFPCLETLRFEDMQEWEDWIPHGSSQGVERFPKLRELQILRCSKLQGTLPEHLPALQMLAIYKCEKLSISITSLPALCKLVIGGCKKVVLRSATDHLGLQNSVVCRDTSNQVflagplkpripklEELEIKNIKNETHIWKSYNELLQDICSLKRLTIRRCPKIQSLVVEEEKDQQQQLCELSCRLEYLGLLYCEGLVKLPQSSLSLCSLREIEIYNCSSLVSFPEVALPSKLKKIQIRHCDALKSLPEAWMCDTNSSLEILNIQYCCSLRYIVEVQlppslkqltiWRCDNIRTLtveegiqssssrrYTSSLLEKLEIWDCPSLTCIFSKNELPATLESLEVGNLPPSLKSLSRLEALPKGLHNLSCLQELTIIGGALPSLEEEDGLptnlqsldirGNMEICKSLIERGRGFHRFSSLRHLTIGGCDDDTVMVSFPLEDKRLGTALPLPASLTSLSISRFPNLERLSSSIVDLQNLTELHLWDCPKLKYFPEKGLPSSLLQLWISGCPLIEEKCRKDGGQYWDLLTHIPCVKIDWERLFDWKRlfdddstgde

MPVGIGKLTCLQTLCNFVVGKDSGSGLSELKLLMHLRGALEISKLENVKDIGDAKEAGLDGKKNLKELSLNWTCSTDGSSSREAETEMGVLDMLKPHKNLDQFCVCGYGGTKFPTWLGDSSFSNLVTLKFEDCGMCTALPSVGQLPSLKHLTVRGMSRVKRLGSEFYGDDSPIPFPCLETLRFEDMQEWEDWIPHGSSQGVERFPKLRELQILRCSKLQGTLPEHLPALQMLAIYKCEKLSISITSLPALCKLVIGGCKKVVLRSATDHLGLQNSVVCRDTSNQVFLAGPLKPRIPKLEELEIKNIKNETHIWKSYNELLQDICSLKRLTIRRCPKIQSLVVEEEKDQQQQLCELScrleylgllyceglVKLPQSSLSLCSLREIEIYNCSSLVSFPEVALPSKLKKIQIRHCDALKSLPEAWMCDTNSSLEILNIQYCCSLRYIVEVQLPPSLKQLTIWRCDNIRTLTVEEGIQssssrrytssLLEKLEIWDCPSLTCIFSKNELPATLESLEVGNLPPSLKSLSRLEALPKGLHNLSCLQELTIIGGALPSLEEEDGLPTNLQSLDIRGNMEICKSLIERGRGFHRFSSLRHLTIGGCDDDTVMVSFPLEDKRLGtalplpasltslsisRFPNLERLSSSIVDLQNLTELHLWDCPKLKYFPEKGLPSSLLQLWISGCPLIEEKCRKDGGQYWDLLTHIPCVKIDWERLFDWKRLFDDDSTGDE

***GIGKLTCLQTLCNFVVGKDSGSGLSELKLLMHLRGALEISKLENVKDI****************LSLNWTC***************VLDMLKPHKNLDQFCVCGYGGTKFPTWLGDSSFSNLVTLKFEDCGMCTALPSVGQLPSLKHLTVRGMSRVKRLGSEFYGDDSPIPFPCLETLRFEDMQEWEDWIPHGSSQGVERFPKLRELQILRCSKLQGTLPEHLPALQMLAIYKCEKLSISITSLPALCKLVIGGCKKVVLRSATDHLGLQNSVVCRDTSNQVFLAGPLKPRIPKLEELEIKNIKNETHIWKSYNELLQDICSLKRLTIRRCPKIQSLVVEEEKDQQQQLCELSCRLEYLGLLYCEGLVKLPQSSLSLCSLREIEIYNCSSLVSFPEVALPSKLKKIQIRHCDALKSLPEAWMCDTNSSLEILNIQYCCSLRYIVEVQLPPSLKQLTIWRCDNIRTLTVEEGI*******YTSSLLEKLEIWDCPSLTCIFSKNELPATLESLEVG**********RLEALPKGLHNLSCLQELTIIGGALPSLE***GLPTNLQSLDIRGNMEICKSLIERGRGFHRFSSLRHLTIGGCDDDTVMVSFPLEDKRLGTALPLPASLTSLSISRFPNLERLSSSIVDLQNLTELHLWDCPKLKYFPEKGLPSSLLQLWISGCPLIEEKCRKDGGQYWDLLTHIPCVKIDWERLFDWKRLF********

MPVGIGKLTCLQTLCNFVVGKDSGSGLSELKLLMHLRGALEISKLENVKDIGDAKEAGLDGKKNLKELSLNWTCST***********MGVLDMLKPHKNLDQFCVCGYGGTKFPTWLGDSSFSNLVTLKFEDCGMCTALPSVGQLPSLKHLTVRGMSRVKRLGSEFYGDDSPIPFPCLETLRFEDMQEWEDWIPHGSSQGVERFPKLRELQILRCSKLQGTLPEHLPALQMLAIYKCEKLSISITSLPALCKLVIGGCKKVV**************VCRDTSNQVFLAGPLKPRIPKLEELEIKNIKNETHIWKSYNELLQDICSLKRLTIRRCPKIQSLVVEEE********ELSCRLEYLGLLYCEGLVKLPQSSLSLCSLREIEIYNCSSLVSFPEVALPSKLKKIQIRHCDALKSLPEAWMCDTNSSLEILNIQYCCSLRYIVEVQLPPSLKQLTIWRCDNIRTLTVEEG********YTSSLLEKLEIWDCPSLTCIFSKNELPATLESLEVGNLPPSLKSLSRLEALPKGLHNLSCLQELTIIGGALPSLEEEDGLPTNLQSLDIRGNMEICKSLIERGRGFHRFSSLRHLTIGGCDDDTVMVSFPLEDKRLGTALPLPASLTSLSISRFPNLERLSSSIVDLQNLTELHLWDCPKLKYFPEKGLPSSLLQLWISGCPLIEEKCRKDGGQYWDLLTHIPCVKIDWERLFDWKRLFDDDSTGD*

MPVGIGKLTCLQTLCNFVVGKDSGSGLSELKLLMHLRGALEISKLENVKDIGDAKEAGLDGKKNLKELSLNW*************TEMGVLDMLKPHKNLDQFCVCGYGGTKFPTWLGDSSFSNLVTLKFEDCGMCTALPSVGQLPSLKHLTVRGMSRVKRLGSEFYGDDSPIPFPCLETLRFEDMQEWEDWIPHGSSQGVERFPKLRELQILRCSKLQGTLPEHLPALQMLAIYKCEKLSISITSLPALCKLVIGGCKKVVLRSATDHLGLQNSVVCRDTSNQVFLAGPLKPRIPKLEELEIKNIKNETHIWKSYNELLQDICSLKRLTIRRCPKIQSLVV********QLCELSCRLEYLGLLYCEGLVKLPQSSLSLCSLREIEIYNCSSLVSFPEVALPSKLKKIQIRHCDALKSLPEAWMCDTNSSLEILNIQYCCSLRYIVEVQLPPSLKQLTIWRCDNIRTLTVEE**********TSSLLEKLEIWDCPSLTCIFSKNELPATLESLEVGNLPPSLKSLSRLEALPKGLHNLSCLQELTIIGGALPSLEEEDGLPTNLQSLDIRGNMEICKSLIERGRGFHRFSSLRHLTIGGCDDDTVMVSFPLEDKRLGTALPLPASLTSLSISRFPNLERLSSSIVDLQNLTELHLWDCPKLKYFPEKGLPSSLLQLWISGCPLIEEKCRKDGGQYWDLLTHIPCVKIDWERLFDWKRLF********

***GIGKLTCLQTLCNFVVGKDSGSGLSELKLLMHLRGALEISKLENVKDIGDAKEAGLDGKKNLKELSLNWTCSTDGSSSREAETEMGVLDMLKPHKNLDQFCVCGYGGTKFPTWLGDSSFSNLVTLKFEDCGMCTALPSVGQLPSLKHLTVRGMSRVKRLGSEFYGDDSPIPFPCLETLRFEDMQEWEDWIPHGSSQGVERFPKLRELQILRCSKLQGTLPEHLPALQMLAIYKCEKLSISITSLPALCKLVIGGCKKVVLRSATDHLGLQNSVVCRDTSNQVFLAGPLKPRIPKLEELEIKNIKNETHIWKSYNELLQDICSLKRLTIRRCPKIQSLVVEEEKDQQQQLCELSCRLEYLGLLYCEGLVKLPQSSLSLCSLREIEIYNCSSLVSFPEVALPSKLKKIQIRHCDALKSLPEAWMCDTNSSLEILNIQYCCSLRYIVEVQLPPSLKQLTIWRCDNIRTLTVEEGIQSSSSRRYTSSLLEKLEIWDCPSLTCIFSKNELPATLESLEVGNLPPSLKSLSRLEALPKGLHNLSCLQELTIIGGALPSLEEEDGLPTNLQSLDIRGNMEICKSLIERGRGFHRFSSLRHLTIGGCDDDTVMVSFPLEDKRLGTALPLPASLTSLSISRFPNLERLSSSIVDLQNLTELHLWDCPKLKYFPEKGLPSSLLQLWISGCPLIEEKCRKDGGQYWDLLTHIPCVKIDWERLFDWKRLFD*******

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		729	2.2.26 [Sep-21-2011]
Q9LRR4		1054	Putative disease resistan	yes	no	0.323	0.223	0.404	8e-49
Q9LRR5		1424	Putative disease resistan	no	no	0.330	0.169	0.42	1e-46
Q7XA42		979	Putative disease resistan	N/A	no	0.436	0.324	0.304	1e-29
Q7XA40		992	Putative disease resistan	N/A	no	0.481	0.353	0.301	2e-28
Q7XA39		988	Putative disease resistan	N/A	no	0.470	0.347	0.308	4e-28
Q7XBQ9		970	Disease resistance protei	N/A	no	0.459	0.345	0.305	8e-28
P0DI18		1049	Probable disease resistan	no	no	0.379	0.264	0.266	2e-05
P0DI17		1049	Probable disease resistan	no	no	0.379	0.264	0.266	2e-05
O23530		1301	Protein SUPPRESSOR OF npr	no	no	0.422	0.236	0.255	0.0001
Q9FKZ2		415	Probable disease resistan	no	no	0.226	0.397	0.336	0.0003

>sp\|Q9LRR4\|R13L1_ARATH Putative disease resistance RPP13-like protein 1 OS=Arabidopsis thaliana GN=RPPL1 PE=3 SV=1	Back alignment and function desciption

 Score =  196 bits (497), Expect = 8e-49,   Method: Compositional matrix adjust.
 Identities = 100/247 (40%), Positives = 149/247 (60%), Gaps = 11/247 (4%)

Query: 1   MPVGIGKLTCLQTLCNFVVGKDSGSGLSELKLLMHLRGALEISKLENVKDIGDAKEAGLD 60
           MP   G+L  LQTL  F V    GS +SEL  L  L G L+I +L+ V D+ DA EA L+
Sbjct: 664 MPRRFGRLKSLQTLTTFFVSASDGSRISELGGLHDLHGKLKIVELQRVVDVADAAEANLN 723

