Citrus Sinensis ID: 038068
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 269 | ||||||
| 255583779 | 374 | ubiquitin-protein ligase, putative [Rici | 0.814 | 0.585 | 0.449 | 1e-47 | |
| 224135291 | 372 | predicted protein [Populus trichocarpa] | 0.836 | 0.604 | 0.423 | 4e-47 | |
| 388496832 | 281 | unknown [Lotus japonicus] | 0.907 | 0.868 | 0.401 | 4e-43 | |
| 225453102 | 355 | PREDICTED: E3 ubiquitin-protein ligase S | 0.832 | 0.630 | 0.404 | 8e-42 | |
| 147816090 | 355 | hypothetical protein VITISV_037121 [Viti | 0.832 | 0.630 | 0.404 | 2e-41 | |
| 255647862 | 320 | unknown [Glycine max] | 0.843 | 0.709 | 0.389 | 4e-41 | |
| 356524904 | 320 | PREDICTED: E3 ubiquitin-protein ligase S | 0.843 | 0.709 | 0.389 | 4e-41 | |
| 356512131 | 320 | PREDICTED: E3 ubiquitin-protein ligase S | 0.773 | 0.65 | 0.416 | 3e-40 | |
| 358348167 | 327 | E3 ubiquitin-protein ligase SINA-like pr | 0.743 | 0.611 | 0.399 | 1e-38 | |
| 357503141 | 317 | Ubiquitin [Medicago truncatula] gi|35549 | 0.706 | 0.599 | 0.439 | 4e-37 |
| >gi|255583779|ref|XP_002532642.1| ubiquitin-protein ligase, putative [Ricinus communis] gi|223527633|gb|EEF29745.1| ubiquitin-protein ligase, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
Score = 196 bits (497), Expect = 1e-47, Method: Compositional matrix adjust.
Identities = 103/229 (44%), Positives = 146/229 (63%), Gaps = 10/229 (4%)
Query: 38 GSCKNGSEALTITDQDIFDCPICFEPLTVPVFQCVNGHLACSDCCAKIKRNCPTCSSPTV 97
G+ +N + +T+TD ++ DCPIC+E L++PVFQC NGH ACS CC K+ CP+CS P
Sbjct: 103 GTARNAAICVTLTDPEVLDCPICYECLSIPVFQCENGHTACSSCCRKLAHKCPSCSLPIG 162
Query: 98 IVRNWAIEKVIELVQVNCKNAEYGCQQKMSFSKKRGHEKTCQHSPLPCPLSDCSFLGCSS 157
R AIEKV+E V++ C N +YGC++ +S+SKK H+K C ++P CPLS CSF+G S
Sbjct: 163 YNRCRAIEKVLESVKLPCHNLKYGCKEMVSYSKKLDHDKICNNAPCSCPLSGCSFVGSSR 222
Query: 158 QFVRHFMAKHNISAVPFKYNSLLNVNLNVNDINIDGKFSVLQEEKNDDVLFILNNNTGSL 217
Q +HF KH SA PF+YN V +ND ++ +LQEEK + V+F L N L
Sbjct: 223 QLYQHFSIKHKGSAAPFRYNITFPVFFTLNDKSL-----ILQEEK-EGVVFFLKNTAEIL 276
Query: 218 GNLVSVCCIA--SVRKDLYYDIVARCVTGTTLKIQSSTWS-SKVRSDIP 263
GN+++V C+ S + +Y++ AR + G+ LK QS T + KV D P
Sbjct: 277 GNVITVNCLGGPSSKGGYFYELAAR-MEGSNLKFQSFTKNIQKVNHDDP 324
|
Source: Ricinus communis Species: Ricinus communis Genus: Ricinus Family: Euphorbiaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|224135291|ref|XP_002327611.1| predicted protein [Populus trichocarpa] gi|222836165|gb|EEE74586.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|388496832|gb|AFK36482.1| unknown [Lotus japonicus] | Back alignment and taxonomy information |
|---|
| >gi|225453102|ref|XP_002271757.1| PREDICTED: E3 ubiquitin-protein ligase SINA-like 10 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|147816090|emb|CAN77431.1| hypothetical protein VITISV_037121 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|255647862|gb|ACU24390.1| unknown [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356524904|ref|XP_003531068.1| PREDICTED: E3 ubiquitin-protein ligase SINA-like 10-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356512131|ref|XP_003524774.1| PREDICTED: E3 ubiquitin-protein ligase SINA-like 10-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|358348167|ref|XP_003638120.1| E3 ubiquitin-protein ligase SINA-like protein [Medicago truncatula] gi|355504055|gb|AES85258.1| E3 ubiquitin-protein ligase SINA-like protein [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|357503141|ref|XP_003621859.1| Ubiquitin [Medicago truncatula] gi|355496874|gb|AES78077.1| Ubiquitin [Medicago truncatula] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 269 | ||||||
| TAIR|locus:2153784 | 349 | AT5G37930 [Arabidopsis thalian | 0.814 | 0.627 | 0.346 | 1.2e-35 | |
| TAIR|locus:2153804 | 281 | AT5G37870 [Arabidopsis thalian | 0.825 | 0.790 | 0.313 | 6e-32 | |
| TAIR|locus:2033369 | 329 | AT1G66650 [Arabidopsis thalian | 0.810 | 0.662 | 0.339 | 2e-31 | |
| TAIR|locus:2195180 | 303 | AT1G66630 [Arabidopsis thalian | 0.739 | 0.656 | 0.357 | 2.6e-31 | |
| TAIR|locus:2153754 | 286 | AT5G37890 [Arabidopsis thalian | 0.855 | 0.804 | 0.325 | 6.2e-30 | |
| TAIR|locus:2195175 | 313 | AT1G66620 [Arabidopsis thalian | 0.561 | 0.482 | 0.388 | 7.9e-30 | |
| TAIR|locus:2033354 | 348 | AT1G66660 [Arabidopsis thalian | 0.773 | 0.597 | 0.312 | 8.6e-30 | |
| TAIR|locus:2153774 | 276 | AT5G37910 [Arabidopsis thalian | 0.475 | 0.463 | 0.406 | 2.2e-27 | |
| UNIPROTKB|P29304 | 314 | sina "E3 ubiquitin-protein lig | 0.609 | 0.522 | 0.315 | 2.3e-23 | |
| UNIPROTKB|Q8I147 | 331 | sina "E3 ubiquitin-protein lig | 0.557 | 0.453 | 0.337 | 3.8e-23 |
| TAIR|locus:2153784 AT5G37930 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 385 (140.6 bits), Expect = 1.2e-35, P = 1.2e-35
Identities = 78/225 (34%), Positives = 116/225 (51%)
Query: 3 MAKNSAKAGKRVGDGEGPSSPKRQRKNNGHDEEEDGSCKNGSEALTITDQDIFDCPICFE 62
M S G D + + +R + + S K+ ++T+ D D+ DCPIC E
Sbjct: 59 MRPESEDRGSTSDDSDREVVIEERRFGKFVNSQSSSSSKDSPLSVTLLDPDVLDCPICCE 118
Query: 63 PLTVPVFQCVNGHLACSDCCAKIKRNCPTCSSPTVIVRNWAIEKVIELVQVNCKNAEYGC 122
PL +P+FQC NGHLAC+ CC K++ CP+C+ P VR A+EKVIE +V+C NA+YGC
Sbjct: 119 PLKIPIFQCDNGHLACTLCCTKVRNRCPSCTLPIGYVRCRAMEKVIEASRVSCLNAKYGC 178
Query: 123 QQKMSFSKKRGHEKTCQHSPLPCPLSDCSFLGCSSQFVRHFMAKHNISAVPFKYNSXXXX 182
++ S+ + HE+ C +P CP+ DC + G H A+H + F +N+
Sbjct: 179 KESTSYGNRFSHEQVCVFTPCSCPILDCHYTGYYKDLNNHVRAEHKDDLISFVWNTRLTI 238
Query: 183 XXXXXXXXXXGKFSVLQEEKNDDVLFILNNNTGSLGNLVSVCCIA 227
K ++LQEE ND + ++ VSV CIA
Sbjct: 239 SLDLNK-----KTTILQEE-NDGHVIVVQVFRALHAVYVSVSCIA 277
|
|
