Citrus Sinensis ID: 038131

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650----
EDLVGIIQEKQQLKVLKIGDERGSTPLHIAAGLGNVSMCKCIATADPRLIGERNHENETPFFLAALHGHKDAFLCLHYLCASVDDGYTYSRRNEGDTVLHCAISGDYFDLAFQIIHRCEKLVNSVNEQGVSPLHLLATKPNAFRSGSHLGLCTGIIYHCISVDKLQEETSYDQYQLETSKKQTNYPENYETCLNFIRLLKTMFIVLSNRGNTKKEQTPTDAEDPERSKGIDDSGDQGEESRHNFGAQGHQFFPPNYGTCFEFVKLVMLVPKAMLVILALGSTKIRKIREKKQKHTWSVQILDELLRRASLYEYDDDGGKPLRRPSSQAEEDETSPYPIVDGGDTDAVLEGKTGSTIPDMAKRETPILIAAKNGITEIVEKILESFPVAIHDINSEKKNIVLLAVENRQPHVYQLLLKTTIMKDSVFRKVDDQGNSALHLAATLGDHKPWLTPGAALQMQWELRWYEQDKSAEDLFTETHISLVQEGDQWLIKTSEACTVMAALIATVAFTSSSNVPGGVNGETGDPNLKDQLAFNVFAISSLVALSFSITALVVFFTITTSQFQERDFRNDLPGKLLLGFTSLFVSIASMLISFCAGHFLVVRDNLKYAAFPLYAGTGLPLTLFAIARFPHCVYLFWATFKKVPQKRKLECKFS
cHHHHHHHHcccHHHHccccccccHHHHHHHHcccHHHHHHHHHcccccccccccccccHHHHHHHcccHHHHHHHHHcccccccccccccccccHHHHHHHHHcccHHHHHHHHHccHHHHccccccccHHHHHHHHcccccccccHHHHHHHHHHccccccccccccccHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHccHHHHHHHHcccccHHHHHHHHHHccccHHHHHHHHHHccccccccccccccccccccccccccccccccccccccHHHHccccccccccccccccHHHHHHHcccHHHHHHHHHcccccccccccccccHHHHHHHcccHHHHHHHHcccccccccccccccccccHHHHHHHccccccccccccHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccc
cHHHHHcccccccHHHHccccccccHHHHHHHHccHHHHHHHHHHcccHccccccccccHHHHHHHHccHHHHHHHHHccccHHHHcHcccccccHHHHHHHHHHHHHHHHHHHHHHcHHHHHccccccccHHHHHHccccccccccccHHHHHHEEEcEEcccccccccHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHcccccccHcccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHccHccEcccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHccHHHHHHHHHHHccHHHHccccccccEEHHHHHccHHHHHHHHHHccHHHHHHHHHHccccccEEHEEccccccccccccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccHHHHEHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccc
EDLVGIIQEKQQLKVLkigdergstplhiaaglgnvsmckciatadprligernhenetpFFLAALHGHKDAFLCLHYLCAsvddgytysrrnegdtvlhcaisgdyfDLAFQIIHRCEKLVNSvneqgvsplhllatkpnafrsgshlglCTGIIYHCISvdklqeetsydQYQLETskkqtnypenyETCLNFIRLLKTMFIVLSnrgntkkeqtptdaedperskgiddsgdqgeesrhnfgaqghqffppnygtcFEFVKLVMLVPKAMLVILALGSTKIRKIREKKQKHTWSVQILDELLRRASlyeydddggkplrrpssqaeedetspypivdggdtdavlegktgstipdmakreTPILIAAKNGITEIVEKILESFPVAIHDINSEKKNIVLLAVENRQPHVYQLLLKTTIMKDSVFRKVDDQGNSALHLAATlgdhkpwltpgaALQMQWELRWYEQDKSAEDLFTETHISLVQEGDQWLIKTSEACTVMAALIATVAftsssnvpggvngetgdpnlkdqLAFNVFAISSLVALSFSITALVVFFTITtsqfqerdfrndlpgkllLGFTSLFVSIASMLISFCAGHFLVVRDNLkyaafplyagtglpltLFAIARFPHCVYLFWATfkkvpqkrkleckfs