Query: 61  GKKNLKELSLNW----TCSTDGSSSREAETEMGVLDMLKPHKNLDQFCVCGYGGTKFPTW 116
            KK+L+E+   W    + S + ++    + E  V + L+PH+++++  +  Y G +FP W
Sbjct: 724 SKKHLREIDFVWRTGSSSSENNTNPHRTQNEAEVFEKLRPHRHIEKLAIERYKGRRFPDW 783

Query: 117 LGDSSFSNLVTLKFEDCGMCTALPSVGQLPSLKHLTVRGMSRVKRLGSEFYGD------D 170
           L D SFS +V ++  +C  CT+LPS+GQLP LK L + GM  ++ +G +FY         
Sbjct: 784 LSDPSFSRIVCIRLRECQYCTSLPSLGQLPCLKELHISGMVGLQSIGRKFYFSDQQLRDQ 843

Query: 171 SPIPFPCLETLRFEDMQEWEDWIPHGSSQGVERFPKLRELQILRCSKLQGTLPEHLPALQ 230
              PF  LETLRF+++ +W++W+    ++G + FP L++L ILRC +L GTLP  LP+L 
Sbjct: 844 DQQPFRSLETLRFDNLPDWQEWLDVRVTRG-DLFPSLKKLFILRCPELTGTLPTFLPSLI 902

Query: 231 MLAIYKC 237
            L IYKC
Sbjct: 903 SLHIYKC 909

Potential disease resistance protein.
Arabidopsis thaliana (taxid: 3702)

>sp\|Q9LRR5\|DRL21_ARATH Putative disease resistance protein At3g14460 OS=Arabidopsis thaliana GN=At3g14460 PE=3 SV=1	Back alignment and function description

>sp\|Q7XA42\|RGA1_SOLBU Putative disease resistance protein RGA1 OS=Solanum bulbocastanum GN=RGA1 PE=2 SV=2	Back alignment and function description

>sp\|Q7XA40\|RGA3_SOLBU Putative disease resistance protein RGA3 OS=Solanum bulbocastanum GN=RGA3 PE=2 SV=2	Back alignment and function description

>sp\|Q7XA39\|RGA4_SOLBU Putative disease resistance protein RGA4 OS=Solanum bulbocastanum GN=RGA4 PE=2 SV=1	Back alignment and function description

>sp\|Q7XBQ9\|RGA2_SOLBU Disease resistance protein RGA2 OS=Solanum bulbocastanum GN=RGA2 PE=1 SV=1	Back alignment and function description

>sp\|P0DI18\|DRL45_ARATH Probable disease resistance protein RDL6 OS=Arabidopsis thaliana GN=RDL6 PE=2 SV=1	Back alignment and function description

>sp\|P0DI17\|DRL11_ARATH Probable disease resistance protein RF9 OS=Arabidopsis thaliana GN=RF9 PE=2 SV=1	Back alignment and function description

>sp\|O23530\|SNC1_ARATH Protein SUPPRESSOR OF npr1-1, CONSTITUTIVE 1 OS=Arabidopsis thaliana GN=SNC1 PE=1 SV=3	Back alignment and function description

>sp\|Q9FKZ2\|DRL41_ARATH Probable disease resistance protein At5g66890 OS=Arabidopsis thaliana GN=At5g66890 PE=3 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		729
400131587		1388	FB_MR5 [Malus x robusta]	0.932	0.489	0.406	1e-117
296085123		1278	unnamed protein product [Vitis vinifera]	0.914	0.521	0.383	1e-110
359487253		1390	PREDICTED: putative disease resistance p	0.916	0.480	0.361	1e-104
284026888		1424	CC-NBS-LRR protein [Quercus suber]	0.931	0.476	0.365	1e-104
147766392		1471	hypothetical protein VITISV_007674 [Viti	0.935	0.463	0.370	1e-102
225450023		1396	PREDICTED: putative disease resistance p	0.932	0.487	0.355	1e-102
45826061		739	resistance protein [Quercus suber]	0.928	0.916	0.367	1e-102
225449649		1418	PREDICTED: putative disease resistance p	0.925	0.476	0.374	1e-100
356554923		1399	PREDICTED: putative disease resistance R	0.930	0.484	0.356	1e-99
451798992		1440	disease resistance protein At3g14460-lik	0.897	0.454	0.354	9e-99

>gi\|400131587\|emb\|CCH50986.1\| FB_MR5 [Malus x robusta]	Back alignment and taxonomy information

 Score =  431 bits (1107), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 308/757 (40%), Positives = 427/757 (56%), Gaps = 77/757 (10%)

Query: 1    MPVGIGKLTCLQTLCNFVVGKDSG---SGLSELKLLMHLRGALEISKLENVKDIGDAKEA 57
            MP  +G+L  LQ+L  FVV    G   SG+ EL+ LMHLRG L IS+LENV D+ DA+ A
Sbjct: 666  MPPQLGRLVNLQSLTKFVVSGGGGGDRSGIRELEFLMHLRGTLCISRLENVTDVEDAQRA 725

Query: 58   GLDGKKNLKELSLNWTCSTDGSSSREAETEMGVLDMLKPHKNLDQFCVCGYGGTKFPTWL 117
             L+ K+ L  L L W+ S+D       ETE  VLDML+PH  L +  +  Y G +F +W+
Sbjct: 726  NLNCKERLDSLVLEWSHSSDTR-----ETESAVLDMLQPHTKLKELTIKSYAGKEFSSWV 780

Query: 118  GDSSFSNLVTLKFEDCGMCTALPSVGQLPSLKHLTVRGMSRVKRLGSEFYGDDSPIPFPC 177
            G   FSN+V ++ E+C  C +LP +G+LP LK L +RGM+ V+ +G+EFYG+ S +PFP 
Sbjct: 781  GVPLFSNMVLVRLEECNNCLSLPPLGKLPHLKELYIRGMNAVESVGAEFYGECS-LPFPL 839

Query: 178  LETLRFEDMQEWEDWIPHGSSQGVERFPKLRELQILRCSKLQGTLPEHLPALQMLAIYKC 237
            LETL F DMQ W+ W+P  +      FP L+ L + +CSKL+G LPE+L +L  L I KC
Sbjct: 840  LETLEFVDMQHWKVWLPFQTDHRGSVFPCLKTLLVRKCSKLEGKLPENLDSLASLEIVKC 899

Query: 238  EKLSISITSLPALCKLVIGGCKKVVLRSATDHLGLQNSVVCRDTSNQVFL-AGPL-KPRI 295
            E+L +SI +   L +L I GCK VV  +A     L  S+   + S    L  G L +  +
Sbjct: 900  EELLVSIANYKQLRQLNIDGCKGVVHTAAKVEFELLESLYLSNISELTSLQTGELCRNGL 959

Query: 296  PKLEELEIKNIKNETHIWKSYNELLQDICSLKRLTIRRCPKIQSLVVEE---EKDQQQQL 352
              + +L+I   +  T   K+   LLQ + SL RL I       SL+VEE   E D+  QL
Sbjct: 960  NMVRDLKINGCEELTSSLKNEAILLQQLISLGRLEIED----NSLLVEELGKEADELLQL 1015

Query: 353  CELSCRLEYLGLLYCEGLVKLPQSSLSLCSLREIEIYNCSSLVSFPEVALPSKLK----- 407
              L C+LE+L L  C+ L+KLP+    L SL+E+ I+ CSSLVSFP+V LP  LK     
Sbjct: 1016 QILGCKLEFLKLKKCKNLLKLPEGLNQLSSLQELRIHECSSLVSFPDVGLPPSLKDIEIT 1075

Query: 408  ------------------KIQIRHCDALKSLPEAWMCDTNSS-----LEILNIQYCCSLR 444
                              +IQIR C +L+SL +     + SS     LE LNI+ C SL 
Sbjct: 1076 ECHSLIYFAKSQIPQNLRRIQIRDCRSLRSLVDNEAVGSCSSSSHNCLEYLNIERCQSLT 1135

Query: 445  YI-VEVQLPPSLKQLTIWRCDNIRTLTVEEGIQSSSSRRYTSSLLEKLEIWDCPSLTCIF 503
             + +  QL  +L++L I+ C+ +  L   +G+  ++    T+  LE   I  C +L    
Sbjct: 1136 LLSLSDQLVRALRELDIYDCEQLEFLA-PDGLFCNN----TNYFLENFRIRRCQNL---- 1186

Query: 504  SKNELPATLESLEVGNLPP-SLKSLSRLEALPKGLHNLSCLQELTIIGGALPSLEEEDGL 562
                LP     +   NL    +    RLEALP+ +HN + L++L I        +  +GL
Sbjct: 1187 --KSLPRLSGGIRGSNLREIRITDCDRLEALPEDMHNFNSLEKLII--------DYREGL 1236

Query: 563  ----PTNLQSLDIRGNMEICKSLIERGRGFHRFSSLRHLTIGGCDDDTVMVSFPLEDKRL 618
                P NL SL I   ++ CKSL E   G HR +SLR+L IGG D D  MVSFP +  R+
Sbjct: 1237 TCSFPANLTSLMI-WKVKSCKSLWELEWGLHRLTSLRYLWIGGEDPD--MVSFPPDMVRM 1293

Query: 619  GTALPLPASLTSLSISRFPNLERLSSSIVD-LQNLTELHLWDCPKLKYFPEKGLPSSLLQ 677
             T   LP SLT LSI  FPNL++LSS     L +L  L LWDCPKL   P++GLP SL +
Sbjct: 1294 ETL--LPKSLTELSIGGFPNLKKLSSKGFQFLTSLESLELWDCPKLASIPKEGLPLSLTE 1351

Query: 678  LWISGCPLIEEKCRKDGGQYWDLLTHIPCVKIDWERL 714
            L I GCP+++E+C+   G+YW  ++HIP + IDW+ +
Sbjct: 1352 LCIYGCPVLKERCQPGKGRYWHKISHIPYIDIDWKMI 1388

Source: Malus x robusta

Species: Malus x robusta

Genus: Malus

Family: Rosaceae

Order: Rosales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|296085123\|emb\|CBI28618.3\| unnamed protein product [Vitis vinifera]	Back alignment and taxonomy information

>gi\|359487253\|ref\|XP_003633548.1\| PREDICTED: putative disease resistance protein At3g14460-like [Vitis vinifera]	Back alignment and taxonomy information

>gi\|284026888\|gb\|ADB66335.1\| CC-NBS-LRR protein [Quercus suber]	Back alignment and taxonomy information

>gi\|147766392\|emb\|CAN67818.1\| hypothetical protein VITISV_007674 [Vitis vinifera]	Back alignment and taxonomy information

>gi\|225450023\|ref\|XP_002272823.1\| PREDICTED: putative disease resistance protein At3g14460-like [Vitis vinifera] gi\|451798994\|gb\|AGF69195.1\| disease resistance protein At3g14460-like protein 2 [Vitis labrusca]	Back alignment and taxonomy information

>gi\|45826061\|gb\|AAS77675.1\| resistance protein [Quercus suber]	Back alignment and taxonomy information

>gi\|225449649\|ref\|XP_002262753.1\| PREDICTED: putative disease resistance protein At3g14460 [Vitis vinifera]	Back alignment and taxonomy information