| TAIR|locus:2153804 AT5G37870 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2033369 AT1G66650 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2195180 AT1G66630 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2153754 AT5G37890 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2195175 AT1G66620 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2033354 AT1G66660 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2153774 AT5G37910 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P29304 sina "E3 ubiquitin-protein ligase sina" [Drosophila virilis (taxid:7244)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q8I147 sina "E3 ubiquitin-protein ligase sina" [Drosophila willistoni (taxid:7260)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 269 | |||
| pfam03145 | 198 | pfam03145, Sina, Seven in absentia protein family | 3e-14 | |
| pfam13923 | 45 | pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RI | 3e-05 |
| >gnl|CDD|190542 pfam03145, Sina, Seven in absentia protein family | Back alignment and domain information |
|---|
Score = 69.0 bits (169), Expect = 3e-14
Identities = 24/72 (33%), Positives = 35/72 (48%), Gaps = 2/72 (2%)
Query: 99 VRNWAIEKVIELVQVNCKNAEYGCQQKMSFSKKRGHEKTCQHSPL--PCPLSDCSFLGCS 156
+RN A+EKV V CK+A GC ++ K HE+ C++ P P P + C + G
Sbjct: 1 IRNLAVEKVASKVLFPCKHAALGCPVRLPLQLKDWHEERCEYKPYFCPMPGAKCKWQGDE 60
Query: 157 SQFVRHFMAKHN 168
+ H A H
Sbjct: 61 DDLMPHLTADHK 72
|
The seven in absentia (sina) gene was first identified in Drosophila. The Drosophila Sina protein is essential for the determination of the R7 pathway in photoreceptor cell development: the loss of functional Sina results in the transformation of the R7 precursor cell to a non- neuronal cell type. The Sina protein contains an N-terminal RING finger domain pfam00097. Through this domain, Sina binds E2 ubiquitin-conjugating enzymes (UbcD1) Sina also interacts with Tramtrack (TTK88) via PHYL. Tramtrack is a transcriptional repressor that blocks photoreceptor determination, while PHYL down-regulates the activity of TTK88. In turn, the activity of PHYL requires the activation of the Sevenless receptor tyrosine kinase, a process essential for R7 determination. It is thought that thus Sina targets TTK88 for degradation, therefore promoting the R7 pathway. Murine and human homologues of Sina have also been identified. The human homologue Siah-1 also binds E2 enzymes (UbcH5) and through a series of physical interactions, targets beta-catenin for ubiquitin degradation. Siah-1 expression is enhanced by p53, itself promoted by DNA damage. Thus this pathway links DNA damage to beta-catenin degradation. Sina proteins, therefore, physically interact with a variety of proteins. The N-terminal RING finger domain that binds ubiquitin conjugating enzymes is described in pfam00097, and does not form part of the alignment for this family. The remainder C-terminal part is involved in interactions with other proteins, and is included in this alignment. In addition to the Drosophila protein and mammalian homologues, whose similarity was noted previously, this family also includes putative homologues from Caenorhabditis elegans, Arabidopsis thaliana. Length = 198 |
| >gnl|CDD|206094 pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RING finger) | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 269 | |||
| KOG3002 | 299 | consensus Zn finger protein [General function pred | 100.0 | |
| PF03145 | 198 | Sina: Seven in absentia protein family; InterPro: | 99.95 | |
| KOG0297 | 391 | consensus TNF receptor-associated factor [Signal t | 99.46 | |
| cd03829 | 127 | Sina Seven in absentia (Sina) protein family, C-te | 99.1 | |
| PF15227 | 42 | zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: | 98.81 | |
| KOG0823 | 230 | consensus Predicted E3 ubiquitin ligase [Posttrans | 98.8 | |
| KOG0320 | 187 | consensus Predicted E3 ubiquitin ligase [Posttrans | 98.73 | |
| PF14835 | 65 | zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM | 98.71 | |
| PLN03208 | 193 | E3 ubiquitin-protein ligase RMA2; Provisional | 98.69 | |
| smart00504 | 63 | Ubox Modified RING finger domain. Modified RING fi | 98.67 | |
| PF13923 | 39 | zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); | 98.66 | |
| KOG0287 | 442 | consensus Postreplication repair protein RAD18 [Re | 98.55 | |
| PF13920 | 50 | zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); | 98.53 | |
| PF02176 | 60 | zf-TRAF: TRAF-type zinc finger; PDB: 2EOD_A 2YUC_A | 98.51 | |
| KOG0317 | 293 | consensus Predicted E3 ubiquitin ligase, integral | 98.49 | |
| TIGR00599 | 397 | rad18 DNA repair protein rad18. This family is bas | 98.47 | |
| PF13639 | 44 | zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C | 98.39 | |
| PF00097 | 41 | zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I | 98.35 | |
| PF04564 | 73 | U-box: U-box domain; InterPro: IPR003613 Quality c | 98.31 | |
| PHA02929 | 238 | N1R/p28-like protein; Provisional | 98.27 | |
| PF14634 | 44 | zf-RING_5: zinc-RING finger domain | 98.22 | |
| cd00162 | 45 | RING RING-finger (Really Interesting New Gene) dom | 98.15 | |
| COG5432 | 391 | RAD18 RING-finger-containing E3 ubiquitin ligase [ | 98.03 | |
| PF13445 | 43 | zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A. | 97.94 | |
| COG5574 | 271 | PEX10 RING-finger-containing E3 ubiquitin ligase [ | 97.85 | |
| KOG2164 | 513 | consensus Predicted E3 ubiquitin ligase [Posttrans | 97.84 | |
| PHA02926 | 242 | zinc finger-like protein; Provisional | 97.8 | |
| smart00184 | 39 | RING Ring finger. E3 ubiquitin-protein ligase acti | 97.74 | |
| PF02176 | 60 | zf-TRAF: TRAF-type zinc finger; PDB: 2EOD_A 2YUC_A | 97.61 | |
| TIGR00570 | 309 | cdk7 CDK-activating kinase assembly factor MAT1. A | 97.58 | |
| KOG0311 | 381 | consensus Predicted E3 ubiquitin ligase [Posttrans | 97.46 | |
| PF12678 | 73 | zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 | 97.42 | |
| KOG2177 | 386 | consensus Predicted E3 ubiquitin ligase [Posttrans | 97.37 | |
| KOG0978 | 698 | consensus E3 ubiquitin ligase involved in syntaxin | 97.33 | |
| PF07800 | 162 | DUF1644: Protein of unknown function (DUF1644); In | 97.23 | |