edlvgiiqekqqlkvlkigdergSTPLHIAAGLGNVSMCKCIATADPRLIGERNHENETPFFLAALHGHKDAFLCLHYLCASVDDGYTYSRRNEGDTVLHCAISGDYFDLAFQIIHRCEKLVNSVNEQGVSPLHLLATKPNAFRSGSHLGLCTGIIYHCISVDKLQEETSYDQYQLetskkqtnypeNYETCLNFIRLLKTMFIVLSnrgntkkeqtptdaedperskGIDDSGDQGEESRHNFGAQGHQFFPPNYGTCFEFVKLVMLVPKAMLVILALGstkirkirekkqkhtwsvqiLDELLRRASLYeydddggkplrrpssqaeedetspypivdggdtdAVLEGKtgstipdmakreTPILIAAKNGITEIVEKILESFPVAIHDINSEKKNIVLLAVENRQPHVYQLLLKTTIMKDSVFRKVDDQGNSALHLAATLGDHKPWLTPGAALQMQWELRWYEQDKSAEDLFTETHISLVQEGDQWLIKTSEACTVMAALIATVAFTSSSNVPGGVNGETGDPNLKDQLAFNVFAISSLVALSFSITALVVFFTITTSQFQERDFRNDLPGKLLLGFTSLFVSIASMLISFCAGHFLVVRDNLKYAAFPLYAGTGLPLTLFAIARFPHCVYLFWATfkkvpqkrkleckfs
EDLVGIIQEKQQLKVLKIGDERGSTPLHIAAGLGNVSMCKCIATADPRLIGERNHENETPFFLAALHGHKDAFLCLHYLCASVDDGYTYSRRNEGDTVLHCAISGDYFDLAFQIIHRCEKLVNSVNEQGVSPLHLLATKPNAFRSGSHLGLCTGIIYHCISVDKLQEETSYDQYQLETSKKQTNYPENYETCLNFIRLLKTMFIVLSNRGNTKKEQTPTDAEDPERSKGIDDSGDQGEESRHNFGAQGHQFFPPNYGTCFEFVKLVMLVPKAMLVILALGSTKIRKIREKKQKHTWSVQILDELLRRASLYEYDDDGGKPLRRPSSQAEEDETSPYPIVDGGDTDAVLEGKTGSTIPDMAKRETPILIAAKNGITEIVEKILESFPVAIHDINSEKKNIVLLAVENRQPHVYQLLLKTTIMKDSVFRKVDDQGNSALHLAATLGDHKPWLTPGAALQMQWELRWYEQDKSAEDLFTETHISLVQEGDQWLIKTSEACTVMAALIATVAFTSSSNVPGGVNGETGDPNLKDQLAFNVFAISSLVALSFSITALVVFFTITTSQFQERDFRNDLPGKLLLGFTSLFVSIASMLISFCAGHFLVVRDNLKYAAFPLYAGTGLPLTLFAIARFPHCVYLFWATFKKVPQKRKLECKFS
*****IIQ*KQQLKVLKIGDERGSTPLHIAAGLGNVSMCKCIATADPRLIGERNHENETPFFLAALHGHKDAFLCLHYLCASVDDGYTYSRRNEGDTVLHCAISGDYFDLAFQIIHRCEKLVNSVNEQGVSPLHLLATKPNAFRSGSHLGLCTGIIYHCISVDKLQEETSYDQYQL******TNYPENYETCLNFIRLLKTMFIVLS****************************************GHQFFPPNYGTCFEFVKLVMLVPKAMLVILALGSTKIRKIREKKQKHTWSVQILDELLRRASLYEY*************************************************ETPILIAAKNGITEIVEKILESFPVAIHDINSEKKNIVLLAVENRQPHVYQLLLKTTIMKDSVFRKVDDQGNSALHLAATLGDHKPWLTPGAALQMQWELRWYEQDKSAEDLFTETHISLVQEGDQWLIKTSEACTVMAALIATVAFTSS***************LKDQLAFNVFAISSLVALSFSITALVVFFTITTSQFQERDFRNDLPGKLLLGFTSLFVSIASMLISFCAGHFLVVRDNLKYAAFPLYAGTGLPLTLFAIARFPHCVYLFWATFKKV***********
EDLVGIIQEKQQLKVLKIGDERGSTPLHIAAGLGNVSMCKCIATADPRLIGERNHENETPFFLAALHGHKDAFLCLHYLCASVDDGYTYSRRNEGDTVLHCAISGDYFDLAFQIIHRCEKLVNSVNEQGVSPLHLLATKPNAFRSGSHLGLCTGIIYHCISVDKLQEETSYDQYQLETSKKQTNYPENYETCLNFIRLLKTMFIVLSNRGNTKKEQTPTDAEDPERSKGIDDSGDQGEESRHNFGAQGHQFFPPNYGTCFEFVKLVMLVPKAMLVILALGSTKIRKIREKKQKHTWSVQILDELLRRASLYEYDDDGGKPLRRPSSQAEEDETSPYPIVDGGDTDAVLEGKTG*TIPDMAKRETPILIAAKNGITEIVEKILESFPVAIHDINSEKKNIVLLAVENRQPHVYQLLLKTTIMKDSVFRKVDDQGNSALHLAATLGDHKPWLTPGAALQMQWELRWYEQDKSAEDLFTE******QEGDQWLIKTSEACTVMAALIATVAFTSSSNVPGGVNGETGDPNLKDQLAFNVFAISSLVALSFSITALVVFFTITTSQFQERDFRNDLPGKLLLGFTSLFVSIASMLISFCAGHFLVVRDNLKYAAFPLYAGTGLPLTLFAIARFPHCVYLFWATFKKVPQ*********
EDLVGIIQEKQQLKVLKIGDERGSTPLHIAAGLGNVSMCKCIATADPRLIGERNHENETPFFLAALHGHKDAFLCLHYLCASVDDGYTYSRRNEGDTVLHCAISGDYFDLAFQIIHRCEKLVNSVNEQGVSPLHLLATKPNAFRSGSHLGLCTGIIYHCISVDKLQEETSYDQYQLETSKKQTNYPENYETCLNFIRLLKTMFIVLSNRG******************************RHNFGAQGHQFFPPNYGTCFEFVKLVMLVPKAMLVILALGSTKIRK*********WSVQILDELLRRASLYEYDDD*****************SPYPIVDGGDTDAVLEGKTGSTIPDMAKRETPILIAAKNGITEIVEKILESFPVAIHDINSEKKNIVLLAVENRQPHVYQLLLKTTIMKDSVFRKVDDQGNSALHLAATLGDHKPWLTPGAALQMQWELRWYEQDKSAEDLFTETHISLVQEGDQWLIKTSEACTVMAALIATVAFTSSSNVPGGVNGETGDPNLKDQLAFNVFAISSLVALSFSITALVVFFTITTSQFQERDFRNDLPGKLLLGFTSLFVSIASMLISFCAGHFLVVRDNLKYAAFPLYAGTGLPLTLFAIARFPHCVYLFWATFKKVPQKRKLECKFS