>gi\|356554923\|ref\|XP_003545790.1\| PREDICTED: putative disease resistance RPP13-like protein 1-like [Glycine max]	Back alignment and taxonomy information

>gi\|451798992\|gb\|AGF69194.1\| disease resistance protein At3g14460-like protein 1 [Vitis labrusca]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		729
TAIR\|locus:2091662		1424	AT3G14460 [Arabidopsis thalian	0.330	0.169	0.424	8.5e-59
TAIR\|locus:2091672		1054	AT3G14470 [Arabidopsis thalian	0.323	0.223	0.408	4.4e-48
UNIPROTKB\|O48647		1802	O48647 "XA1" [Oryza sativa (ta	0.499	0.201	0.251	6.8e-14
TAIR\|locus:2205804		1556	AT1G27180 [Arabidopsis thalian	0.294	0.138	0.266	4.9e-07
TAIR\|locus:504956186		1138	AT1G58602 [Arabidopsis thalian	0.163	0.104	0.320	1.2e-05
TAIR\|locus:2175075		1068	AT5G41750 [Arabidopsis thalian	0.281	0.191	0.262	2.1e-05
TAIR\|locus:2076043		1194	RPP1 "recognition of peronospo	0.266	0.162	0.258	4.4e-05
TAIR\|locus:2129236		1301	SNC1 "SUPPRESSOR OF NPR1-1, CO	0.718	0.402	0.238	7.9e-05
TAIR\|locus:2100182		1007	AT3G44400 [Arabidopsis thalian	0.201	0.145	0.251	0.00012
TAIR\|locus:2147992		1189	AT5G11250 [Arabidopsis thalian	0.257	0.158	0.293	0.00015

TAIR\|locus:2091662 AT3G14460 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 483 (175.1 bits), Expect = 8.5e-59, Sum P(2) = 8.5e-59
 Identities = 106/250 (42%), Positives = 149/250 (59%)

Query:     1 MPVGIGKLTCLQTLCNFVVGKDSGSGLSELKLLMHLRGALEISKLENVKDIGDAKEAGLD 60
             MP GI KL  LQ L NFV+G+ SG+GL ELK L HLRG L IS+L+NV    +AK+AGL 
Sbjct:   658 MPPGIKKLRSLQKLSNFVIGRLSGAGLHELKELSHLRGTLRISELQNVAFASEAKDAGLK 717

Query:    61 GKKNLKELSLNWTCS----TDGSSSREAETEMGVLDMLKPHKNLDQFCVCGYGGTKFPTW 116
              K  L  L L WT        GS +  A  +  VL ML+PH +L  FC+  Y G  FP W
Sbjct:   718 RKPFLDGLILKWTVKGSGFVPGSFNALACDQKEVLRMLEPHPHLKTFCIESYQGGAFPKW 777

Query:   117 LGDSSFSNLVTLKFEDCGMCTALPSVGQLPSLKHLTVRGMSRVKRLGSEFY-GDDSP--I 173
             LGDSSF  + ++    C +C +LP VGQLPSLK+L++   + ++++G +F+ G+++   +
Sbjct:   778 LGDSSFFGITSVTLSSCNLCISLPPVGQLPSLKYLSIEKFNILQKVGLDFFFGENNSRGV 837

Query:   174 PFPCLETLRFEDMQEWEDWIPHGSSQGVERFPKLRELQILRCSKLQGTLPEHLPALQMLA 233
             PF  L+ L+F  M  W++WI      G+  FP L++L I RC  L+   PE LP+   + 
Sbjct:   838 PFQSLQILKFYGMPRWDEWICPELEDGI--FPCLQKLIIQRCPSLRKKFPEGLPSSTEVT 895

Query:   234 IYKCEKLSIS 243
             I  C   ++S
Sbjct:   896 ISDCPLRAVS 905

GO:0005634 "nucleus" evidence=ISM

GO:0006952 "defense response" evidence=IEA;ISS

GO:0043531 "ADP binding" evidence=IEA

TAIR\|locus:2091672 AT3G14470 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

UNIPROTKB\|O48647 O48647 "XA1" [Oryza sativa (taxid:4530)]	Back alignment and assigned GO terms

TAIR\|locus:2205804 AT1G27180 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:504956186 AT1G58602 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2175075 AT5G41750 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2076043 RPP1 "recognition of peronospora parasitica 1" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2129236 SNC1 "SUPPRESSOR OF NPR1-1, CONSTITUTIVE 1" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2100182 AT3G44400 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2147992 AT5G11250 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		729
PLN03210		1153	PLN03210, PLN03210, Resistant to P	4e-07
PRK15386		426	PRK15386, PRK15386, type III secretion protein Gog	2e-05
PLN03210		1153	PLN03210, PLN03210, Resistant to P	0.002
PLN03210		1153	PLN03210, PLN03210, Resistant to P	0.003

>gnl\|CDD\|215633 PLN03210, PLN03210, Resistant to P	Back alignment and domain information

 Score = 53.3 bits (128), Expect = 4e-07
 Identities = 63/204 (30%), Positives = 91/204 (44%), Gaps = 35/204 (17%)

Query: 488 LEKLEIWDCPSLTCIFSKNELPATLESLEVGNLPPSLKSLS-----RLEALPKGLHNLSC 542
           LE L++ DC SL       ELP++++ L        L+ L       LE LP G+ NL  
Sbjct: 659 LETLKLSDCSSLV------ELPSSIQYLN------KLEDLDMSRCENLEILPTGI-NLKS 705

Query: 543 LQELTIIGGALPSLEEEDGLPTNLQSLDIRGNMEICKSLIERGRGFHRFSSLRHLTIGGC 602
           L  L + G +   L+    + TN+  LD+        + IE      R  +L  L +  C
Sbjct: 706 LYRLNLSGCS--RLKSFPDISTNISWLDLDE------TAIEEFPSNLRLENLDELIL--C 755

Query: 603 DDDTVMVSFPLEDK-RLGTAL--PLPASLTSLSISRFPNLERLSSSIVDLQNLTELHLWD 659
           +    M S  L ++ +  T L   L  SLT L +S  P+L  L SSI +L  L  L + +
Sbjct: 756 E----MKSEKLWERVQPLTPLMTMLSPSLTRLFLSDIPSLVELPSSIQNLHKLEHLEIEN 811

Query: 660 CPKLKYFPEKGLPSSLLQLWISGC 683
           C  L+  P      SL  L +SGC
Sbjct: 812 CINLETLPTGINLESLESLDLSGC 835

syringae 6; Provisional. Length = 1153

>gnl\|CDD\|237954 PRK15386, PRK15386, type III secretion protein GogB; Provisional	Back alignment and domain information

>gnl\|CDD\|215633 PLN03210, PLN03210, Resistant to P	Back alignment and domain information

>gnl\|CDD\|215633 PLN03210, PLN03210, Resistant to P	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		729
PLN00113		968	leucine-rich repeat receptor-like protein kinase;	100.0
PLN00113		968	leucine-rich repeat receptor-like protein kinase;	100.0
KOG4194		873	consensus Membrane glycoprotein LIG-1 [Signal tran	99.89
KOG4194		873	consensus Membrane glycoprotein LIG-1 [Signal tran	99.88
PLN03210		1153	Resistant to P. syringae 6; Provisional	99.86
PLN03210		1153	Resistant to P. syringae 6; Provisional	99.85
KOG0618		1081	consensus Serine/threonine phosphatase 2C containi	99.85
KOG0444		1255	consensus Cytoskeletal regulator Flightless-I (con	99.84
KOG0472		565	consensus Leucine-rich repeat protein [Function un	99.83
KOG0618		1081	consensus Serine/threonine phosphatase 2C containi	99.81
KOG0472		565	consensus Leucine-rich repeat protein [Function un	99.76
KOG0444		1255	consensus Cytoskeletal regulator Flightless-I (con	99.75
PRK15387		788	E3 ubiquitin-protein ligase SspH2; Provisional	99.63
PRK15387		788	E3 ubiquitin-protein ligase SspH2; Provisional	99.62
PRK15370		754	E3 ubiquitin-protein ligase SlrP; Provisional	99.48
PRK15370		754	E3 ubiquitin-protein ligase SlrP; Provisional	99.45
KOG4237		498	consensus Extracellular matrix protein slit, conta	99.22
KOG0617		264	consensus Ras suppressor protein (contains leucine	99.19
KOG4237		498	consensus Extracellular matrix protein slit, conta	99.18
KOG0617		264	consensus Ras suppressor protein (contains leucine	99.16
KOG4341		483	consensus F-box protein containing LRR [General fu	99.13
KOG4341		483	consensus F-box protein containing LRR [General fu	99.04
cd00116		319	LRR_RI Leucine-rich repeats (LRRs), ribonuclease i	99.03
cd00116		319	LRR_RI Leucine-rich repeats (LRRs), ribonuclease i	99.02
PF14580		175	LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ	98.76
KOG3207		505	consensus Beta-tubulin folding cofactor E [Posttra	98.68
KOG4658		889	consensus Apoptotic ATPase [Signal transduction me	98.67
KOG1259		490	consensus Nischarin, modulator of integrin alpha5	98.58
KOG1259		490	consensus Nischarin, modulator of integrin alpha5	98.48
KOG3207		505	consensus Beta-tubulin folding cofactor E [Posttra	98.47
PRK15386		426	type III secretion protein GogB; Provisional	98.46
PF14580		175	LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ	98.45
KOG4658		889	consensus Apoptotic ATPase [Signal transduction me	98.42
PRK15386		426	type III secretion protein GogB; Provisional	98.41
COG4886		394	Leucine-rich repeat (LRR) protein [Function unknow	98.19
KOG2120		419	consensus SCF ubiquitin ligase, Skp2 component [Po	98.16
COG4886		394	Leucine-rich repeat (LRR) protein [Function unknow	98.14
KOG1909		382	consensus Ran GTPase-activating protein [RNA proce	98.11
KOG0532		722	consensus Leucine-rich repeat (LRR) protein, conta	98.09
PF13855		61	LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF	98.04
PF13855		61	LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF	98.0
KOG1859		1096	consensus Leucine-rich repeat proteins [General fu	97.86
KOG0532		722	consensus Leucine-rich repeat (LRR) protein, conta	97.79
KOG2120		419	consensus SCF ubiquitin ligase, Skp2 component [Po	97.78
PLN03150		623	hypothetical protein; Provisional	97.71
KOG1909		382	consensus Ran GTPase-activating protein [RNA proce	97.71
KOG1644		233	consensus U2-associated snRNP A' protein [RNA proc	97.7
KOG1859		1096	consensus Leucine-rich repeat proteins [General fu	97.62
KOG0531		414	consensus Protein phosphatase 1, regulatory subuni	97.59
PLN03150		623	hypothetical protein; Provisional	97.55
KOG1947		482	consensus Leucine rich repeat proteins, some prote	97.26
PF12799		44	LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_	97.21
KOG1947		482	consensus Leucine rich repeat proteins, some prote	97.21
KOG0531		414	consensus Protein phosphatase 1, regulatory subuni	97.15
KOG2982		418	consensus Uncharacterized conserved protein [Funct	97.1
PF12799		44	LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_	97.03
KOG3665		699	consensus ZYG-1-like serine/threonine protein kina	96.99
KOG3665		699	consensus ZYG-1-like serine/threonine protein kina	96.96
KOG2982		418	consensus Uncharacterized conserved protein [Funct	96.89
KOG4579		177	consensus Leucine-rich repeat (LRR) protein associ	96.66
KOG4579		177	consensus Leucine-rich repeat (LRR) protein associ	96.65
KOG1644		233	consensus U2-associated snRNP A' protein [RNA proc	96.46
KOG2123		388	consensus Uncharacterized conserved protein [Funct	95.76
KOG2739		260	consensus Leucine-rich acidic nuclear protein [Cel	95.37
KOG2123		388	consensus Uncharacterized conserved protein [Funct	95.25
COG5238		388	RNA1 Ran GTPase-activating protein (RanGAP) involv	94.73
KOG3864		221	consensus Uncharacterized conserved protein [Funct	93.98
KOG2739		260	consensus Leucine-rich acidic nuclear protein [Cel	93.52
PF13306		129	LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_	93.27
KOG3864		221	consensus Uncharacterized conserved protein [Funct	92.59
PF13306		129	LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_	91.58
PF13504		17	LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO	91.25
PF00560		22	LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le	90.96
COG5238		388	RNA1 Ran GTPase-activating protein (RanGAP) involv	81.87