| PLN03086 | 567 | PRLI-interacting factor K; Provisional | 96.93 | |
| PLN03086 | 567 | PRLI-interacting factor K; Provisional | 96.88 | |
| COG5152 | 259 | Uncharacterized conserved protein, contains RING a | 96.73 | |
| PF11789 | 57 | zf-Nse: Zinc-finger of the MIZ type in Nse subunit | 96.66 | |
| KOG2879 | 298 | consensus Predicted E3 ubiquitin ligase [Posttrans | 96.59 | |
| KOG1813 | 313 | consensus Predicted E3 ubiquitin ligase [Posttrans | 96.5 | |
| KOG4159 | 398 | consensus Predicted E3 ubiquitin ligase [Posttrans | 96.5 | |
| KOG2660 | 331 | consensus Locus-specific chromosome binding protei | 96.43 | |
| PF12861 | 85 | zf-Apc11: Anaphase-promoting complex subunit 11 RI | 96.37 | |
| KOG4265 | 349 | consensus Predicted E3 ubiquitin ligase [Posttrans | 96.34 | |
| KOG4739 | 233 | consensus Uncharacterized protein involved in syna | 96.14 | |
| KOG0802 | 543 | consensus E3 ubiquitin ligase [Posttranslational m | 95.9 | |
| PF14570 | 48 | zf-RING_4: RING/Ubox like zinc-binding domain; PDB | 95.88 | |
| KOG4172 | 62 | consensus Predicted E3 ubiquitin ligase [Posttrans | 95.73 | |
| COG5540 | 374 | RING-finger-containing ubiquitin ligase [Posttrans | 95.62 | |
| COG5222 | 427 | Uncharacterized conserved protein, contains RING Z | 95.34 | |
| KOG0824 | 324 | consensus Predicted E3 ubiquitin ligase [Posttrans | 95.3 | |
| KOG1785 | 563 | consensus Tyrosine kinase negative regulator CBL [ | 95.15 | |
| COG5236 | 493 | Uncharacterized conserved protein, contains RING Z | 95.1 | |
| COG5175 | 480 | MOT2 Transcriptional repressor [Transcription] | 95.05 | |
| PF05290 | 140 | Baculo_IE-1: Baculovirus immediate-early protein ( | 94.63 | |
| KOG4275 | 350 | consensus Predicted E3 ubiquitin ligase [Posttrans | 94.57 | |
| COG5243 | 491 | HRD1 HRD ubiquitin ligase complex, ER membrane com | 94.06 | |
| PF14447 | 55 | Prok-RING_4: Prokaryotic RING finger family 4 | 93.6 | |
| KOG4692 | 489 | consensus Predicted E3 ubiquitin ligase [Posttrans | 93.47 | |
| KOG1002 | 791 | consensus Nucleotide excision repair protein RAD16 | 93.4 | |
| KOG1039 | 344 | consensus Predicted E3 ubiquitin ligase [Posttrans | 93.22 | |
| KOG4628 | 348 | consensus Predicted E3 ubiquitin ligase [Posttrans | 92.87 | |
| PF11793 | 70 | FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A. | 91.94 | |
| KOG4367 | 699 | consensus Predicted Zn-finger protein [Function un | 91.8 | |
| PF05605 | 54 | zf-Di19: Drought induced 19 protein (Di19), zinc-b | 91.34 | |
| KOG3039 | 303 | consensus Uncharacterized conserved protein [Funct | 91.31 | |
| PF04641 | 260 | Rtf2: Rtf2 RING-finger | 90.94 | |
| KOG1571 | 355 | consensus Predicted E3 ubiquitin ligase [Posttrans | 90.86 | |
| KOG0825 | 1134 | consensus PHD Zn-finger protein [General function | 89.93 | |
| KOG0804 | 493 | consensus Cytoplasmic Zn-finger protein BRAP2 (BRC | 89.68 | |
| KOG2932 | 389 | consensus E3 ubiquitin ligase involved in ubiquiti | 89.32 | |
| PF10571 | 26 | UPF0547: Uncharacterised protein family UPF0547; I | 89.01 | |
| COG5219 | 1525 | Uncharacterized conserved protein, contains RING Z | 89.0 | |
| KOG1814 | 445 | consensus Predicted E3 ubiquitin ligase [Posttrans | 88.73 | |
| KOG1645 | 463 | consensus RING-finger-containing E3 ubiquitin liga | 88.03 | |
| KOG0826 | 357 | consensus Predicted E3 ubiquitin ligase involved i | 87.38 | |
| KOG1734 | 328 | consensus Predicted RING-containing E3 ubiquitin l | 86.91 | |
| PF13909 | 24 | zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W | 86.45 | |
| PF07191 | 70 | zinc-ribbons_6: zinc-ribbons; InterPro: IPR010807 | 86.11 | |
| KOG2817 | 394 | consensus Predicted E3 ubiquitin ligase [Posttrans | 85.72 | |
| KOG3608 | 467 | consensus Zn finger proteins [General function pre | 85.14 | |
| PF07975 | 51 | C1_4: TFIIH C1-like domain; InterPro: IPR004595 Al | 84.63 | |
| COG5194 | 88 | APC11 Component of SCF ubiquitin ligase and anapha | 84.62 | |
| KOG0828 | 636 | consensus Predicted E3 ubiquitin ligase [Posttrans | 84.22 | |
| PF02891 | 50 | zf-MIZ: MIZ/SP-RING zinc finger; InterPro: IPR0041 | 84.11 | |
| KOG3161 | 861 | consensus Predicted E3 ubiquitin ligase [Posttrans | 83.89 | |
| KOG1001 | 674 | consensus Helicase-like transcription factor HLTF/ | 82.02 | |
| KOG4185 | 296 | consensus Predicted E3 ubiquitin ligase [Posttrans | 81.78 | |
| COG2888 | 61 | Predicted Zn-ribbon RNA-binding protein with a fun | 80.8 | |
| PF13913 | 25 | zf-C2HC_2: zinc-finger of a C2HC-type | 80.51 |
| >KOG3002 consensus Zn finger protein [General function prediction only] | Back alignment and domain information |
|---|
Probab=100.00 E-value=5.5e-38 Score=277.00 Aligned_cols=219 Identities=33% Similarity=0.607 Sum_probs=183.3
Q ss_pred eecCCCCeeeccCCCCCCcCceeeccCCceechhchhhcCCCCCCCCCCCccccchhHHHHhhcceecccCCCCCccccc
Q 038068 47 LTITDQDIFDCPICFEPLTVPVFQCVNGHLACSDCCAKIKRNCPTCSSPTVIVRNWAIEKVIELVQVNCKNAEYGCQQKM 126 (269)
Q Consensus 47 ~~~~~~~~l~C~iC~~~l~~Pv~~c~cgH~fC~~C~~~~~~~Cp~C~~~~~~~~~~~l~~~i~~l~v~C~~~~~GC~~~~ 126 (269)
+...+.+.|.||||.+++.+|++||..||+.|+.|..++...||.|+.+++.+|+++||++++++.|+|+|..+||++.+
T Consensus 41 ~~~~~~~lleCPvC~~~l~~Pi~QC~nGHlaCssC~~~~~~~CP~Cr~~~g~~R~~amEkV~e~~~vpC~~~~~GC~~~~ 120 (299)
T KOG3002|consen 41 VTLLDLDLLDCPVCFNPLSPPIFQCDNGHLACSSCRTKVSNKCPTCRLPIGNIRCRAMEKVAEAVLVPCKNAKLGCTKSF 120 (299)
T ss_pred ccccchhhccCchhhccCcccceecCCCcEehhhhhhhhcccCCccccccccHHHHHHHHHHHhceecccccccCCceee
Confidence 44556699999999999999999999999999999988888999999999999999999999999999999999999999
Q ss_pred cccchhhhhccCCCeeeeCCCC--CCCCccChhHHhhhhhhhCCCCcc-----ceeecceEEEEeeccCCCCCCceEEEE
Q 038068 127 SFSKKRGHEKTCQHSPLPCPLS--DCSFLGCSSQFVRHFMAKHNISAV-----PFKYNSLLNVNLNVNDINIDGKFSVLQ 199 (269)
Q Consensus 127 ~~~~~~~He~~C~~~p~~Cp~~--~C~~~g~~~~l~~Hl~~~H~~~~~-----~~~~~~~~~~~l~~~~~~~~~~~~~~~ 199 (269)
+|.+...||+.|.|+|+.||.+ .|+|.|..++|..|++..|+..++ .+.|.......+....- --++. +.