EDLVGIIQEKQQLKVLKIGDERGSTPLHIAAGLGNVSMCKCIATADPRLIGERNHENETPFFLAALHGHKDAFLCLHYLCASVDDGYTYSRRNEGDTVLHCAISGDYFDLAFQIIHRCEKLVNSVNEQGVSPLHLLATKPNAFRSGSHLGLCTGIIYHCISVDKLQEETSYDQYQLETSKKQTNYPENYETCLNFIRLLKTMFIVLSNR****************************************QFFPPNYGTCFEFVKLVMLVPKAMLVILALGSTKIRKIREKKQKHTWSVQILDELLRRASLYEYDDD***************************************IPDMAKRETPILIAAKNGITEIVEKILESFPVAIHDINSEKKNIVLLAVENRQPHVYQLLLKTTIMKDSVFRKVDDQGNSALHLAATLGDHKPWLTPGAALQMQWELRWYEQDKSAEDLFTETHISLVQEGDQWLIKTSEACTVMAALIATVAFTSSSNVPGGVNGETGDPNLKDQLAFNVFAISSLVALSFSITALVVFFTITTSQFQERDFRNDLPGKLLLGFTSLFVSIASMLISFCAGHFLVVRDNLKYAAFPLYAGTGLPLTLFAIARFPHCVYLFWATFKKVPQ*********
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHoooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
EDLVGIIQEKQQLKVLKIGDERGSTPLHIAAGLGNVSMCKCIATADPRLIGERNHENETPFFLAALHGHKDAFLCLHYLCASVDDGYTYSRRNEGDTVLHCAISGDYFDLAFQIIHRCEKLVNSVNEQGVSPLHLLATKPNAFRSGSHLGLCTGIIYHCISVDKLQEETSYDQYQLETSKKQTNYPENYETCLNFIRLLKTMFIVLSNRGNTKKEQTPTDAEDPERSKGIDDSGDQGEESRHNFGAQGHQFFPPNYGTCFEFVKLVMLVPKAMLVILALGSTKIRKIREKKQKHTWSVQILDELLRRASLYEYDDDGGKPLRRPSSQAEEDETSPYPIVDGGDTDAVLEGKTGSTIPDMAKRETPILIAAKNGITEIVEKILESFPVAIHDINSEKKNIVLLAVENRQPHVYQLLLKTTIMKDSVFRKVDDQGNSALHLAATLGDHKPWLTPGAALQMQWELRWYEQDKSAEDLFTETHISLVQEGDQWLIKTSEACTVMAALIATVAFTSSSNVPGGVNGETGDPNLKDQLAFNVFAISSLVALSFSITALVVFFTITTSQFQERDFRNDLPGKLLLGFTSLFVSIASMLISFCAGHFLVVRDNLKYAAFPLYAGTGLPLTLFAIARFPHCVYLFWATFKKVPQKRKLECKFS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query654 2.2.26 [Sep-21-2011]
Q96NW41050 Ankyrin repeat domain-con yes no 0.165 0.102 0.314 4e-05
Q5REW91050 Ankyrin repeat domain-con yes no 0.165 0.102 0.314 6e-05
Q9C7A2590 Ankyrin repeat-containing no no 0.356 0.394 0.232 0.0001
Q9XZC01413 Alpha-latrocrustotoxin-Lt N/A no 0.128 0.059 0.322 0.0002
Q54KA7 986 Ankyrin repeat, PH and SE yes no 0.160 0.106 0.321 0.0003
Q6RI861125 Transient receptor potent no no 0.171 0.099 0.291 0.0004
Q12955 4377 Ankyrin-3 OS=Homo sapiens no no 0.191 0.028 0.278 0.0004
Q8BLA81125 Transient receptor potent yes no 0.171 0.099 0.291 0.0004
O757621119 Transient receptor potent no no 0.171 0.100 0.291 0.0006
>sp|Q96NW4|ANR27_HUMAN Ankyrin repeat domain-containing protein 27 OS=Homo sapiens GN=ANKRD27 PE=1 SV=2 Back     alignment and function desciption
 Score = 50.4 bits (119), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 39/124 (31%), Positives = 60/124 (48%), Gaps = 16/124 (12%)