>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional	Back alignment and domain information

Probab=100.00  E-value=7.3e-33  Score=331.91  Aligned_cols=297  Identities=15%  Similarity=0.114  Sum_probs=175.6

Q ss_pred             CcccEEEeeecCCcccccccccCCCCccEEEeccCCCcccCCC-CCCcCCcceEEEecCCCCCccccccccCCCCCccEE
Q 038031          357 CRLEYLGLLYCEGLVKLPQSSLSLCSLREIEIYNCSSLVSFPE-VALPSKLKKIQIRHCDALKSLPEAWMCDTNSSLEIL  435 (729)
Q Consensus       357 ~~L~~L~L~~~~~l~~~~~~~~~l~~L~~L~l~~c~~l~~l~~-~~~~~~L~~L~l~~~~~l~~~~~~~~~~~l~~L~~L  435 (729)
                      ++|++|++++|...+.+|..+..+++|+.|++++|.....+|. ...+++|+.|++++|.....+|..+  ..+++|+.+
T Consensus       308 ~~L~~L~l~~n~~~~~~~~~~~~l~~L~~L~L~~n~l~~~~p~~l~~~~~L~~L~Ls~n~l~~~~p~~~--~~~~~L~~L  385 (968)
T PLN00113        308 QNLEILHLFSNNFTGKIPVALTSLPRLQVLQLWSNKFSGEIPKNLGKHNNLTVLDLSTNNLTGEIPEGL--CSSGNLFKL  385 (968)
T ss_pred             CCCcEEECCCCccCCcCChhHhcCCCCCEEECcCCCCcCcCChHHhCCCCCcEEECCCCeeEeeCChhH--hCcCCCCEE
Confidence            4555555555554444444555555555555555332223332 1224455555555554333333332  344555555


Q ss_pred             EeecCCCccccccc-CCCCCCCeEEEecCCCCcccccccCccccccccccccccceEEecCCCCccccccCC-CCccccc
Q 038031          436 NIQYCCSLRYIVEV-QLPPSLKQLTIWRCDNIRTLTVEEGIQSSSSRRYTSSLLEKLEIWDCPSLTCIFSKN-ELPATLE  513 (729)
Q Consensus       436 ~l~~c~~l~~~~~~-~~~~~L~~L~l~~~~~l~~l~~~~~~~~~~~~~l~~~~L~~L~l~~c~~l~~~~~~~-~~~~~L~  513 (729)
                      ++++|+....++.. .-.++|+.|++.+|.--..+  |..+.     .++  .|+.|+++++. +...++.. ...++|+
T Consensus       386 ~l~~n~l~~~~p~~~~~~~~L~~L~L~~n~l~~~~--p~~~~-----~l~--~L~~L~Ls~N~-l~~~~~~~~~~l~~L~  455 (968)
T PLN00113        386 ILFSNSLEGEIPKSLGACRSLRRVRLQDNSFSGEL--PSEFT-----KLP--LVYFLDISNNN-LQGRINSRKWDMPSLQ  455 (968)
T ss_pred             ECcCCEecccCCHHHhCCCCCCEEECcCCEeeeEC--ChhHh-----cCC--CCCEEECcCCc-ccCccChhhccCCCCc
Confidence            55543322222211 11233555555544321122  22111     344  56666666532 22212211 1124566


Q ss_pred             cccccccccccccCcccccccCcCCCCCccceEEEccCCCCC-CCCCCCCCCCcceEEecCchhhhhhhhhccCCCCCCC
Q 038031          514 SLEVGNLPPSLKSLSRLEALPKGLHNLSCLQELTIIGGALPS-LEEEDGLPTNLQSLDIRGNMEICKSLIERGRGFHRFS  592 (729)
Q Consensus       514 ~L~~~~~~~~l~~~~~l~~l~~~~~~l~~L~~L~l~~~~i~~-l~~~~~~~~~L~~L~L~~~~~~~~~~~~~~~~l~~l~  592 (729)
                      +|       .+.+|.-...+|..+ ..++|+.|++++|++.. ++.....+++|++|++++|.+....+.    .+..++
T Consensus       456 ~L-------~L~~n~~~~~~p~~~-~~~~L~~L~ls~n~l~~~~~~~~~~l~~L~~L~Ls~N~l~~~~p~----~~~~l~  523 (968)
T PLN00113        456 ML-------SLARNKFFGGLPDSF-GSKRLENLDLSRNQFSGAVPRKLGSLSELMQLKLSENKLSGEIPD----ELSSCK  523 (968)
T ss_pred             EE-------ECcCceeeeecCccc-ccccceEEECcCCccCCccChhhhhhhccCEEECcCCcceeeCCh----HHcCcc
Confidence            66       555555444555443 45789999999998774 344556678899999999988876653    567889


Q ss_pred             CcceeeeccCCCccccccccccccccCCccCCCCCcceEEcccCCCcccccccCCCCCCccEEeecCCCCCCCCCCCCCC
Q 038031          593 SLRHLTIGGCDDDTVMVSFPLEDKRLGTALPLPASLTSLSISRFPNLERLSSSIVDLQNLTELHLWDCPKLKYFPEKGLP  672 (729)
Q Consensus       593 ~L~~L~ls~n~~~~~~~~~~~~~~~~~~~~~~l~~L~~L~l~~~~~l~~l~~~~~~l~~L~~L~l~~c~~l~~l~~~~~~  672 (729)
                      +|++|++++|..   .+.+|...       ..+++|+.|++++|.....+|..+..+++|++|++++|+....+|..+.+
T Consensus       524 ~L~~L~Ls~N~l---~~~~p~~~-------~~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~l~ls~N~l~~~~p~~~~~  593 (968)
T PLN00113        524 KLVSLDLSHNQL---SGQIPASF-------SEMPVLSQLDLSQNQLSGEIPKNLGNVESLVQVNISHNHLHGSLPSTGAF  593 (968)
T ss_pred             CCCEEECCCCcc---cccCChhH-------hCcccCCEEECCCCcccccCChhHhcCcccCEEeccCCcceeeCCCcchh
Confidence            999999999884   44555544       46789999999997766688888889999999999998888888887666


Q ss_pred             CccceeeccCCchhH
Q 038031          673 SSLLQLWISGCPLIE  687 (729)
Q Consensus       673 ~~L~~L~l~~n~~l~  687 (729)
                      .++....+.+|+.+.
T Consensus       594 ~~~~~~~~~~n~~lc  608 (968)
T PLN00113        594 LAINASAVAGNIDLC  608 (968)
T ss_pred             cccChhhhcCCcccc
Confidence            677777777887654

>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional	Back alignment and domain information

>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms]	Back alignment and domain information

>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms]	Back alignment and domain information

>PLN03210 Resistant to P	Back alignment and domain information

>PLN03210 Resistant to P	Back alignment and domain information

>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms]	Back alignment and domain information

>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton]	Back alignment and domain information

>KOG0472 consensus Leucine-rich repeat protein [Function unknown]	Back alignment and domain information

>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms]	Back alignment and domain information

>KOG0472 consensus Leucine-rich repeat protein [Function unknown]	Back alignment and domain information

>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton]	Back alignment and domain information

>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional	Back alignment and domain information

>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional	Back alignment and domain information

>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional	Back alignment and domain information

>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional	Back alignment and domain information

>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms]	Back alignment and domain information

>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms]	Back alignment and domain information

>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms]	Back alignment and domain information

>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms]	Back alignment and domain information

>KOG4341 consensus F-box protein containing LRR [General function prediction only]	Back alignment and domain information

>KOG4341 consensus F-box protein containing LRR [General function prediction only]	Back alignment and domain information

>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily	Back alignment and domain information

>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily	Back alignment and domain information

>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A	Back alignment and domain information

>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms]	Back alignment and domain information

>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton]	Back alignment and domain information

>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton]	Back alignment and domain information

>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK15386 type III secretion protein GogB; Provisional	Back alignment and domain information

>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A	Back alignment and domain information

>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms]	Back alignment and domain information

>PRK15386 type III secretion protein GogB; Provisional	Back alignment and domain information

>COG4886 Leucine-rich repeat (LRR) protein [Function unknown]	Back alignment and domain information

>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>COG4886 Leucine-rich repeat (LRR) protein [Function unknown]	Back alignment and domain information

>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms]	Back alignment and domain information

>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton]	Back alignment and domain information

>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A	Back alignment and domain information

>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A	Back alignment and domain information

>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only]	Back alignment and domain information

>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton]	Back alignment and domain information

>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PLN03150 hypothetical protein; Provisional	Back alignment and domain information

>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms]	Back alignment and domain information

>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification]	Back alignment and domain information

>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only]	Back alignment and domain information

>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms]	Back alignment and domain information

>PLN03150 hypothetical protein; Provisional	Back alignment and domain information

>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only]	Back alignment and domain information

>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B	Back alignment and domain information

>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only]	Back alignment and domain information

>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms]	Back alignment and domain information

>KOG2982 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B	Back alignment and domain information

>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only]	Back alignment and domain information

>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only]	Back alignment and domain information

>KOG2982 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only]	Back alignment and domain information

>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only]	Back alignment and domain information

>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification]	Back alignment and domain information

>KOG2123 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only]	Back alignment and domain information

>KOG2123 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification]	Back alignment and domain information

>KOG3864 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only]	Back alignment and domain information

>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A	Back alignment and domain information

>KOG3864 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A	Back alignment and domain information

>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D	Back alignment and domain information

>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape []	Back alignment and domain information