T Consensus 121 ~Y~~~~~HE~~C~f~~~~CP~p~~~C~~~G~~~~l~~H~~~~hk~~~~~~~~~~~~~~~~~~~~~~~~~~--~~~~~-~~ 197 (299)
T KOG3002|consen 121 PYGEKSKHEKVCEFRPCSCPVPGAECKYTGSYKDLYAHLNDTHKSDIITLTGFDFVFVATDENLLGAATW--TLKTS-VC 197 (299)
T ss_pred ccccccccccccccCCcCCCCCcccCCccCcHHHHHHHHHhhChhhhhhccccceecccCCccccccchh--heeee-ec
Confidence 9999999999999999999998 999999999999999999999776 33333322222221100 00211 12
Q ss_pred eeeCCCeEEEEEcCccCccceEEEEEeecCC---CCCeEEEEEEecCCeEEEEeeeeeeecc-ccCCCCCCCCC
Q 038068 200 EEKNDDVLFILNNNTGSLGNLVSVCCIASVR---KDLYYDIVARCVTGTTLKIQSSTWSSKV-RSDIPSPFGFF 269 (269)
Q Consensus 200 ~~~~~~~lF~l~~~~~~~g~~v~v~ci~~~~---~~f~Y~l~~~~~~~~~l~~~s~~~~~~~-~~~~~~~~~~~ 269 (269)
.+..++.+|.++...++.|.+++|++|.|.+ .+|+|+|.+. +++++|+|||.++|+.+ ++...|..+|+
T Consensus 198 ~~~~~~~~~~~q~~~~~~~~y~tv~~i~~~~~e~~~fsy~L~~~-~~~~klt~~s~~~s~~~kvs~~~p~~dfm 270 (299)
T KOG3002|consen 198 FGREFGLLFEVQCFREPHGVYVTVNRIAPSAPEAGEFSYSLALG-GSGRKLTWQSPPRSIIQKVSKVRPEDDFM 270 (299)
T ss_pred CcEEEeeeeeehhhcCCCceEEEeehhccCCCcccccceeeecC-CCCceEeecCCcceeecccceeccCCCce
Confidence 3346678888888888889999999998876 8899999999 89999999999999975 55466666654
|
|
| >PF03145 Sina: Seven in absentia protein family; InterPro: IPR018121 The seven in absentia (sina) gene was first identified in Drosophila | Back alignment and domain information |
|---|
| >KOG0297 consensus TNF receptor-associated factor [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd03829 Sina Seven in absentia (Sina) protein family, C-terminal substrate binding domain; composed of the Drosophila Sina protein, the mammalian Sina homolog (Siah), the plant protein SINAT5, and similar proteins | Back alignment and domain information |
|---|
| >PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A | Back alignment and domain information |
|---|
| >KOG0823 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0320 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF14835 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM7_B | Back alignment and domain information |
|---|
| >PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional | Back alignment and domain information |
|---|
| >smart00504 Ubox Modified RING finger domain | Back alignment and domain information |
|---|
| >PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A | Back alignment and domain information |
|---|
| >KOG0287 consensus Postreplication repair protein RAD18 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A | Back alignment and domain information |
|---|
| >PF02176 zf-TRAF: TRAF-type zinc finger; PDB: 2EOD_A 2YUC_A 3HCU_A 3HCS_B 3HCT_A | Back alignment and domain information |
|---|
| >KOG0317 consensus Predicted E3 ubiquitin ligase, integral peroxisomal membrane protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR00599 rad18 DNA repair protein rad18 | Back alignment and domain information |
|---|
| >PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A | Back alignment and domain information |
|---|
| >PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >PF04564 U-box: U-box domain; InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis | Back alignment and domain information |
|---|
| >PHA02929 N1R/p28-like protein; Provisional | Back alignment and domain information |
|---|
| >PF14634 zf-RING_5: zinc-RING finger domain | Back alignment and domain information |
|---|
| >cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) | Back alignment and domain information |
|---|
| >COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A | Back alignment and domain information |
|---|
| >COG5574 PEX10 RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG2164 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PHA02926 zinc finger-like protein; Provisional | Back alignment and domain information |
|---|
| >smart00184 RING Ring finger | Back alignment and domain information |
|---|
| >PF02176 zf-TRAF: TRAF-type zinc finger; PDB: 2EOD_A 2YUC_A 3HCU_A 3HCS_B 3HCT_A | Back alignment and domain information |
|---|
| >TIGR00570 cdk7 CDK-activating kinase assembly factor MAT1 | Back alignment and domain information |
|---|
| >KOG0311 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >KOG2177 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF07800 DUF1644: Protein of unknown function (DUF1644); InterPro: IPR012866 This family consists of sequences found in a number of hypothetical plant proteins of unknown function | Back alignment and domain information |
|---|
| >PLN03086 PRLI-interacting factor K; Provisional | Back alignment and domain information |
|---|
| >PLN03086 PRLI-interacting factor K; Provisional | Back alignment and domain information |
|---|
| >COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only] | Back alignment and domain information |
|---|
| >PF11789 zf-Nse: Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C | Back alignment and domain information |
|---|
| >KOG2879 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1813 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4159 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG2660 consensus Locus-specific chromosome binding proteins [Function unknown] | Back alignment and domain information |
|---|
| >PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger | Back alignment and domain information |
|---|
| >KOG4265 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4739 consensus Uncharacterized protein involved in synaptonemal complex formation [Cell cycle control, cell division, chromosome partitioning; General function prediction only] | Back alignment and domain information |
|---|
| >KOG0802 consensus E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF14570 zf-RING_4: RING/Ubox like zinc-binding domain; PDB: 1E4U_A 1UR6_B | Back alignment and domain information |
|---|
| >KOG4172 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG5540 RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG5222 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0824 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1785 consensus Tyrosine kinase negative regulator CBL [Defense mechanisms] | Back alignment and domain information |
|---|
| >COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
| >COG5175 MOT2 Transcriptional repressor [Transcription] | Back alignment and domain information |
|---|
| >PF05290 Baculo_IE-1: Baculovirus immediate-early protein (IE-0); InterPro: IPR007954 This entry contains the Baculovirus immediate-early protein IE-0 | Back alignment and domain information |
|---|
| >KOG4275 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF14447 Prok-RING_4: Prokaryotic RING finger family 4 | Back alignment and domain information |
|---|
| >KOG4692 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1002 consensus Nucleotide excision repair protein RAD16 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG1039 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4628 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF11793 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A | Back alignment and domain information |
|---|
| >KOG4367 consensus Predicted Zn-finger protein [Function unknown] | Back alignment and domain information |
|---|
| >PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins | Back alignment and domain information |
|---|
| >KOG3039 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF04641 Rtf2: Rtf2 RING-finger | Back alignment and domain information |
|---|
| >KOG1571 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0825 consensus PHD Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2932 consensus E3 ubiquitin ligase involved in ubiquitination of E-cadherin complex [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF10571 UPF0547: Uncharacterised protein family UPF0547; InterPro: IPR018886 This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines | Back alignment and domain information |