Query: 20  DERGSTPLHIAAGLGNVSMCKCIATADPRLIGERNHENETPFFLAALHGHKDA-FLCLHY 78
           D+RG TPLH+AA  G  S+   + +    ++   ++   TP  LA   G++    L LHY
Sbjct: 460 DDRGHTPLHVAAVCGQASLIDLLVSKGA-MVNATDYHGATPLHLACQKGYQSVTLLLLHY 518

Query: 79  -LCASVDDGYTYSRRNEGDTVLHCAISGDYFD----LAFQIIHRCEKLVNSVNEQGVSPL 133
              A V D       N G+T LH A +  + D    L +  +  C   ++  NE+G +PL
Sbjct: 519 KASAEVQD-------NNGNTPLHLACTYGHEDCVKALVYYDVESCR--LDIGNEKGDTPL 569

Query: 134 HLLA 137
           H+ A
Sbjct: 570 HIAA 573
May be a Rab21 guanine exchange factor and regulate endosome dynamics.
Homo sapiens (taxid: 9606)
>sp|Q5REW9|ANR27_PONAB Ankyrin repeat domain-containing protein 27 OS=Pongo abelii GN=ANKRD27 PE=2 SV=1 Back     alignment and function description
>sp|Q9C7A2|Y3236_ARATH Ankyrin repeat-containing protein At3g12360 OS=Arabidopsis thaliana GN=At3g12360 PE=2 SV=1 Back     alignment and function description
>sp|Q9XZC0|LCTA_LATTR Alpha-latrocrustotoxin-Lt1a (Fragment) OS=Latrodectus tredecimguttatus PE=2 SV=2 Back     alignment and function description
>sp|Q54KA7|SECG_DICDI Ankyrin repeat, PH and SEC7 domain containing protein secG OS=Dictyostelium discoideum GN=secG PE=2 SV=1 Back     alignment and function description
>sp|Q6RI86|TRPA1_RAT Transient receptor potential cation channel subfamily A member 1 OS=Rattus norvegicus GN=Trpa1 PE=2 SV=1 Back     alignment and function description
>sp|Q12955|ANK3_HUMAN Ankyrin-3 OS=Homo sapiens GN=ANK3 PE=1 SV=3 Back     alignment and function description
>sp|Q8BLA8|TRPA1_MOUSE Transient receptor potential cation channel subfamily A member 1 OS=Mus musculus GN=Trpa1 PE=1 SV=1 Back     alignment and function description
>sp|O75762|TRPA1_HUMAN Transient receptor potential cation channel subfamily A member 1 OS=Homo sapiens GN=TRPA1 PE=2 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query654
359479721749 PREDICTED: uncharacterized protein LOC10 0.932 0.814 0.517 0.0
147855983 1513 hypothetical protein VITISV_044165 [Viti 0.977 0.422 0.498 0.0
359476634 969 PREDICTED: uncharacterized protein LOC10 0.952 0.642 0.497 0.0
359495447733 PREDICTED: uncharacterized protein LOC10 0.873 0.778 0.475 1e-176
356546544725 PREDICTED: uncharacterized protein LOC10 0.909 0.820 0.453 1e-162
359479727663 PREDICTED: ankyrin repeat-containing pro 0.882 0.870 0.454 1e-160
255554112 786 ankyrin repeat-containing protein, putat 0.946 0.787 0.435 1e-158
147779690 869 hypothetical protein VITISV_044420 [Viti 0.914 0.688 0.429 1e-157
359479729 826 PREDICTED: uncharacterized protein LOC10 0.932 0.738 0.447 1e-157
147841950714 hypothetical protein VITISV_026950 [Viti 0.882 0.808 0.442 1e-155
>gi|359479721|ref|XP_002272096.2| PREDICTED: uncharacterized protein LOC100255529 [Vitis vinifera] Back     alignment and taxonomy information
 Score =  687 bits (1774), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 369/713 (51%), Positives = 469/713 (65%), Gaps = 103/713 (14%)