>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification]	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		729
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	6e-18
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	2e-14
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	2e-09
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	2e-11
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	3e-07
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	6e-05
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	1e-10
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	3e-05
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	4e-10
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	5e-10
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	9e-05
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	1e-09
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	2e-04
3bz5_A		457	Internalin-J, INLJ; leucine rich repeat (LRR), cys	4e-09
2z7x_B		520	TOLL-like receptor 1, variable lymphocyte recepto;	2e-08
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	4e-07
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	5e-05
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	6e-07
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	7e-07
2p1m_B		594	Transport inhibitor response 1 protein; F-BOX, leu	8e-07
3ogk_B		592	Coronatine-insensitive protein 1; leucine rich rep	9e-07
3ogk_B		592	Coronatine-insensitive protein 1; leucine rich rep	8e-05
1o6v_A		466	Internalin A; bacterial infection, extracellular r	3e-06
2z66_A		306	Variable lymphocyte receptor B, TOLL-like recepto;	2e-05
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	3e-05
3e4g_A		176	ATP synthase subunit S, mitochondrial; leucine-ric	5e-05
3jqh_A		167	C-type lectin domain family 4 member M; DC-signr,	6e-05
3jqh_A		167	C-type lectin domain family 4 member M; DC-signr,	5e-04
2id5_A		477	Lingo-1, leucine rich repeat neuronal 6A; CNS-spec	1e-04
3zyi_A		452	Leucine-rich repeat-containing protein 4; cell adh	1e-04
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	1e-04
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	2e-04
1xku_A		330	Decorin; proteoglycan, leucine-rich repeat, struct	3e-04
3cvr_A		571	Invasion plasmid antigen; leucine rich repeat and	5e-04
1dce_A		567	Protein (RAB geranylgeranyltransferase alpha subun	6e-04
1wwl_A		312	Monocyte differentiation antigen CD14; LPS, immune	7e-04
1wwl_A		312	Monocyte differentiation antigen CD14; LPS, immune	7e-04
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	8e-04

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328	Back alignment and structure

 Score = 84.6 bits (210), Expect = 6e-18
 Identities = 67/348 (19%), Positives = 105/348 (30%), Gaps = 69/348 (19%)

Query: 359 LEYLGLLYCEGLVKLPQSSLSLCSLREIEIYNCSSLVSFPEVALPSKLKKIQIRHCDALK 418
            E L       L                +     S          S   +I+ R   ALK
Sbjct: 14  RENLYFQGSTALRPYHDVLSQWQRHYNADRNRWHSAWRQAN----SNNPQIETRTGRALK 69

Query: 419 SLPEAWMCDTNSSLEILNIQYCCSLRYIVEVQLPPSLKQLTIWRCDNIRTLTVEEGIQSS 478
           +  +     T      L +     L      Q P    +L+     +++ +T++      
Sbjct: 70  ATADLLEDATQPGRVALEL-RSVPLP-----QFPDQAFRLS-----HLQHMTID------ 112

Query: 479 SSRRYTSSLLEKL--EIWDCPSLTCI-FSKN---ELPATLESLEVGNLPPSLKSL----- 527
                 ++ L +L   +     L  +  ++N    LPA++ SL        L+ L     
Sbjct: 113 ------AAGLMELPDTMQQFAGLETLTLARNPLRALPASIASLN------RLRELSIRAC 160

Query: 528 SRLEALPKGL---------HNLSCLQELTIIGGALPSLEEEDGLPTNLQSLDIRGNMEIC 578
             L  LP+ L           L  LQ L +    + SL        NL+SL IR +    
Sbjct: 161 PELTELPEPLASTDASGEHQGLVNLQSLRLEWTGIRSLPASIANLQNLKSLKIRNS---- 216

Query: 579 KSLIERGRGFHRFSSLRHLTIGGCDDDTVMVSFPLEDKRLGTALPLPASLTSLSISRFPN 638
             L   G   H    L  L + GC   T + ++P             A L  L +    N
Sbjct: 217 -PLSALGPAIHHLPKLEELDLRGC---TALRNYPPIFGGR-------APLKRLILKDCSN 265

Query: 639 LERLSSSIVDLQNLTELHLWDCPKLKYFPEK-GLPSSLLQLWISGCPL 685
           L  L   I  L  L +L L  C  L   P       +   + +     
Sbjct: 266 LLTLPLDIHRLTQLEKLDLRGCVNLSRLPSLIAQLPANCIILVPPHLQ 313

PyMOL of 4fcg

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549	Back alignment and structure

>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457	Back alignment and structure

>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454	Back alignment and structure

>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594	Back alignment and structure

>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592	Back alignment and structure

>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466	Back alignment and structure

>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606	Back alignment and structure

>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176	Back alignment and structure

>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477	Back alignment and structure

>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487	Back alignment and structure

>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330	Back alignment and structure

>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571	Back alignment and structure

>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567	Back alignment and structure

>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312	Back alignment and structure

>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		729
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	100.0
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	100.0
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	100.0
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	100.0
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	100.0
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	100.0
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	99.98
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	99.97
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	99.97
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	99.97
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	99.97
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	99.97
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	99.96
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	99.96
2z7x_B		520	TOLL-like receptor 1, variable lymphocyte recepto;	99.96
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	99.95
4g8a_A		635	TOLL-like receptor 4; leucine rich repeat MD-2 rel	99.95
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	99.95
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	99.95
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	99.95
2z7x_B		520	TOLL-like receptor 1, variable lymphocyte recepto;	99.94
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	99.94
3a79_B		562	TLR6, VLRB.59, TOLL-like receptor 6, variable lymp	99.94
3a79_B		562	TLR6, VLRB.59, TOLL-like receptor 6, variable lymp	99.93
4g8a_A		635	TOLL-like receptor 4; leucine rich repeat MD-2 rel	99.93
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	99.92
3v47_A		455	TOLL-like receptor 5B and variable lymphocyte REC	99.91
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	99.9
1o6v_A		466	Internalin A; bacterial infection, extracellular r	99.9
3bz5_A		457	Internalin-J, INLJ; leucine rich repeat (LRR), cys	99.9
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	99.9
3v47_A		455	TOLL-like receptor 5B and variable lymphocyte REC	99.9
3bz5_A		457	Internalin-J, INLJ; leucine rich repeat (LRR), cys	99.89
1o6v_A		466	Internalin A; bacterial infection, extracellular r	99.89
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	99.88
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	99.88
2id5_A		477	Lingo-1, leucine rich repeat neuronal 6A; CNS-spec	99.87
2id5_A		477	Lingo-1, leucine rich repeat neuronal 6A; CNS-spec	99.87
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	99.86
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	99.84
1xku_A		330	Decorin; proteoglycan, leucine-rich repeat, struct	99.84
2ft3_A		332	Biglycan; proteoglycan, dimer interface, structura	99.83
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	99.82
2ft3_A		332	Biglycan; proteoglycan, dimer interface, structura	99.82
3ogk_B		592	Coronatine-insensitive protein 1; leucine rich rep	99.81
1xku_A		330	Decorin; proteoglycan, leucine-rich repeat, struct	99.81
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	99.79
1ogq_A		313	PGIP-2, polygalacturonase inhibiting protein; inhi	99.79
3ogk_B		592	Coronatine-insensitive protein 1; leucine rich rep	99.78
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	99.78
2p1m_B		594	Transport inhibitor response 1 protein; F-BOX, leu	99.78
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	99.77
3zyi_A		452	Leucine-rich repeat-containing protein 4; cell adh	99.75
2p1m_B		594	Transport inhibitor response 1 protein; F-BOX, leu	99.75
3zyj_A		440	Leucine-rich repeat-containing protein 4C; cell ad	99.75
2z80_A		353	TOLL-like receptor 2, variable lymphocyte recepto;	99.74
3o53_A		317	Protein LRIM1, AGAP006348-PA; leucine-rich repeat,	99.73
3zyj_A		440	Leucine-rich repeat-containing protein 4C; cell ad	99.73
1z7x_W		461	Ribonuclease inhibitor; leucine-rich repeat, enzym	99.73
2z80_A		353	TOLL-like receptor 2, variable lymphocyte recepto;	99.73
2z66_A		306	Variable lymphocyte receptor B, TOLL-like recepto;	99.73
3zyi_A		452	Leucine-rich repeat-containing protein 4; cell adh	99.72
3o53_A		317	Protein LRIM1, AGAP006348-PA; leucine-rich repeat,	99.72
1z7x_W		461	Ribonuclease inhibitor; leucine-rich repeat, enzym	99.7
1ozn_A		285	Reticulon 4 receptor; NOGO receptor, MAD, myelinat	99.69
1ogq_A		313	PGIP-2, polygalacturonase inhibiting protein; inhi	99.69
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	99.69
2xwt_C		239	Thyrotropin receptor; signaling protein-immune sys	99.69
2z66_A		306	Variable lymphocyte receptor B, TOLL-like recepto;	99.69
4ay9_X		350	Follicle-stimulating hormone receptor; hormone-rec	99.68
2xwt_C		239	Thyrotropin receptor; signaling protein-immune sys	99.66
1ozn_A		285	Reticulon 4 receptor; NOGO receptor, MAD, myelinat	99.65
1p9a_G		290	Platelet glycoprotein IB alpha chain precursor; pl	99.64
1p9a_G		290	Platelet glycoprotein IB alpha chain precursor; pl	99.64
1wwl_A		312	Monocyte differentiation antigen CD14; LPS, immune	99.64
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	99.62
2o6q_A		270	Variable lymphocyte receptor A; leucine-rich repea	99.62
4ay9_X		350	Follicle-stimulating hormone receptor; hormone-rec	99.61
2o6q_A		270	Variable lymphocyte receptor A; leucine-rich repea	99.6
1wwl_A		312	Monocyte differentiation antigen CD14; LPS, immune	99.59
2z62_A		276	TOLL-like receptor 4, variable lymphocyte recepto;	99.59
2z62_A		276	TOLL-like receptor 4, variable lymphocyte recepto;	99.53
3rfs_A		272	Internalin B, repeat modules, variable lymphocyte	99.52
1h6u_A		308	Internalin H; cell adhesion, leucine rich repeat,	99.52
1h6u_A		308	Internalin H; cell adhesion, leucine rich repeat,	99.51
3m19_A		251	Variable lymphocyte receptor A diversity region; a	99.49
4glp_A		310	Monocyte differentiation antigen CD14; alpha beta	99.48
3rfs_A		272	Internalin B, repeat modules, variable lymphocyte	99.45
4glp_A		310	Monocyte differentiation antigen CD14; alpha beta	99.43
2ast_B		336	S-phase kinase-associated protein 2; SCF-substrate	99.41
3m19_A		251	Variable lymphocyte receptor A diversity region; a	99.4
4ezg_A		197	Putative uncharacterized protein; internalin-A, le	99.39
3goz_A		362	Leucine-rich repeat-containing protein; LEGL7, NES	99.37
2ca6_A		386	RAN GTPase-activating protein 1; GAP, GTPase activ	99.36
3e6j_A		229	Variable lymphocyte receptor diversity region; var	99.36
1h6t_A		291	Internalin B; cell adhesion, leucine rich repeat,	99.36
2v9t_B		220	SLIT homolog 2 protein N-product; structural prote	99.35
2ast_B		336	S-phase kinase-associated protein 2; SCF-substrate	99.35
3cvr_A		571	Invasion plasmid antigen; leucine rich repeat and	99.35
3cvr_A		571	Invasion plasmid antigen; leucine rich repeat and	99.32
3goz_A		362	Leucine-rich repeat-containing protein; LEGL7, NES	99.3
2ca6_A		386	RAN GTPase-activating protein 1; GAP, GTPase activ	99.27
1h6t_A		291	Internalin B; cell adhesion, leucine rich repeat,	99.26
3e6j_A		229	Variable lymphocyte receptor diversity region; var	99.26
1m9s_A		605	Internalin B; cell invasion, GW domains, SH3 domai	99.25
2o6s_A		208	Variable lymphocyte receptor B; leucine-rich repea	99.25
2v70_A		220	SLIT-2, SLIT homolog 2 protein N-product; neurogen	99.24
2xot_A		361	Amphoterin-induced protein 1; cell adhesion, neuro	99.22
2o6s_A		208	Variable lymphocyte receptor B; leucine-rich repea	99.22
1xeu_A		263	Internalin C; cellular invasion, leucine-rich repe	99.21
3sb4_A		329	Hypothetical leucine rich repeat protein; LRR, rig	99.2
4ezg_A		197	Putative uncharacterized protein; internalin-A, le	99.2
2v70_A		220	SLIT-2, SLIT homolog 2 protein N-product; neurogen	99.19
1m9s_A		605	Internalin B; cell invasion, GW domains, SH3 domai	99.18
2ell_A		168	Acidic leucine-rich nuclear phosphoprotein 32 FAM	99.17
2v9t_B		220	SLIT homolog 2 protein N-product; structural prote	99.16
1a9n_A		176	U2A', U2A'; complex (nuclear protein/RNA), RNA, sn	99.13
1xeu_A		263	Internalin C; cellular invasion, leucine-rich repe	99.12
2ell_A		168	Acidic leucine-rich nuclear phosphoprotein 32 FAM	99.12
2xot_A		361	Amphoterin-induced protein 1; cell adhesion, neuro	99.11
2je0_A		149	Acidic leucine-rich nuclear phosphoprotein 32 FAM	99.08
2je0_A		149	Acidic leucine-rich nuclear phosphoprotein 32 FAM	99.06
2wfh_A		193	SLIT homolog 2 protein C-product; developmental pr	99.05
1w8a_A		192	SLIT protein; signaling protein, secreted protein,	99.04
2o6r_A		177	Variable lymphocyte receptor B; leucine-rich repea	99.01
2wfh_A		193	SLIT homolog 2 protein C-product; developmental pr	99.0
3sb4_A		329	Hypothetical leucine rich repeat protein; LRR, rig	98.98
1w8a_A		192	SLIT protein; signaling protein, secreted protein,	98.95
1a9n_A		176	U2A', U2A'; complex (nuclear protein/RNA), RNA, sn	98.93
4fdw_A		401	Leucine rich hypothetical protein; putative cell s	98.93
4fdw_A		401	Leucine rich hypothetical protein; putative cell s	98.92
2o6r_A		177	Variable lymphocyte receptor B; leucine-rich repea	98.91
4b8c_D		727	Glucose-repressible alcohol dehydrogenase transcr	98.81
1dce_A		567	Protein (RAB geranylgeranyltransferase alpha subun	98.77
2r9u_A		174	Variable lymphocyte receptor; adaptive immunity, V	98.76
3g39_A		170	Variable lymphocyte receptor VLRB.2D; antibody, X-	98.76
4b8c_D		727	Glucose-repressible alcohol dehydrogenase transcr	98.69
1dce_A		567	Protein (RAB geranylgeranyltransferase alpha subun	98.65
1ds9_A		198	Outer arm dynein; leucine-rich repeat, beta-BETA-a	98.57
4fs7_A		394	Uncharacterized protein; leucine-rich repeats, pro	98.51
3g39_A		170	Variable lymphocyte receptor VLRB.2D; antibody, X-	98.5
4fs7_A		394	Uncharacterized protein; leucine-rich repeats, pro	98.46
2r9u_A		174	Variable lymphocyte receptor; adaptive immunity, V	98.46
1ds9_A		198	Outer arm dynein; leucine-rich repeat, beta-BETA-a	98.34
2ifg_A		347	High affinity nerve growth factor receptor; TRK, T	98.21
3e4g_A		176	ATP synthase subunit S, mitochondrial; leucine-ric	98.17
4gt6_A		394	Cell surface protein; leucine rich repeats, putati	98.17
3e4g_A		176	ATP synthase subunit S, mitochondrial; leucine-ric	98.13
2ifg_A		347	High affinity nerve growth factor receptor; TRK, T	98.11
4gt6_A		394	Cell surface protein; leucine rich repeats, putati	98.09
4h09_A		379	Hypothetical leucine rich repeat protein; two LRR_	98.02
4h09_A		379	Hypothetical leucine rich repeat protein; two LRR_	98.01
3un9_A		372	NLR family member X1; leucine rich repeat (LRR), a	97.89
2ra8_A		362	Uncharacterized protein Q64V53_bacfr; WGR domain,	97.82
3un9_A		372	NLR family member X1; leucine rich repeat (LRR), a	97.8
2ra8_A		362	Uncharacterized protein Q64V53_bacfr; WGR domain,	97.66
1io0_A		185	Tropomodulin; LRR protein, right-handed super-heli	97.43
1io0_A		185	Tropomodulin; LRR protein, right-handed super-heli	97.15
3rw6_A		267	Nuclear RNA export factor 1; retroviral constituti	96.72
3rw6_A		267	Nuclear RNA export factor 1; retroviral constituti	96.4
3rfe_A		130	Platelet glycoprotein IB beta chain; platelet surf	94.26
3rfe_A		130	Platelet glycoprotein IB beta chain; platelet surf	94.2
1pgv_A		197	TMD-1, tropomodulin TMD-1; structural genomics, PS	92.63
1pgv_A		197	TMD-1, tropomodulin TMD-1; structural genomics, PS	92.25