|---|
| >COG5219 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1814 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1645 consensus RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0826 consensus Predicted E3 ubiquitin ligase involved in peroxisome organization [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1734 consensus Predicted RING-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF13909 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W_A | Back alignment and domain information |
|---|
| >PF07191 zinc-ribbons_6: zinc-ribbons; InterPro: IPR010807 This family consists of several short, hypothetical bacterial proteins of around 70 residues in length | Back alignment and domain information |
|---|
| >KOG2817 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG3608 consensus Zn finger proteins [General function prediction only] | Back alignment and domain information |
|---|
| >PF07975 C1_4: TFIIH C1-like domain; InterPro: IPR004595 All proteins in this domain for which functions are known are components of the TFIIH complex which is involved in the initiation of transcription and nucleotide excision repair | Back alignment and domain information |
|---|
| >COG5194 APC11 Component of SCF ubiquitin ligase and anaphase-promoting complex [Posttranslational modification, protein turnover, chaperones / Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0828 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF02891 zf-MIZ: MIZ/SP-RING zinc finger; InterPro: IPR004181 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >KOG3161 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1001 consensus Helicase-like transcription factor HLTF/DNA helicase RAD5, DEAD-box superfamily [Transcription; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG4185 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG2888 Predicted Zn-ribbon RNA-binding protein with a function in translation [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PF13913 zf-C2HC_2: zinc-finger of a C2HC-type | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 269 | |||
| 2a25_A | 193 | Ubiquitin ligase SIAH1; protein-peptide complex, l | 1e-16 | |
| 3hct_A | 118 | TNF receptor-associated factor 6; cross-brace, bet | 8e-14 | |
| 3knv_A | 141 | TNF receptor-associated factor 2; cross-brace, alt | 2e-10 | |
| 3hcs_A | 170 | TNF receptor-associated factor 6; cross-brace, bet | 4e-10 | |
| 1rmd_A | 116 | RAG1; V(D)J recombination, antibody, MAD, ring fin | 8e-08 | |
| 4epo_C | 149 | E3 ubiquitin-protein ligase RNF8; coiled-coil, E3 | 8e-07 | |
| 3lrq_A | 100 | E3 ubiquitin-protein ligase TRIM37; structural gen | 4e-06 | |
| 1jm7_B | 117 | BARD1, BRCA1-associated ring domain protein 1; rin | 1e-05 | |
| 2y43_A | 99 | E3 ubiquitin-protein ligase RAD18; DNA repair, met | 3e-05 | |
| 2csy_A | 81 | Zinc finger protein 183-like 1; ring finger protei | 3e-05 | |
| 2d8t_A | 71 | Dactylidin, ring finger protein 146; RNF146, ring | 5e-05 | |
| 2ecy_A | 66 | TNF receptor-associated factor 3; metal binding pr | 2e-04 | |
| 1e4u_A | 78 | Transcriptional repressor NOT4; gene regulation, t | 2e-04 | |
| 1bor_A | 56 | Transcription factor PML; proto-oncogene, nuclear | 2e-04 | |
| 1z6u_A | 150 | NP95-like ring finger protein isoform B; structura | 3e-04 |
| >2a25_A Ubiquitin ligase SIAH1; protein-peptide complex, ligase; 2.20A {Homo sapiens} PDB: 2an6_A 1k2f_A Length = 193 | Back alignment and structure |
|---|
Score = 74.8 bits (183), Expect = 1e-16
Identities = 28/157 (17%), Positives = 58/157 (36%), Gaps = 12/157 (7%)
Query: 107 VIELVQVNCKNAEYGCQQKMSFSKKRGHEKTCQHSPLPC--PLSDCSFLGCSSQFVRHFM 164
V V CK A GC+ + ++K HE+ C+ P C P + C + G + H M
Sbjct: 1 VANSVLFPCKYASSGCEITLPHTEKADHEELCEFRPYSCPCPGASCKWQGSLDAVMPHLM 60
Query: 165 AKH-NISAVPFKYNSLLNVNLNVNDINIDGKFSVLQEEKNDDVLFILNNNTGSLGNLVSV 223
+H +I+ + + L ++N+ + ++Q + +L G+
Sbjct: 61 HQHKSITTLQGEDIVFLATDINLPGAV---DWVMMQSCFGFHFMLVLEKQEKYDGHQQFF 117
Query: 224 CCI-----ASVRKDLYYDIVARCVTGTTLKIQSSTWS 255
+ ++ Y + L +++ S
Sbjct: 118 AIVQLIGTRKQAENFAYRLELNG-HRRRLTWEATPRS 153
|
| >3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Length = 118 | Back alignment and structure |
|---|
| >3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Length = 141 | Back alignment and structure |
|---|
| >3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Length = 170 | Back alignment and structure |
|---|
| >1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Length = 116 | Back alignment and structure |
|---|
| >4epo_C E3 ubiquitin-protein ligase RNF8; coiled-coil, E3 ubiquitin ligase, protein binding complex; 4.80A {Homo sapiens} Length = 149 | Back alignment and structure |
|---|
| >3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Length = 100 | Back alignment and structure |
|---|
| >1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 117 | Back alignment and structure |
|---|
| >2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Length = 99 | Back alignment and structure |
|---|
| >2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 | Back alignment and structure |
|---|
| >2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 71 | Back alignment and structure |
|---|
| >2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 66 | Back alignment and structure |
|---|
| >1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Length = 78 | Back alignment and structure |
|---|
| >1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 56 | Back alignment and structure |
|---|
| >1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Length = 150 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 269 | |||
| 2a25_A | 193 | Ubiquitin ligase SIAH1; protein-peptide complex, l | 99.95 | |
| 3hcs_A | 170 | TNF receptor-associated factor 6; cross-brace, bet | 99.91 | |
| 3hct_A | 118 | TNF receptor-associated factor 6; cross-brace, bet | 99.73 | |
| 3knv_A | 141 | TNF receptor-associated factor 2; cross-brace, alt | 99.68 | |
| 1rmd_A | 116 | RAG1; V(D)J recombination, antibody, MAD, ring fin | 99.67 | |
| 1t1h_A | 78 | Gspef-atpub14, armadillo repeat containing protein | 99.13 | |
| 3ztg_A | 92 | E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR | 99.12 | |
| 2kr4_A | 85 | Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri | 99.05 | |
| 1wgm_A | 98 | Ubiquitin conjugation factor E4A; ubiquitinating e | 99.05 | |
| 2djb_A | 72 | Polycomb group ring finger protein 6; PCGF6, ring | 99.03 | |
| 2y43_A | 99 | E3 ubiquitin-protein ligase RAD18; DNA repair, met | 99.01 | |
| 2csy_A | 81 | Zinc finger protein 183-like 1; ring finger protei | 99.0 | |
| 3lrq_A | 100 | E3 ubiquitin-protein ligase TRIM37; structural gen | 99.0 | |
| 2egp_A | 79 | Tripartite motif-containing protein 34; ZF-C3HC4 d | 98.99 | |
| 2kre_A | 100 | Ubiquitin conjugation factor E4 B; U-box domain, E | 98.97 | |
| 2ckl_A | 108 | Polycomb group ring finger protein 4; BMI1, RING1B | 98.97 | |
| 4ayc_A | 138 | E3 ubiquitin-protein ligase RNF8; DNA damage, K63 | 98.96 | |
| 3fl2_A | 124 | E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA | 98.96 | |
| 1jm7_B | 117 | BARD1, BRCA1-associated ring domain protein 1; rin | 98.94 | |
| 2ecy_A | 66 | TNF receptor-associated factor 3; metal binding pr | 98.93 | |
| 2ecv_A | 85 | Tripartite motif-containing protein 5; metal bindi | 98.92 | |
| 1bor_A | 56 | Transcription factor PML; proto-oncogene, nuclear | 98.92 | |
| 2yur_A | 74 | Retinoblastoma-binding protein 6; P53-associated c | 98.92 | |
| 2ecw_A | 85 | Tripartite motif-containing protein 30; metal bind | 98.91 | |
| 1z6u_A | 150 | NP95-like ring finger protein isoform B; structura | 98.91 | |