Query: 1   EDLVGIIQEKQQLK-VLKIGDERGSTPLHIAAGLGNVSMCKCIATADPRLIGERNHENET 59
           E L+ II+ K ++K VLKI +ERG+T LH+AA +G++ MCKCIA A P LIG RNH++ET
Sbjct: 66  EQLLLIIRGKAKVKEVLKIQNERGNTILHLAASMGSMEMCKCIADALPDLIGARNHDSET 125

Query: 60  PFFLAALHGHKDAFLCLHYLCASVDDGYTYSRRNEGDTVLHCAISGDYFDLAFQIIHRCE 119
           P FLAALHG K+AF+CL  +C  +D G TY RRN+GDT+LHCAI+G+YFDLAFQII R +
Sbjct: 126 PLFLAALHGKKEAFICLDEICG-LDKGNTYCRRNDGDTILHCAIAGEYFDLAFQIISRYK 184

Query: 120 KLVNSVNEQGVSPLHLLATKPNAFRSGSHLGLCTGIIYHCISVDKLQEETSYDQYQLETS 179
            LVNSVNEQG+SPLHLLATK +AFRSGSH    T IIYHCI V+KL+EET    ++ E +
Sbjct: 185 NLVNSVNEQGLSPLHLLATKHSAFRSGSHFRWFTNIIYHCIFVEKLEEET----FKQEEA 240

Query: 180 KKQTNYPENYETCLNFIRLLKTMFIVLSNRGNTKKEQTPTDAEDPERSKGIDDSGDQGE- 238
              + +P +                  +N G         D EDP        SG+Q   
Sbjct: 241 ISLSYFPFS------------------ANTGKDPGTGGQADLEDP--------SGNQSNM 274

Query: 239 ESRHNFGAQGHQFFPPNYGTCFEFVKLVMLVPKAMLVILALGSTKIRKIREKKQKHTWSV 298
           +++    +QGHQ  P NY TCF  +K V    KA+LVIL  G   ++K+R+KK+KH W+ 
Sbjct: 275 KAKGELQSQGHQLIPSNYHTCFNIIKFVF---KAILVILGFGFKAVKKVRQKKEKHVWAA 331

Query: 299 QILDELLRRASLYEYDDDGGKPLRRPSSQAEEDETSPYPIVD--GGDTDAVLE------- 349
           QILDELL  AS YEY+D+G  P ++PS + + D T+PY I D  G   D  LE       
Sbjct: 332 QILDELLCHASFYEYEDNGRNP-QQPSQKKDAD-TTPYSISDDHGVSFDNTLESQHLPGG 389

Query: 350 ----------------------------------GKTGSTIPD------MAKRETPILIA 369
                                             GK      D      M ++ETP+L+A
Sbjct: 390 TAAQPSSATNQQGEDKGAPADRSSPEAQRKQNDNGKNKKNEQDKKKPSEMERKETPLLVA 449

Query: 370 AKNGITEIVEKILESFPVAIHDINSEKKNIVLLAVENRQPHVYQLLLKTTIMKDSVFRKV 429
           AKNG+ EIVE+ILE FPVAIHD + +KKNIVLLAVE RQPHVY+LL+K  ++KD+VFR V
Sbjct: 450 AKNGVVEIVERILELFPVAIHDKDYQKKNIVLLAVEYRQPHVYELLVKRKVLKDAVFRHV 509

Query: 430 DDQGNSALHLAATLGDHKPWLTPGAALQMQWELRWYE----------------QDKSAED 473
           D  GNSALHLAA LG++KPWL PGAALQMQWE++WYE                + ++A+D
Sbjct: 510 DIDGNSALHLAAMLGENKPWLIPGAALQMQWEIKWYEFVKRSVPQHFFVRCNQKGETAKD 569

Query: 474 LFTETHISLVQEGDQWLIKTSEACTVMAALIATVAFTSSSNVPGGVNGETGDPNLKDQLA 533
           +FTE H+ LVQ G +WL KTSE+C+V+AALIATVAF +SS VPGGV  + G P L+D+ A
Sbjct: 570 IFTEKHMDLVQAGGEWLFKTSESCSVVAALIATVAFATSSTVPGGVKEKVGTPTLEDEPA 629