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A*	Back alignment and structure

Probab=100.00  E-value=7.2e-42  Score=397.85  Aligned_cols=536  Identities=17%  Similarity=0.096  Sum_probs=268.6

Q ss_pred             CCCCCCccEEEEeeeCCCCCCcccCCCCCCCccEEEEccCCCCCcCCCCCCCCCCCeEEEcCCCCceEcCccccCCCCCC
Q 038031           94 LKPHKNLDQFCVCGYGGTKFPTWLGDSSFSNLVTLKFEDCGMCTALPSVGQLPSLKHLTVRGMSRVKRLGSEFYGDDSPI  173 (729)
Q Consensus        94 l~~~~~L~~L~L~~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~l~~l~~l~~L~~L~L~~~~~l~~~~~~~~~~~~~~  173 (729)
                      +..+++|+.|++++|........   ..+++|++|++++|...+.+|.++.+++|++|++++|.....++..+      .
T Consensus       174 ~~~l~~L~~L~Ls~n~l~~~~~~---~~l~~L~~L~Ls~n~l~~~~~~l~~l~~L~~L~Ls~n~l~~~~~~~l------~  244 (768)
T 3rgz_A          174 SDGCGELKHLAISGNKISGDVDV---SRCVNLEFLDVSSNNFSTGIPFLGDCSALQHLDISGNKLSGDFSRAI------S  244 (768)
T ss_dssp             TTCCTTCCEEECCSSEEESCCBC---TTCTTCCEEECCSSCCCSCCCBCTTCCSCCEEECCSSCCCSCHHHHT------T
T ss_pred             hccCCCCCEEECCCCcccccCCc---ccCCcCCEEECcCCcCCCCCcccccCCCCCEEECcCCcCCCcccHHH------h
Confidence            44455666666665543332211   34566666666666544445556666666666666654332333222      1


Q ss_pred             CCCCcceeeecccccccccccCCCCCCCccCCccceEeeccCccccccCCCC----CCCccEEEEEccC---CcccccCC
Q 038031          174 PFPCLETLRFEDMQEWEDWIPHGSSQGVERFPKLRELQILRCSKLQGTLPEH----LPALQMLAIYKCE---KLSISITS  246 (729)
Q Consensus       174 ~~~~L~~L~l~~~~~l~~~~~~~~~~~~~~~~~L~~L~l~~~~~l~~~~~~~----l~~L~~L~l~~~~---~l~~~~~~  246 (729)
                      .+++|++|++.++.- ....+      ...+++|++|++++|. +++.+|..    +++|+.|++++|.   .++..+..
T Consensus       245 ~l~~L~~L~Ls~n~l-~~~~~------~~~l~~L~~L~L~~n~-l~~~ip~~~~~~~~~L~~L~Ls~n~l~~~~p~~~~~  316 (768)
T 3rgz_A          245 TCTELKLLNISSNQF-VGPIP------PLPLKSLQYLSLAENK-FTGEIPDFLSGACDTLTGLDLSGNHFYGAVPPFFGS  316 (768)
T ss_dssp             TCSSCCEEECCSSCC-EESCC------CCCCTTCCEEECCSSE-EEESCCCCSCTTCTTCSEEECCSSEEEECCCGGGGG
T ss_pred             cCCCCCEEECCCCcc-cCccC------ccccCCCCEEECcCCc-cCCccCHHHHhhcCcCCEEECcCCcCCCccchHHhc
Confidence            256666666665532 11111      1245666666666553 43344432    2566666666654   23334555


Q ss_pred             CCcccEEEEeCCCCceeeccccccCcccceeecCCCCcccccCCCCCCCCCccEEEEeccCCCchhhhhhhhhhhcCC-C
Q 038031          247 LPALCKLVIGGCKKVVLRSATDHLGLQNSVVCRDTSNQVFLAGPLKPRIPKLEELEIKNIKNETHIWKSYNELLQDIC-S  325 (729)
Q Consensus       247 l~~L~~L~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~L~~L~l~~~~~l~~~~~~~~~~~~~l~-~  325 (729)
                      +++|++|++++|......+..                       ....+++|+.|++.++.....++.    .+..++ +
T Consensus       317 l~~L~~L~L~~n~l~~~ip~~-----------------------~l~~l~~L~~L~Ls~n~l~~~~p~----~l~~l~~~  369 (768)
T 3rgz_A          317 CSLLESLALSSNNFSGELPMD-----------------------TLLKMRGLKVLDLSFNEFSGELPE----SLTNLSAS  369 (768)
T ss_dssp             CTTCCEEECCSSEEEEECCHH-----------------------HHTTCTTCCEEECCSSEEEECCCT----THHHHTTT
T ss_pred             CCCccEEECCCCcccCcCCHH-----------------------HHhcCCCCCEEeCcCCccCccccH----HHHhhhcC
Confidence            666666666666543111100                       001344555555554432112222    223333 5


Q ss_pred             ccEEEeccCCCccccchhhhHHHHhhhhhccCcccEEEeeecCCcccccccccCCCCccEEEeccCCCcc-cCCC-CCCc
Q 038031          326 LKRLTIRRCPKIQSLVVEEEKDQQQQLCELSCRLEYLGLLYCEGLVKLPQSSLSLCSLREIEIYNCSSLV-SFPE-VALP  403 (729)
Q Consensus       326 L~~L~l~~c~~l~~l~~~~~~~~~~~l~~~~~~L~~L~L~~~~~l~~~~~~~~~l~~L~~L~l~~c~~l~-~l~~-~~~~  403 (729)
                      |+.|+++++.-...++....     .  ..+++|++|++++|...+.+|..+..+++|++|++++| .++ .+|. ...+
T Consensus       370 L~~L~Ls~N~l~~~~~~~~~-----~--~~~~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~Ls~N-~l~~~~p~~l~~l  441 (768)
T 3rgz_A          370 LLTLDLSSNNFSGPILPNLC-----Q--NPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFN-YLSGTIPSSLGSL  441 (768)
T ss_dssp             CSEEECCSSEEEEECCTTTT-----C--STTCCCCEEECCSSEEEEECCGGGGGCTTCCEEECCSS-EEESCCCGGGGGC
T ss_pred             CcEEEccCCCcCCCcChhhh-----h--cccCCccEEECCCCccccccCHHHhcCCCCCEEECcCC-cccCcccHHHhcC
Confidence            55555554432111111100     0  00144555555555544445555555555555555553 232 2221 1124