| 2d8t_A | 71 | Dactylidin, ring finger protein 146; RNF146, ring | 98.9 | |
| 2ckl_B | 165 | Ubiquitin ligase protein RING2; BMI1, RING1B, poly | 98.88 | |
| 2ysl_A | 73 | Tripartite motif-containing protein 31; ring-type | 98.86 | |
| 2yu4_A | 94 | E3 SUMO-protein ligase NSE2; SP-ring domain, struc | 98.82 | |
| 2ea6_A | 69 | Ring finger protein 4; RNF4, RES4-26, ring domain, | 98.8 | |
| 2c2l_A | 281 | CHIP, carboxy terminus of HSP70-interacting protei | 98.8 | |
| 2ysj_A | 63 | Tripartite motif-containing protein 31; ring-type | 98.79 | |
| 3l11_A | 115 | E3 ubiquitin-protein ligase RNF168; E3 ligase, rin | 98.78 | |
| 1jm7_A | 112 | BRCA1, breast cancer type 1 susceptibility protein | 98.76 | |
| 3ng2_A | 71 | RNF4, snurf, ring finger protein 4; ring domain, E | 98.75 | |
| 1chc_A | 68 | Equine herpes virus-1 ring domain; viral protein; | 98.74 | |
| 2ct2_A | 88 | Tripartite motif protein 32; zinc-finger protein H | 98.74 | |
| 1g25_A | 65 | CDK-activating kinase assembly factor MAT1; ring f | 98.73 | |
| 2ecj_A | 58 | Tripartite motif-containing protein 39; TRIM39, ri | 98.72 | |
| 2f42_A | 179 | STIP1 homology and U-box containing protein 1; cha | 98.69 | |
| 2xeu_A | 64 | Ring finger protein 4; transcription, zinc-finger, | 98.69 | |
| 2ect_A | 78 | Ring finger protein 126; metal binding protein, st | 98.65 | |
| 1iym_A | 55 | EL5; ring-H2 finger, ubiquitin ligase, DNA binding | 98.65 | |
| 2ecm_A | 55 | Ring finger and CHY zinc finger domain- containing | 98.64 | |
| 4ic3_A | 74 | E3 ubiquitin-protein ligase XIAP; ring domain, zin | 98.63 | |
| 2ep4_A | 74 | Ring finger protein 24; zinc binding, ubiquitin, E | 98.62 | |
| 1e4u_A | 78 | Transcriptional repressor NOT4; gene regulation, t | 98.61 | |
| 2ecn_A | 70 | Ring finger protein 141; RNF141, ring domain, zinc | 98.6 | |
| 2kiz_A | 69 | E3 ubiquitin-protein ligase arkadia; ring-H2 finge | 98.59 | |
| 1x4j_A | 75 | Ring finger protein 38; structural genomics, NPPSF | 98.57 | |
| 2l0b_A | 91 | E3 ubiquitin-protein ligase praja-1; zinc finger, | 98.57 | |
| 3htk_C | 267 | E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- | 98.56 | |
| 2ecg_A | 75 | Baculoviral IAP repeat-containing protein 4; BIRC4 | 98.52 | |
| 2ea5_A | 68 | Cell growth regulator with ring finger domain prot | 98.49 | |
| 4ap4_A | 133 | E3 ubiquitin ligase RNF4; ligase-signalling protei | 98.45 | |
| 2ecl_A | 81 | Ring-box protein 2; RNF7, ring domian, zinc-bindin | 98.43 | |
| 2yho_A | 79 | E3 ubiquitin-protein ligase mylip; ligase, E2 liga | 98.36 | |
| 1v87_A | 114 | Deltex protein 2; ring-H2 domain, zinc-binding dom | 98.32 | |
| 2vje_A | 64 | E3 ubiquitin-protein ligase MDM2; proto-oncogene, | 98.25 | |
| 4ap4_A | 133 | E3 ubiquitin ligase RNF4; ligase-signalling protei | 98.2 | |
| 2y1n_A | 389 | E3 ubiquitin-protein ligase; ligase-transferase co | 98.15 | |
| 2vje_B | 63 | MDM4 protein; proto-oncogene, phosphorylation, alt | 98.14 | |
| 3t6p_A | 345 | Baculoviral IAP repeat-containing protein 2; ring, | 98.13 | |
| 3dpl_R | 106 | Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST | 98.1 | |
| 2yuc_A | 76 | TNF receptor-associated factor 4; ZF-TRAF, cystein | 98.03 | |
| 2yre_A | 100 | F-box only protein 30; zinc binding, E3 ubiquitin | 98.02 | |
| 2yre_A | 100 | F-box only protein 30; zinc binding, E3 ubiquitin | 98.01 | |
| 2bay_A | 61 | PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l | 98.0 | |
| 1wim_A | 94 | KIAA0161 protein; ring finger domain, UBCM4-intera | 97.95 | |
| 2yuc_A | 76 | TNF receptor-associated factor 4; ZF-TRAF, cystein | 97.92 | |
| 4a0k_B | 117 | E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi | 97.79 | |
| 3vk6_A | 101 | E3 ubiquitin-protein ligase hakai; HYB, phosphotyr | 97.75 | |
| 3hcs_A | 170 | TNF receptor-associated factor 6; cross-brace, bet | 97.53 | |
| 2d8s_A | 80 | Cellular modulator of immune recognition; C-MIR, m | 97.02 | |
| 2d9k_A | 75 | FLN29 gene product; zinc finger, ZF-TRAF, structur | 96.89 | |
| 2ct0_A | 74 | Non-SMC element 1 homolog; ring domain, structural | 96.57 | |
| 3k1l_B | 381 | Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A | 95.91 | |
| 2jun_A | 101 | Midline-1; B-BOX, TRIM, ring finger, alternative s | 95.04 | |
| 2d9k_A | 75 | FLN29 gene product; zinc finger, ZF-TRAF, structur | 94.1 | |
| 3hct_A | 118 | TNF receptor-associated factor 6; cross-brace, bet | 93.06 | |
| 2eod_A | 66 | TNF receptor-associated factor 4; zinc binding, NF | 92.79 | |
| 1rmd_A | 116 | RAG1; V(D)J recombination, antibody, MAD, ring fin | 91.36 | |
| 2cs3_A | 93 | Protein C14ORF4, MY039 protein; ZF-C3HC4 domain, s | 90.48 | |
| 1vyx_A | 60 | ORF K3, K3RING; zinc-binding protein, ring domain, | 87.21 | |
| 2ct7_A | 86 | Ring finger protein 31; IBR, structural genomics, | 86.92 | |
| 2i13_A | 190 | AART; DNA binding, zinc finger, DNA binding protei | 86.66 | |
| 2cup_A | 101 | Skeletal muscle LIM-protein 1; four and half LIM d | 86.45 | |
| 2yt9_A | 95 | Zinc finger-containing protein 1; C2H2, structural | 86.04 | |
| 2dlq_A | 124 | GLI-kruppel family member HKR3; ZF-C2H2 domain, st | 86.02 | |
| 1wfh_A | 64 | Zinc finger (AN1-like) family protein; ZF-AN1 doma | 85.02 | |
| 1wfp_A | 74 | Zinc finger (AN1-like) family protein; ZF-AN1 doma | 83.77 | |
| 2dlq_A | 124 | GLI-kruppel family member HKR3; ZF-C2H2 domain, st | 83.73 | |
| 2gli_A | 155 | Protein (five-finger GLI); protein/DNA complex, tr | 83.55 | |
| 2dlk_A | 79 | Novel protein; ZF-C2H2 domain, zinc finger protein | 83.2 | |
| 2rpc_A | 155 | Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr | 83.04 | |
| 3nw0_A | 238 | Non-structural maintenance of chromosomes element | 82.98 | |
| 2xqn_T | 126 | Testin, TESS; metal-binding protein, cytoskeleton, | 82.21 | |
| 2eod_A | 66 | TNF receptor-associated factor 4; zinc binding, NF | 82.21 | |
| 3m62_A | 968 | Ubiquitin conjugation factor E4; armadillo-like re | 82.1 | |
| 1wg2_A | 64 | Zinc finger (AN1-like) family protein; riken struc | 81.47 | |
| 1wfl_A | 74 | Zinc finger protein 216; ZF-AN1 domain, zinc bindi | 81.43 | |
| 3knv_A | 141 | TNF receptor-associated factor 2; cross-brace, alt | 81.03 | |
| 2j7j_A | 85 | Transcription factor IIIA; zinc finger module, alt | 80.9 | |
| 1z60_A | 59 | TFIIH basal transcription factor complex P44 subun | 80.39 | |
| 1wjp_A | 107 | Zinc finger protein 295; ZF-C2H2 domain, zinc bind | 80.34 | |
| 2dmd_A | 96 | Zinc finger protein 64, isoforms 1 and 2; ZNF338, | 80.01 |
| >2a25_A Ubiquitin ligase SIAH1; protein-peptide complex, ligase; 2.20A {Homo sapiens} PDB: 2an6_A 1k2f_A | Back alignment and structure |
|---|
Probab=99.95 E-value=4.3e-29 Score=208.76 Aligned_cols=158 Identities=20% Similarity=0.331 Sum_probs=86.4
Q ss_pred HhhcceecccCCCCCccccccccchhhhhccCCCeeeeCCCCC--CCCccChhHHhhhhhhhCCCCccceeecceEEEEe
Q 038068 107 VIELVQVNCKNAEYGCQQKMSFSKKRGHEKTCQHSPLPCPLSD--CSFLGCSSQFVRHFMAKHNISAVPFKYNSLLNVNL 184 (269)
Q Consensus 107 ~i~~l~v~C~~~~~GC~~~~~~~~~~~He~~C~~~p~~Cp~~~--C~~~g~~~~l~~Hl~~~H~~~~~~~~~~~~~~~~l 184 (269)
+++++++||+|+.+||.+.++|.++..||++|+|+|+.||.++ |+|.|..++|..|+...|.|..+ . .+..+ +.+
T Consensus 1 v~~s~~~pC~~~~~GC~~~~~y~~~~~He~~C~f~p~~Cp~~g~~C~~~G~~~~l~~H~~~~H~~~~~-~-~g~~i-~f~ 77 (193)
T 2a25_A 1 VANSVLFPCKYASSGCEITLPHTEKADHEELCEFRPYSCPCPGASCKWQGSLDAVMPHLMHQHKSITT-L-QGEDI-VFL 77 (193)
T ss_dssp -----------------------------------CEECCCC--CCCCEECSTTHHHHHHHHCTTSCE-E-ESSEE-EEE
T ss_pred CccceEecCCCCCCCCCcccccccccchhhcCCCCCccCCCCCCCCcCCCCHHHHHHHHHHHCCCcce-e-cCceE-EEE
Confidence 4678999999999999999999999999999999999999976 99999999999999999998432 1 11111 122
Q ss_pred eccCCCCCCceEEEEeeeCCCeEEEEEcCccC--cc---ceEEEEEeecCC--CCCeEEEEEEecCCeEEEEeeeeeeec
Q 038068 185 NVNDINIDGKFSVLQEEKNDDVLFILNNNTGS--LG---NLVSVCCIASVR--KDLYYDIVARCVTGTTLKIQSSTWSSK 257 (269)