Query: 534 FNVFAISSLVALSFSITALVVFFTITTSQFQERDFRNDLPGKLLLGFTSLFVSIASMLIS 593
           F++FAISSLVAL FS+ A+++F  I TS++QERDFR  LP KLL+G TSLFVSIASMLIS
Sbjct: 630 FDIFAISSLVALCFSVNAVIMFLAILTSRYQERDFRIYLPRKLLVGLTSLFVSIASMLIS 689

Query: 594 FCAGHFLVVRDNLKYAAFPLYAGTGLPLTLFAIARFPHCVYLFWATFKKVPQK 646
           FCAGH+ V+ D L+Y A  +YA T LP+  FA+A+FP    L WATFKKVPQ+
Sbjct: 690 FCAGHYFVLMDKLQYTAILVYAVTCLPVIFFAVAQFPLYFDLMWATFKKVPQR 742

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|147855983|emb|CAN82817.1| hypothetical protein VITISV_044165 [Vitis vinifera] Back     alignment and taxonomy information
>gi|359476634|ref|XP_002273692.2| PREDICTED: uncharacterized protein LOC100246246 [Vitis vinifera] Back     alignment and taxonomy information
>gi|359495447|ref|XP_002274376.2| PREDICTED: uncharacterized protein LOC100254555 [Vitis vinifera] Back     alignment and taxonomy information
>gi|356546544|ref|XP_003541685.1| PREDICTED: uncharacterized protein LOC100798360 [Glycine max] Back     alignment and taxonomy information
>gi|359479727|ref|XP_002274066.2| PREDICTED: ankyrin repeat-containing protein At3g12360-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|255554112|ref|XP_002518096.1| ankyrin repeat-containing protein, putative [Ricinus communis] gi|223542692|gb|EEF44229.1| ankyrin repeat-containing protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|147779690|emb|CAN60672.1| hypothetical protein VITISV_044420 [Vitis vinifera] Back     alignment and taxonomy information
>gi|359479729|ref|XP_002274084.2| PREDICTED: uncharacterized protein LOC100245924 [Vitis vinifera] Back     alignment and taxonomy information
>gi|147841950|emb|CAN67508.1| hypothetical protein VITISV_026950 [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query654
TAIR|locus:2165174347 AT5G35810 "AT5G35810" [Arabido 0.247 0.466 0.374 1.3e-34
TAIR|locus:2175448603 AT5G04730 "AT5G04730" [Arabido 0.288 0.313 0.325 2.4e-32
TAIR|locus:2080240574 AT3G54070 "AT3G54070" [Arabido 0.198 0.226 0.427 5.2e-30
TAIR|locus:2175413669 AT5G04700 "AT5G04700" [Arabido 0.281 0.275 0.326 3.1e-26
TAIR|locus:2180228625 AT5G04690 "AT5G04690" [Arabido 0.273 0.286 0.291 5.4e-25
TAIR|locus:2020833616 AT1G03670 "AT1G03670" [Arabido 0.204 0.217 0.275 8.9e-13
TAIR|locus:2046628601 AT2G24600 "AT2G24600" [Arabido 0.174 0.189 0.304 1.1e-12
TAIR|locus:2129685694 AT4G14390 "AT4G14390" [Arabido 0.185 0.174 0.305 6.3e-12
TAIR|locus:2138391572 AT4G05040 "AT4G05040" [Arabido 0.175 0.201 0.28 7.3e-12
TAIR|locus:2009046573 AT1G34050 "AT1G34050" [Arabido 0.163 0.186 0.318 9.9e-12
TAIR|locus:2165174 AT5G35810 "AT5G35810" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 286 (105.7 bits), Expect = 1.3e-34, Sum P(2) = 1.3e-34
 Identities = 64/171 (37%), Positives = 105/171 (61%)

Query:   466 EQDKSAEDLFTETHISLVQEGDQWLIKTSEACTVMAALIATVAFTSSSNVPGGVNGETGD 525
             ++++ A DLFT+ H +L +EG++W+ +T+ AC +++ LIATV F ++  +PGG N  +GD
Sbjct:   153 KKEEVAHDLFTKEHDNLRKEGEKWMKETATACILVSTLIATVVFAAAFTLPGG-NDTSGD 211

Query:   526 ------PNLKDQLAFNVFAISSLVALSFSITALVVFFTITTSQFQERDFRNDLPGKLLLG 579
                   P  + +  F VF IS  VAL  S+T++++F +I TS++ E  F+  LP KL+LG
Sbjct:   212 IKTLGFPTFRKEFWFEVFIISDSVALLSSVTSIMIFLSILTSRYAEASFQTTLPTKLMLG 271