Q ss_pred             CCcceEEEecCCCCCccccccccCCCCCccEEEeecCCCccccccc-CCCCCCCeEEEecCCCCcccccccCcccccccc
Q 038031          404 SKLKKIQIRHCDALKSLPEAWMCDTNSSLEILNIQYCCSLRYIVEV-QLPPSLKQLTIWRCDNIRTLTVEEGIQSSSSRR  482 (729)
Q Consensus       404 ~~L~~L~l~~~~~l~~~~~~~~~~~l~~L~~L~l~~c~~l~~~~~~-~~~~~L~~L~l~~~~~l~~l~~~~~~~~~~~~~  482 (729)
                      ++|++|++++|.....+|..+  ..+++|++|++++|.....++.. .-.++|+.|+++++.-...+  |..+.     .
T Consensus       442 ~~L~~L~L~~n~l~~~~p~~~--~~l~~L~~L~L~~N~l~~~~p~~l~~l~~L~~L~L~~N~l~~~~--p~~~~-----~  512 (768)
T 3rgz_A          442 SKLRDLKLWLNMLEGEIPQEL--MYVKTLETLILDFNDLTGEIPSGLSNCTNLNWISLSNNRLTGEI--PKWIG-----R  512 (768)
T ss_dssp             TTCCEEECCSSCCCSCCCGGG--GGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCCSCC--CGGGG-----G
T ss_pred             CCCCEEECCCCcccCcCCHHH--cCCCCceEEEecCCcccCcCCHHHhcCCCCCEEEccCCccCCcC--ChHHh-----c
Confidence            555555555555333444333  44555555555554322222211 11233555555554322222  22222     3


Q ss_pred             ccccccceEEecCCCCccccccCC-CCcccccccccc------ccccccccCcccccc----------------------
Q 038031          483 YTSSLLEKLEIWDCPSLTCIFSKN-ELPATLESLEVG------NLPPSLKSLSRLEAL----------------------  533 (729)
Q Consensus       483 l~~~~L~~L~l~~c~~l~~~~~~~-~~~~~L~~L~~~------~~~~~l~~~~~l~~l----------------------  533 (729)
                      ++  +|+.|++++|.-... +|.. .-.++|+.|+++      .+|..+..+..+..+                      
T Consensus       513 l~--~L~~L~L~~N~l~~~-~p~~l~~l~~L~~L~Ls~N~l~g~ip~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  589 (768)
T 3rgz_A          513 LE--NLAILKLSNNSFSGN-IPAELGDCRSLIWLDLNTNLFNGTIPAAMFKQSGKIAANFIAGKRYVYIKNDGMKKECHG  589 (768)
T ss_dssp             CT--TCCEEECCSSCCEEE-CCGGGGGCTTCCEEECCSSEEESBCCGGGGTTTTCBCCSTTCSCEEEEEECCSCCTTCCS
T ss_pred             CC--CCCEEECCCCcccCc-CCHHHcCCCCCCEEECCCCccCCcCChHHhcccchhhhhccccccccccccccccccccc
Confidence            34  555555555322212 2211 111334444221      122222111111000                      


Q ss_pred             -----------cCcCCCCCccceEEEccCCCC-CCCCCCCCCCCcceEEecCchhhhhhhhhccCCCCCCCCcceeeecc
Q 038031          534 -----------PKGLHNLSCLQELTIIGGALP-SLEEEDGLPTNLQSLDIRGNMEICKSLIERGRGFHRFSSLRHLTIGG  601 (729)
Q Consensus       534 -----------~~~~~~l~~L~~L~l~~~~i~-~l~~~~~~~~~L~~L~L~~~~~~~~~~~~~~~~l~~l~~L~~L~ls~  601 (729)
                                 +..+..++.++.+++..+.+. .++...+.+++|++||+++|.+.+.++.    .+..+++|+.|++++
T Consensus       590 ~~~~~~~~~~~~~~~~~l~~~~~~~l~~~~~~g~~~~~~~~l~~L~~LdLs~N~l~g~ip~----~l~~l~~L~~L~Ls~  665 (768)
T 3rgz_A          590 AGNLLEFQGIRSEQLNRLSTRNPCNITSRVYGGHTSPTFDNNGSMMFLDMSYNMLSGYIPK----EIGSMPYLFILNLGH  665 (768)
T ss_dssp             SEEEEECTTCCGGGGGGGGGTCCSCTTSCEEEEECCCSCSSSBCCCEEECCSSCCBSCCCG----GGGGCTTCCEEECCS
T ss_pred             cccccccccccchhhhccccccccccccceecccCchhhhccccccEEECcCCcccccCCH----HHhccccCCEEeCcC
Confidence                       000111112222222222211 1223344568899999999999987764    688999999999999


Q ss_pred             CCCccccccccccccccCCccCCCCCcceEEcccCCCcccccccCCCCCCccEEeecCCCCCCCCCCCCCCCccceeecc
Q 038031          602 CDDDTVMVSFPLEDKRLGTALPLPASLTSLSISRFPNLERLSSSIVDLQNLTELHLWDCPKLKYFPEKGLPSSLLQLWIS  681 (729)
Q Consensus       602 n~~~~~~~~~~~~~~~~~~~~~~l~~L~~L~l~~~~~l~~l~~~~~~l~~L~~L~l~~c~~l~~l~~~~~~~~L~~L~l~  681 (729)
                      |..   .+.+|...+       .+++|++|++++|.....+|..+..+++|++|++++|+..+.+|..+.+.++....+.
T Consensus       666 N~l---~g~ip~~l~-------~L~~L~~LdLs~N~l~g~ip~~l~~l~~L~~L~ls~N~l~g~iP~~~~~~~~~~~~~~  735 (768)
T 3rgz_A          666 NDI---SGSIPDEVG-------DLRGLNILDLSSNKLDGRIPQAMSALTMLTEIDLSNNNLSGPIPEMGQFETFPPAKFL  735 (768)
T ss_dssp             SCC---CSCCCGGGG-------GCTTCCEEECCSSCCEECCCGGGGGCCCCSEEECCSSEEEEECCSSSSGGGSCGGGGC
T ss_pred             Ccc---CCCCChHHh-------CCCCCCEEECCCCcccCcCChHHhCCCCCCEEECcCCcccccCCCchhhccCCHHHhc
Confidence            995   457887774       7899999999996655688999999999999999999888899998888889999999


Q ss_pred             CCchhHH----hhhccCCCCcccccccceE
Q 038031          682 GCPLIEE----KCRKDGGQYWDLLTHIPCV  707 (729)
Q Consensus       682 ~n~~l~~----~~~~~~~~~~~~~~~~~~~  707 (729)
                      +||.+..    .|....++.|.+++|++.+
T Consensus       736 gN~~Lcg~~l~~C~~~~~~~~~~~~~~~~~  765 (768)
T 3rgz_A          736 NNPGLCGYPLPRCDPSNADGYAHHQRSHHH  765 (768)
T ss_dssp             SCTEEESTTSCCCCSCC-------------
T ss_pred             CCchhcCCCCcCCCCCccCCCCCCCCcccc
Confidence            9987653    4778889999999999874

PyMOL of 3rgz

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A*	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A*	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A*	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A*	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A*	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A*	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A*	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens}	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens}	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens}	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A*	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens}	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A*	Back alignment and structure

>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens}	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697}	Back alignment and structure

>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A*	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron}	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697}	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron}	Back alignment and structure

>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens}	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A	Back alignment and structure

>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus}	Back alignment and structure

>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus}	Back alignment and structure

>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A*	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A	Back alignment and structure

>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A*	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae}	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A	Back alignment and structure

>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes}	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B}	Back alignment and structure

>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A*	Back alignment and structure

>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes}	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae}	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B}	Back alignment and structure

>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens}	Back alignment and structure

>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens}	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae}	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae}	Back alignment and structure

>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A*	Back alignment and structure

>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus}	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV}	Back alignment and structure

>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus}	Back alignment and structure

>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B*	Back alignment and structure

>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A*	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium}	Back alignment and structure

>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8	Back alignment and structure

>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B*	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV}	Back alignment and structure

>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B*	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium}	Back alignment and structure

>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A	Back alignment and structure

>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B*	Back alignment and structure

>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens}	Back alignment and structure

>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens}	Back alignment and structure

>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae}	Back alignment and structure

>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens}	Back alignment and structure

>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I	Back alignment and structure

>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens}	Back alignment and structure

>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri}	Back alignment and structure

>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A	Back alignment and structure

>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae}	Back alignment and structure

>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I	Back alignment and structure

>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A*	Back alignment and structure

>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae}	Back alignment and structure

>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C*	Back alignment and structure

>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri}	Back alignment and structure

>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C*	Back alignment and structure

>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C*	Back alignment and structure

>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A*	Back alignment and structure

>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A	Back alignment and structure

>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A	Back alignment and structure

>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus}	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae}	Back alignment and structure

>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri}	Back alignment and structure

>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C*	Back alignment and structure

>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri}	Back alignment and structure

>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus}	Back alignment and structure

>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A*	Back alignment and structure

>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A*	Back alignment and structure

>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A	Back alignment and structure

>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1	Back alignment and structure

>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1	Back alignment and structure

>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A	Back alignment and structure

>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens}	Back alignment and structure

>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A	Back alignment and structure

>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens}	Back alignment and structure

>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A	Back alignment and structure

>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A	Back alignment and structure

>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes}	Back alignment and structure

>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp}	Back alignment and structure

>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A	Back alignment and structure

>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus}	Back alignment and structure

>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A	Back alignment and structure

>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A	Back alignment and structure

>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A	Back alignment and structure

>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A}	Back alignment and structure

>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A}	Back alignment and structure

>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp}	Back alignment and structure

>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A	Back alignment and structure

>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A	Back alignment and structure

>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus}	Back alignment and structure

>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A	Back alignment and structure

>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri}	Back alignment and structure

>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens}	Back alignment and structure

>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus}	Back alignment and structure

>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri}	Back alignment and structure

>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes}	Back alignment and structure

>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron}	Back alignment and structure

>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes}	Back alignment and structure

>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens}	Back alignment and structure

>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A	Back alignment and structure

>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A	Back alignment and structure

>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A	Back alignment and structure

>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4	Back alignment and structure

>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes}	Back alignment and structure

>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A	Back alignment and structure

>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus}	Back alignment and structure

>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A	Back alignment and structure

>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A	Back alignment and structure

>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens}	Back alignment and structure

>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7	Back alignment and structure

>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri}	Back alignment and structure

>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens}	Back alignment and structure

>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron}	Back alignment and structure