Q Consensus 185 ~~~~~~~~~~~~~~~~~~~~~~lF~l~~~~~~--~g---~~v~v~ci~~~~--~~f~Y~l~~~~~~~~~l~~~s~~~~~~ 257 (269)
..+ .++++...|++...++++.|+|+..... .| .+|+|+||||.+ .+|+|+|++. +++|+|+||+++++++
T Consensus 78 ~~~-~~l~~~~~~~~v~~~~g~~Fll~~~~~~~~~g~~~~~~~V~~ig~~~ea~~f~Y~l~~~-~~~r~L~~~~~~~s~~ 155 (193)
T 2a25_A 78 ATD-INLPGAVDWVMMQSCFGFHFMLVLEKQEKYDGHQQFFAIVQLIGTRKQAENFAYRLELN-GHRRRLTWEATPRSIH 155 (193)
T ss_dssp EEC-CC----CEEEEEEEETTEEEEEEEEEC------CEEEEEEEESSCHHHHTTEEEEEEEE-ETTEEEEEEECCEETT
T ss_pred ecc-cccccceeEEEEEEecCceEEEEEEEeccCCCCcEEEEEEEEeCCcchhcceEEEEEEE-cCCCEEEEEEEEEehh
Confidence 222 2334444454444578999999865443 34 257999999976 9999999999 8999999999999997
Q ss_pred c-ccCCCCCCCCC
Q 038068 258 V-RSDIPSPFGFF 269 (269)
Q Consensus 258 ~-~~~~~~~~~~~ 269 (269)
+ ..+..++.+||
T Consensus 156 e~~~~~~~~~d~L 168 (193)
T 2a25_A 156 EGIATAIMNSDCL 168 (193)
T ss_dssp TCSHHHHHTTCSE
T ss_pred hcccccccCCCEE
Confidence 5 55556656554
|
| >3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A | Back alignment and structure |
|---|
| >3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 | Back alignment and structure |
|---|
| >1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 | Back alignment and structure |
|---|
| >3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 | Back alignment and structure |
|---|
| >2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} | Back alignment and structure |
|---|
| >2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B | Back alignment and structure |
|---|
| >2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A | Back alignment and structure |
|---|
| >4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C | Back alignment and structure |
|---|
| >3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} | Back alignment and structure |
|---|
| >1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B | Back alignment and structure |
|---|
| >2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 | Back alignment and structure |
|---|
| >2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens} | Back alignment and structure |
|---|
| >1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} | Back alignment and structure |
|---|
| >1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C | Back alignment and structure |
|---|
| >2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} | Back alignment and structure |
|---|
| >2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A | Back alignment and structure |
|---|
| >4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A | Back alignment and structure |
|---|
| >2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B | Back alignment and structure |
|---|
| >2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A | Back alignment and structure |
|---|
| >1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A | Back alignment and structure |
|---|
| >4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* | Back alignment and structure |
|---|
| >2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* | Back alignment and structure |
|---|
| >3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A 4auq_B | Back alignment and structure |
|---|
| >3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A | Back alignment and structure |
|---|
| >2yuc_A TNF receptor-associated factor 4; ZF-TRAF, cysteine-rich domain associated with ring and TRAF domains protein 1, malignant 62; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yre_A F-box only protein 30; zinc binding, E3 ubiquitin ligase, SCF, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yre_A F-box only protein 30; zinc binding, E3 ubiquitin ligase, SCF, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A | Back alignment and structure |
|---|
| >1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2yuc_A TNF receptor-associated factor 4; ZF-TRAF, cysteine-rich domain associated with ring and TRAF domains protein 1, malignant 62; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} | Back alignment and structure |
|---|
| >3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} | Back alignment and structure |
|---|
| >3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >2jun_A Midline-1; B-BOX, TRIM, ring finger, alternative splicing, coiled coil, cytoplasm, cytoskeleton, disease mutation, ligase, metal-binding; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A | Back alignment and structure |
|---|
| >2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 | Back alignment and structure |
|---|
| >2cs3_A Protein C14ORF4, MY039 protein; ZF-C3HC4 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.44.1.3 | Back alignment and structure |
|---|
| >1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 | Back alignment and structure |
|---|
| >2ct7_A Ring finger protein 31; IBR, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.44.1.4 | Back alignment and structure |
|---|
| >2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* | Back alignment and structure |
|---|
| >2cup_A Skeletal muscle LIM-protein 1; four and half LIM domains protein 1, LIM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >1wfh_A Zinc finger (AN1-like) family protein; ZF-AN1 domain, zinc binding, structural genomics, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} SCOP: g.80.1.1 | Back alignment and structure |
|---|
| >1wfp_A Zinc finger (AN1-like) family protein; ZF-AN1 domain, zinc binding, structural genomics, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} SCOP: g.80.1.1 | Back alignment and structure |
|---|
| >2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} | Back alignment and structure |
|---|
| >2xqn_T Testin, TESS; metal-binding protein, cytoskeleton, focal adhesion, acrosom; 2.62A {Homo sapiens} | Back alignment and structure |
|---|
| >2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3m62_A Ubiquitin conjugation factor E4; armadillo-like repeats, UBL conjugation pathway, DNA damage, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} PDB: 3m63_A* 2qiz_A 2qj0_A | Back alignment and structure |
|---|
| >1wg2_A Zinc finger (AN1-like) family protein; riken structural genomics/proteomics initiative, RSGI, structural genomics, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.80.1.1 | Back alignment and structure |
|---|
| >1wfl_A Zinc finger protein 216; ZF-AN1 domain, zinc binding, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.80.1.1 | Back alignment and structure |
|---|
| >3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A | Back alignment and structure |
|---|
| >1z60_A TFIIH basal transcription factor complex P44 subunit; basic transcription factor, zinc binding protein, ring finger; NMR {Homo sapiens} SCOP: g.49.1.2 | Back alignment and structure |
|---|
| >1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 269 | ||||
| d1k2fa_ | 190 | b.8.1.2 (A:) SIAH, seven in absentia homolog {Mous | 2e-17 | |
| d1bora_ | 56 | g.44.1.1 (A:) Acute promyelocytic leukaemia proto- | 9e-06 | |
| d1jm7b_ | 97 | g.44.1.1 (B:) bard1 RING domain {Human (Homo sapie | 3e-05 | |
| d1jm7a_ | 103 | g.44.1.1 (A:) brca1 RING domain {Human (Homo sapie | 2e-04 | |
| d1chca_ | 68 | g.44.1.1 (A:) Immediate early protein, IEEHV {Equi | 2e-04 | |
| d1fbva4 | 79 | g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [Ta | 0.002 | |
| d1rmda2 | 86 | g.44.1.1 (A:1-86) V(D)J recombination activating p | 0.003 |
| >d1k2fa_ b.8.1.2 (A:) SIAH, seven in absentia homolog {Mouse (Mus musculus) [TaxId: 10090]} Length = 190 | Back information, alignment and structure |
|---|
class: All beta proteins fold: TRAF domain-like superfamily: TRAF domain-like family: SIAH, seven in absentia homolog domain: SIAH, seven in absentia homolog species: Mouse (Mus musculus) [TaxId: 10090]