Query:   580 FTSLFVSIASMLISFCAGHFLVVRDNLKYAAFPL-YAGTGLPLTLFAIARF 629
               +LFVSI SM+++F A   L+     K++   L Y  +   L+ F +  F
Sbjct:   272 LLALFVSIISMVLAFTATLILIRDQEPKWSLILLVYVASATALS-FVVLHF 321
GO:0003674 "molecular_function" evidence=ND
GO:0008150 "biological_process" evidence=ND
TAIR|locus:2175448 AT5G04730 "AT5G04730" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2080240 AT3G54070 "AT3G54070" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2175413 AT5G04700 "AT5G04700" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2180228 AT5G04690 "AT5G04690" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2020833 AT1G03670 "AT1G03670" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2046628 AT2G24600 "AT2G24600" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2129685 AT4G14390 "AT4G14390" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2138391 AT4G05040 "AT4G05040" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2009046 AT1G34050 "AT1G34050" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query654
pfam13962114 pfam13962, PGG, Domain of unknown function 2e-26
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 3e-14
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 7e-11
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 3e-09
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 6e-09
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 7e-08
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 2e-07
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 2e-06
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 4e-06
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 2e-05
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 1e-04
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 2e-04
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 0.001
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 0.001
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 0.001
>gnl|CDD|222475 pfam13962, PGG, Domain of unknown function Back     alignment and domain information 
 Score =  103 bits (260), Expect = 2e-26
 Identities = 38/121 (31%), Positives = 60/121 (49%), Gaps = 13/121 (10%)

Query: 487 DQWLIKTSEACTVMAALIATVAFTSSSNVPGGVNGET-----GDPNLKDQL-AFNVFAIS 540
            +WL KT  +  V+A LIATV F +    PGG   +      G P L  +   F  F +S
Sbjct: 1   SEWLEKTRNSLLVVATLIATVTFAAGFTPPGGYWQDDGGHHAGTPILAGKPRRFKAFFVS 60

Query: 541 SLVALSFSITALVVFFTITTSQFQERDFRNDLPGKLLLGFTSLFVSIASMLISFCAGHFL 600
           + +A   S+ A+++   I         F   LP +LL   T L++S+ S++++F AG + 
Sbjct: 61  NTIAFVASLVAVILLLYIV------PSFSRRLP-RLLALLTLLWLSLLSLMVAFAAGSYR 113