>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7	Back alignment and structure

>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4	Back alignment and structure

>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A	Back alignment and structure

>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A	Back alignment and structure

>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri}	Back alignment and structure

>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C}	Back alignment and structure

>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A*	Back alignment and structure

>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus}	Back alignment and structure

>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D	Back alignment and structure

>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C}	Back alignment and structure

>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A*	Back alignment and structure

>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A	Back alignment and structure

>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus}	Back alignment and structure

>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D	Back alignment and structure

>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus}	Back alignment and structure

>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus}	Back alignment and structure

>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A	Back alignment and structure

>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7	Back alignment and structure

>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A	Back alignment and structure

>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165}	Back alignment and structure

>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A	Back alignment and structure

>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7	Back alignment and structure

>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165}	Back alignment and structure

>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum}	Back alignment and structure

>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum}	Back alignment and structure

>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens}	Back alignment and structure

>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis}	Back alignment and structure

>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens}	Back alignment and structure

>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis}	Back alignment and structure

>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1	Back alignment and structure

>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1	Back alignment and structure

>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A	Back alignment and structure

>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A	Back alignment and structure

>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A*	Back alignment and structure

>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A*	Back alignment and structure

>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1	Back alignment and structure

>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		729
d2omza2		384	Internalin A {Listeria monocytogenes [TaxId: 1639]	99.77
d2omza2		384	Internalin A {Listeria monocytogenes [TaxId: 1639]	99.77
d1xkua_		305	Decorin {Cow (Bos taurus) [TaxId: 9913]}	99.75
d1xkua_		305	Decorin {Cow (Bos taurus) [TaxId: 9913]}	99.66
d1ogqa_		313	Polygalacturonase inhibiting protein PGIP {Kidney	99.63
d1p9ag_		266	von Willebrand factor binding domain of glycoprote	99.61
d1p9ag_		266	von Willebrand factor binding domain of glycoprote	99.58
d1ogqa_		313	Polygalacturonase inhibiting protein PGIP {Kidney	99.55
d1ozna_		284	Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma	99.55
d1ozna_		284	Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma	99.54
d1jl5a_		353	Leucine rich effector protein YopM {Yersinia pesti	99.53
d1jl5a_		353	Leucine rich effector protein YopM {Yersinia pesti	99.51
d1xwdc1		242	Follicle-stimulating hormone receptor {Human (Homo	99.44
d1xwdc1		242	Follicle-stimulating hormone receptor {Human (Homo	99.39
d1h6ua2		227	Internalin H {Listeria monocytogenes [TaxId: 1639]	99.36
d1h6ua2		227	Internalin H {Listeria monocytogenes [TaxId: 1639]	99.33
d1h6ta2		210	Internalin B {Listeria monocytogenes [TaxId: 1639]	99.27
d2omxa2		199	Internalin B {Listeria monocytogenes [TaxId: 1639]	99.26
d2astb2		284	Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa	99.22
d2omxa2		199	Internalin B {Listeria monocytogenes [TaxId: 1639]	99.21
d1h6ta2		210	Internalin B {Listeria monocytogenes [TaxId: 1639]	99.2
d2astb2		284	Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa	99.2
d1w8aa_		192	Slit {Fruit fly (Drosophila melanogaster) [TaxId:	99.17
d1a9na_		162	Splicesomal U2A' protein {Human (Homo sapiens) [Ta	99.14
d1w8aa_		192	Slit {Fruit fly (Drosophila melanogaster) [TaxId:	99.09
d1dcea3		124	Rab geranylgeranyltransferase alpha-subunit, C-ter	99.02
d1z7xw1		460	Ribonuclease inhibitor {Human (Homo sapiens) [TaxI	98.98
d1dcea3		124	Rab geranylgeranyltransferase alpha-subunit, C-ter	98.92
d1z7xw1		460	Ribonuclease inhibitor {Human (Homo sapiens) [TaxI	98.86
d1a9na_		162	Splicesomal U2A' protein {Human (Homo sapiens) [Ta	98.84
d1m9la_		198	Outer arm dynein light chain 1 {Green algae (Chlam	98.67
d2ifga3		156	High affinity nerve growth factor receptor, N-term	98.59
d2ifga3		156	High affinity nerve growth factor receptor, N-term	98.55
d2ca6a1		344	Rna1p (RanGAP1), N-terminal domain {Fission yeast	98.46
d2ca6a1		344	Rna1p (RanGAP1), N-terminal domain {Fission yeast	98.31
d1m9la_		198	Outer arm dynein light chain 1 {Green algae (Chlam	98.3
d1koha1		162	mRNA export factor tap {Human (Homo sapiens) [TaxI	96.97
d1koha1		162	mRNA export factor tap {Human (Homo sapiens) [TaxI	96.89
d1pgva_		167	Tropomodulin C-terminal domain {nematode (Caenorha	96.55
d1pgva_		167	Tropomodulin C-terminal domain {nematode (Caenorha	96.09
d1io0a_		166	Tropomodulin C-terminal domain {Chicken (Gallus ga	95.35
d1io0a_		166	Tropomodulin C-terminal domain {Chicken (Gallus ga	94.69

>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]

Probab=99.77  E-value=3.6e-17  Score=171.71  Aligned_cols=191  Identities=15%  Similarity=0.194  Sum_probs=106.6

Q ss_pred             hhcCCCccEEEeccCCCccccchhhhHHHHhhhhhccCcccEEEeeecCCcccccccccCCCCccEEEeccCCCcccCCC
Q 038031          320 LQDICSLKRLTIRRCPKIQSLVVEEEKDQQQQLCELSCRLEYLGLLYCEGLVKLPQSSLSLCSLREIEIYNCSSLVSFPE  399 (729)
Q Consensus       320 ~~~l~~L~~L~l~~c~~l~~l~~~~~~~~~~~l~~~~~~L~~L~L~~~~~l~~~~~~~~~l~~L~~L~l~~c~~l~~l~~  399 (729)
                      ...+++++.+.++++. ++.+.+.          ..+++|++|++++|. ++.++ .+..+++|+.|++++| .++.++.
T Consensus       193 ~~~l~~~~~l~l~~n~-i~~~~~~----------~~~~~L~~L~l~~n~-l~~~~-~l~~l~~L~~L~l~~n-~l~~~~~  258 (384)
T d2omza2         193 LAKLTNLESLIATNNQ-ISDITPL----------GILTNLDELSLNGNQ-LKDIG-TLASLTNLTDLDLANN-QISNLAP  258 (384)
T ss_dssp             GGGCTTCSEEECCSSC-CCCCGGG----------GGCTTCCEEECCSSC-CCCCG-GGGGCTTCSEEECCSS-CCCCCGG
T ss_pred             cccccccceeeccCCc-cCCCCcc----------cccCCCCEEECCCCC-CCCcc-hhhcccccchhccccC-ccCCCCc
Confidence            4555666666666543 3332211          012566777776665 33333 4556677777777763 4565555


Q ss_pred             CCCcCCcceEEEecCCCCCccccccccCCCCCccEEEeecCCCcccccccCCCCCCCeEEEecCCCCcccccccCccccc
Q 038031          400 VALPSKLKKIQIRHCDALKSLPEAWMCDTNSSLEILNIQYCCSLRYIVEVQLPPSLKQLTIWRCDNIRTLTVEEGIQSSS  479 (729)
Q Consensus       400 ~~~~~~L~~L~l~~~~~l~~~~~~~~~~~l~~L~~L~l~~c~~l~~~~~~~~~~~L~~L~l~~~~~l~~l~~~~~~~~~~  479 (729)
                      ...+++|++|+++++. +..++..   ..++.++.+.+..+ .+..+....                             
T Consensus       259 ~~~~~~L~~L~l~~~~-l~~~~~~---~~~~~l~~l~~~~n-~l~~~~~~~-----------------------------  304 (384)
T d2omza2         259 LSGLTKLTELKLGANQ-ISNISPL---AGLTALTNLELNEN-QLEDISPIS-----------------------------  304 (384)
T ss_dssp             GTTCTTCSEEECCSSC-CCCCGGG---TTCTTCSEEECCSS-CCSCCGGGG-----------------------------
T ss_pred             ccccccCCEeeccCcc-cCCCCcc---cccccccccccccc-ccccccccc-----------------------------
Confidence            5556667777776665 4444432   45556666665543 221111111                             


Q ss_pred             cccccccccceEEecCCCCccccccCCCCccccccccccccccccccCcccccccCcCCCCCccceEEEccCCCCCCCCC
Q 038031          480 SRRYTSSLLEKLEIWDCPSLTCIFSKNELPATLESLEVGNLPPSLKSLSRLEALPKGLHNLSCLQELTIIGGALPSLEEE  559 (729)
Q Consensus       480 ~~~l~~~~L~~L~l~~c~~l~~~~~~~~~~~~L~~L~~~~~~~~l~~~~~l~~l~~~~~~l~~L~~L~l~~~~i~~l~~~  559 (729)
                        .++  +++.|+++++ .++                               .++ .+..+++|++|++++|+++.++. 
T Consensus       305 --~~~--~l~~L~ls~n-~l~-------------------------------~l~-~l~~l~~L~~L~L~~n~l~~l~~-  346 (384)
T d2omza2         305 --NLK--NLTYLTLYFN-NIS-------------------------------DIS-PVSSLTKLQRLFFANNKVSDVSS-  346 (384)
T ss_dssp             --GCT--TCSEEECCSS-CCS-------------------------------CCG-GGGGCTTCCEEECCSSCCCCCGG-
T ss_pred             --hhc--ccCeEECCCC-CCC-------------------------------CCc-ccccCCCCCEEECCCCCCCCChh-
Confidence              233  5666666552 111                               111 13456777777777777766653 


Q ss_pred             CCCCCCcceEEecCchhhhhhhhhccCCCCCCCCcceeeeccC
Q 038031          560 DGLPTNLQSLDIRGNMEICKSLIERGRGFHRFSSLRHLTIGGC  602 (729)
Q Consensus       560 ~~~~~~L~~L~L~~~~~~~~~~~~~~~~l~~l~~L~~L~ls~n  602 (729)
                      ...+++|++|++++|++.+..      .+.++++|+.|+|++|
T Consensus       347 l~~l~~L~~L~l~~N~l~~l~------~l~~l~~L~~L~L~~N  383 (384)
T d2omza2         347 LANLTNINWLSAGHNQISDLT------PLANLTRITQLGLNDQ  383 (384)
T ss_dssp             GGGCTTCCEEECCSSCCCBCG------GGTTCTTCSEEECCCE
T ss_pred             HcCCCCCCEEECCCCcCCCCh------hhccCCCCCEeeCCCC
Confidence            344577777777777766532      3567778888888775

PyMOL of d2omza2

>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]}	Back information, alignment and structure

>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]}	Back information, alignment and structure

>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]}	Back information, alignment and structure

>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]}	Back information, alignment and structure

>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}	Back information, alignment and structure

>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}	Back information, alignment and structure

>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]}	Back information, alignment and structure

>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}	Back information, alignment and structure

>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}	Back information, alignment and structure

>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]}	Back information, alignment and structure

>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]}	Back information, alignment and structure

>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]}	Back information, alignment and structure

>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]}	Back information, alignment and structure

>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]}	Back information, alignment and structure