Score = 76.2 bits (187), Expect = 2e-17
Identities = 30/165 (18%), Positives = 57/165 (34%), Gaps = 16/165 (9%)
Query: 111 VQVNCKNAEYGCQQKMSFSKKRGHEKTCQHSPLPC--PLSDCSFLGCSSQFVRHFMAKHN 168
V CK A GC+ + ++K HE+ C+ P C P + C + G + H M +H
Sbjct: 2 VLFPCKYASSGCEITLPHTEKAEHEELCEFRPYSCPCPGASCKWQGSLDAVMPHLMHQHK 61
Query: 169 ISAVPFKYNSLLNVNLNVNDINIDGKFSVLQEEKNDDVLFILNNNTGSLGN----LVSVC 224
++ DIN+ G + + F+L + ++
Sbjct: 62 SITTLQGE----DIVFLATDINLPGAVDWVMMQSCFGFHFMLVLEKQEKYDGHQQFFAIV 117
Query: 225 CIASVRKD---LYYDIVARCVTGTTLKIQSSTWS--SKVRSDIPS 264
+ RK Y + L +++ S + + I +
Sbjct: 118 QLIGTRKQAENFAYRLELN-GHRRRLTWEATPRSIHEGIATAIMN 161
|
| >d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Length = 56 | Back information, alignment and structure |
|---|
| >d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 97 | Back information, alignment and structure |
|---|
| >d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 103 | Back information, alignment and structure |
|---|
| >d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Length = 68 | Back information, alignment and structure |
|---|
| >d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Length = 79 | Back information, alignment and structure |
|---|
| >d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 269 | |||
| d1k2fa_ | 190 | SIAH, seven in absentia homolog {Mouse (Mus muscul | 99.94 | |
| d2c2la2 | 80 | STIP1 homology and U box-containing protein 1, STU | 99.19 | |
| d1jm7b_ | 97 | bard1 RING domain {Human (Homo sapiens) [TaxId: 96 | 99.19 | |
| d1t1ha_ | 78 | E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi | 99.16 | |
| d1bora_ | 56 | Acute promyelocytic leukaemia proto-oncoprotein PM | 99.1 | |
| d1rmda2 | 86 | V(D)J recombination activating protein 1 (RAG1), d | 99.09 | |
| d1jm7a_ | 103 | brca1 RING domain {Human (Homo sapiens) [TaxId: 96 | 99.03 | |
| d1wgma_ | 98 | Ubiquitin conjugation factor E4A {Human (Homo sapi | 98.99 | |
| d2baya1 | 56 | Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac | 98.94 | |
| d1chca_ | 68 | Immediate early protein, IEEHV {Equine herpesvirus | 98.9 | |
| d1fbva4 | 79 | CBL {Human (Homo sapiens) [TaxId: 9606]} | 98.81 | |
| d1ur6b_ | 52 | Not-4 N-terminal RING finger domain {Human (Homo s | 98.75 | |
| d1g25a_ | 65 | TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 | 98.69 | |
| d1iyma_ | 55 | EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 | 98.64 | |
| d1v87a_ | 114 | Deltex protein 2 RING-H2 domain {Mouse (Mus muscul | 98.22 | |
| d3dplr1 | 88 | RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase | 98.1 | |
| d1vyxa_ | 60 | IE1B protein (ORF K3), N-terminal domain {Kaposi's | 97.87 | |
| d1wima_ | 94 | UbcM4-interacting protein 4 (KIAA0161) {Human (Hom | 97.11 | |
| d1wfpa_ | 74 | Zinc finger A20 and AN1 domains containing protein | 93.92 | |
| d1ubdc4 | 28 | Ying-yang 1 (yy1, zinc finger domain) {Human (Homo | 92.26 | |
| d1zfda_ | 32 | SWI5 zinc-finger domains {Baker's yeast (Saccharom | 92.12 | |
| d1a1ia1 | 29 | ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} | 91.65 | |
| d1sp2a_ | 31 | Transcription factor sp1 {Human (Homo sapiens) [Ta | 91.16 | |
| d1ubdc3 | 30 | Ying-yang 1 (yy1, zinc finger domain) {Human (Homo | 90.97 | |
| d2glia3 | 30 | Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 | 90.62 | |
| d1wfla_ | 74 | Zinc finger A20 domain containing protein 2 {Mouse | 89.71 | |
| d1wffa_ | 85 | ANUBL1 (AN1, ubiquitin-like, homolog) {Mouse (Mus | 88.15 | |
| d1z60a1 | 59 | TFIIH p44 subunit cysteine-rich domain {Human (Hom | 87.45 | |
| d1wfha_ | 64 | Zinc finger A20 and AN1 domains containing protein | 84.73 | |
| d2cs3a1 | 80 | Protein c14orf4 (KIAA1865) {Human (Homo sapiens) [ | 84.24 | |
| d2glia5 | 29 | Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 | 82.91 | |
| d1ncsa_ | 47 | SWI5 zinc-finger domains {Baker's yeast (Saccharom | 82.71 | |
| d2jnea1 | 71 | Hypothetical protein YfgJ {Escherichia coli [TaxId | 81.65 | |
| d2ct7a1 | 73 | Ring finger protein 31 {Human (Homo sapiens) [TaxI | 81.05 |
| >d1k2fa_ b.8.1.2 (A:) SIAH, seven in absentia homolog {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
class: All beta proteins fold: TRAF domain-like superfamily: TRAF domain-like family: SIAH, seven in absentia homolog domain: SIAH, seven in absentia homolog species: Mouse (Mus musculus) [TaxId: 10090]
Probab=99.94 E-value=9e-28 Score=198.33 Aligned_cols=154 Identities=18% Similarity=0.256 Sum_probs=122.1
Q ss_pred cceecccCCCCCccccccccchhhhhccCCCeeeeCCCC--CCCCccChhHHhhhhhhhCCCCccceeecceEEEEeecc
Q 038068 110 LVQVNCKNAEYGCQQKMSFSKKRGHEKTCQHSPLPCPLS--DCSFLGCSSQFVRHFMAKHNISAVPFKYNSLLNVNLNVN 187 (269)
Q Consensus 110 ~l~v~C~~~~~GC~~~~~~~~~~~He~~C~~~p~~Cp~~--~C~~~g~~~~l~~Hl~~~H~~~~~~~~~~~~~~~~l~~~ 187 (269)
++.+||+|+.+||.++++|.++..||++|+|+|+.||.+ +|+|+|...+|..|++..|++..+.+.++..+.....
T Consensus 1 Sv~~pC~~~~~GC~~~~~~~~~~~HE~~C~~~p~~C~~~~~~C~~~G~~~~l~~Hl~~~H~~~~~~~~~~~~~~~~~~-- 78 (190)
T d1k2fa_ 1 SVLFPCKYASSGCEITLPHTEKAEHEELCEFRPYSCPCPGASCKWQGSLDAVMPHLMHQHKSITTLQGEDIVFLATDI-- 78 (190)
T ss_dssp CCCCCCTTGGGTCCCCCCGGGHHHHHHTCTTSCEECCSSSTTCCCEECHHHHHHHHHHSSCCCEEEESSEEEEEECCT--
T ss_pred CeeEecCCCCCCCCEeccccchhhHHhcCCCcccCCCCCCCCCccCCCHhHHHHHHHhcCCcccccCccceEEeeecc--
Confidence 468999999999999999999999999999999888775 6999999999999999999977666555544333221
Q ss_pred CCCCCCceEEEEeeeCCCeEEEEEcCccCcc-----ceEEEEEeecCC--CCCeEEEEEEecCCeEEEEeeeeeeecc-c
Q 038068 188 DINIDGKFSVLQEEKNDDVLFILNNNTGSLG-----NLVSVCCIASVR--KDLYYDIVARCVTGTTLKIQSSTWSSKV-R 259 (269)
Q Consensus 188 ~~~~~~~~~~~~~~~~~~~lF~l~~~~~~~g-----~~v~v~ci~~~~--~~f~Y~l~~~~~~~~~l~~~s~~~~~~~-~ 259 (269)
+..+...|++...+++.+|+|+..+...+ ..+.|++||+++ .+|.|+|++. +++|+|+|++.+++|++ +
T Consensus 79 --~~~~~~~~v~~~~~~g~~F~l~~~~~~~~~~~~~~~~~v~~~G~~~~a~~f~Yel~l~-~~~r~l~~~~~~~si~e~~ 155 (190)
T d1k2fa_ 79 --NLPGAVDWVMMQSCFGFHFMLVLEKQEKYDGHQQFFAIVQLIGTRKQAENFAYRLELN-GHRRRLTWEATPRSIHEGI 155 (190)
T ss_dssp --TCTTCCEEEEEEEETTEEEEEEEEEEEETTTEEEEEEEEEESSCHHHHTTEEEEEEEE-ETTEEEEEEECCEETTTCS
T ss_pred --ccccceeEEEEEecCCCEEEEEEEEEeccCCCCeEEEEEEEECCHHHhhCccEEEEec-CCCceEEEecccccccccc
Confidence 12223345666678999999998764433 247788999876 9999999999 99999999999999986 4
Q ss_pred cCCCCCCCC
Q 038068 260 SDIPSPFGF 268 (269)
Q Consensus 260 ~~~~~~~~~ 268 (269)
.+..++..|
T Consensus 156 ~~~~~~~d~ 164 (190)
T d1k2fa_ 156 ATAIMNSDC 164 (190)
T ss_dssp HHHHHTTCS
T ss_pred ccccCCCCE
Confidence 444444444
|
| >d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} | Back information, alignment and structure |
|---|
| >d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} | Back information, alignment and structure |
|---|
| >d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} | Back information, alignment and structure |
|---|
| >d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wfpa_ g.80.1.1 (A:) Zinc finger A20 and AN1 domains containing protein At1g12440 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wfla_ g.80.1.1 (A:) Zinc finger A20 domain containing protein 2 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wffa_ g.80.1.1 (A:) ANUBL1 (AN1, ubiquitin-like, homolog) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1z60a1 g.49.1.2 (A:328-386) TFIIH p44 subunit cysteine-rich domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wfha_ g.80.1.1 (A:) Zinc finger A20 and AN1 domains containing protein At2g36320 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d2cs3a1 g.44.1.3 (A:8-87) Protein c14orf4 (KIAA1865) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2glia5 g.37.1.1 (A:229-257) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2jnea1 g.41.18.1 (A:1-71) Hypothetical protein YfgJ {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2ct7a1 g.44.1.4 (A:8-80) Ring finger protein 31 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|