Query: 601 V 601
           V
Sbjct: 114 V 114

The PGG domain is named for the highly conserved sequence motif found at the startt of the domain. The function is not known. Length = 114
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 654
PHA02946446 ankyin-like protein; Provisional 100.0
KOG0510 929 consensus Ankyrin repeat protein [General function 100.0
PHA02876682 ankyrin repeat protein; Provisional 100.0
PHA02876682 ankyrin repeat protein; Provisional 100.0
KOG0510 929 consensus Ankyrin repeat protein [General function 100.0
PHA02716764 CPXV016; CPX019; EVM010; Provisional 100.0
PHA03095471 ankyrin-like protein; Provisional 100.0
PHA02730672 ankyrin-like protein; Provisional 100.0
PHA02917661 ankyrin-like protein; Provisional 100.0
PHA02946446 ankyin-like protein; Provisional 100.0
PHA02791284 ankyrin-like protein; Provisional 100.0
PHA02874434 ankyrin repeat protein; Provisional 100.0
PHA02716764 CPXV016; CPX019; EVM010; Provisional 100.0
PHA02874434 ankyrin repeat protein; Provisional 100.0
PHA03100480 ankyrin repeat protein; Provisional 100.0
KOG4412226 consensus 26S proteasome regulatory complex, subun 100.0
PHA02989494 ankyrin repeat protein; Provisional 100.0
KOG4412226 consensus 26S proteasome regulatory complex, subun 100.0
KOG4177 1143 consensus Ankyrin [Cell wall/membrane/envelope bio 100.0
PHA02878477 ankyrin repeat protein; Provisional 100.0
PHA02875413 ankyrin repeat protein; Provisional 100.0
PHA03095471 ankyrin-like protein; Provisional 100.0
PHA02917661 ankyrin-like protein; Provisional 100.0
PHA02875413 ankyrin repeat protein; Provisional 100.0
KOG4177 1143 consensus Ankyrin [Cell wall/membrane/envelope bio 100.0
PHA02798489 ankyrin-like protein; Provisional 100.0
PHA03100480 ankyrin repeat protein; Provisional 100.0
PHA02791284 ankyrin-like protein; Provisional 100.0
KOG0508615 consensus Ankyrin repeat protein [General function 100.0
KOG0509 600 consensus Ankyrin repeat and DHHC-type Zn-finger d 100.0
PHA02989494 ankyrin repeat protein; Provisional 100.0
PHA02730672 ankyrin-like protein; Provisional 99.98
PHA02878477 ankyrin repeat protein; Provisional 99.97
PHA02792631 ankyrin-like protein; Provisional 99.97
KOG0509600 consensus Ankyrin repeat and DHHC-type Zn-finger d 99.97
PHA02798489 ankyrin-like protein; Provisional 99.97
PHA02859209 ankyrin repeat protein; Provisional 99.96
PHA02795437 ankyrin-like protein; Provisional 99.95
KOG0508615 consensus Ankyrin repeat protein [General function 99.95
PHA02792631 ankyrin-like protein; Provisional 99.95
TIGR00870 743 trp transient-receptor-potential calcium channel p 99.94
PHA02795437 ankyrin-like protein; Provisional 99.93
KOG0507 854 consensus CASK-interacting adaptor protein (caskin 99.92
PF13962113 PGG: Domain of unknown function 99.92
KOG4369 2131 consensus RTK signaling protein MASK/UNC-44 [Signa 99.92
KOG0502296 consensus Integral membrane ankyrin-repeat protein 99.92
PLN03192823 Voltage-dependent potassium channel; Provisional 99.91
PHA02859209 ankyrin repeat protein; Provisional 99.91
KOG0502296 consensus Integral membrane ankyrin-repeat protein 99.91
PLN03192823 Voltage-dependent potassium channel; Provisional 99.9
TIGR00870743 trp transient-receptor-potential calcium channel p 99.9
KOG0505527 consensus Myosin phosphatase, regulatory subunit [ 99.88
PHA02741169 hypothetical protein; Provisional 99.87
PHA02743166 Viral ankyrin protein; Provisional 99.87
KOG0507 854 consensus CASK-interacting adaptor protein (caskin 99.87
KOG0514452 consensus Ankyrin repeat protein [General function 99.86
KOG0514452 consensus Ankyrin repeat protein [General function 99.85
PHA02736154 Viral ankyrin protein; Provisional 99.85
KOG4369 2131 consensus RTK signaling protein MASK/UNC-44 [Signa 99.83
KOG0512228 consensus Fetal globin-inducing factor (contains a 99.83
KOG0505527 consensus Myosin phosphatase, regulatory subunit [ 99.82
KOG0512228 consensus Fetal globin-inducing factor (contains a 99.82
KOG0195448 consensus Integrin-linked kinase [Signal transduct 99.81
PHA02743166 Viral ankyrin protein; Provisional 99.81
PHA02884300 ankyrin repeat protein; Provisional 99.8
PHA02741169 hypothetical protein; Provisional 99.79
KOG3676 782 consensus Ca2+-permeable cation channel OSM-9 and 99.78
PHA02884300 ankyrin repeat protein; Provisional 99.77
PHA02736154 Viral ankyrin protein; Provisional 99.75
PF1279689 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 99.73
cd00204126 ANK ankyrin repeats; ankyrin repeats mediate prote 99.73
KOG3676782 consensus Ca2+-permeable cation channel OSM-9 and 99.68
KOG0195448 consensus Integrin-linked kinase [Signal transduct 99.67
PF1279689 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 99.65
cd00204126 ANK ankyrin repeats; ankyrin repeats mediate prote 99.58
COG0666235 Arp FOG: Ankyrin repeat [General function predicti 99.57
KOG4214117 consensus Myotrophin and similar proteins [Transcr 99.54
PF1363754 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 99.45
PTZ00322664 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas 99.44
KOG4214117 consensus Myotrophin and similar proteins [Transcr 99.44
COG0666235 Arp FOG: Ankyrin repeat [General function predicti 99.43
PF1385756 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 99.42
PF1385756 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 99.42
PF1363754 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 99.4
KOG1710396 consensus MYND Zn-finger and ankyrin repeat protei 99.34
KOG0515752 consensus p53-interacting protein 53BP/ASPP, conta 99.33
KOG1710396 consensus MYND Zn-finger and ankyrin repeat protei 99.32
PTZ00322664 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas 99.28
KOG0515752 consensus p53-interacting protein 53BP/ASPP, conta 99.26
KOG0818669 consensus GTPase-activating proteins of the GIT fa 98.84
KOG07821004 consensus Predicted diacylglycerol kinase [Signal 98.82
PF1360630 Ank_3: Ankyrin repeat 98.78
KOG0783 1267 consensus Uncharacterized conserved protein, conta 98.76
KOG0783 1267 consensus Uncharacterized conserved protein, conta 98.75
PF0002333 Ank: Ankyrin repeat Hereditary spherocytosis; Inte 98.62
KOG0506622 consensus Glutaminase (contains ankyrin repeat) [A 98.62
KOG0506622 consensus Glutaminase (contains ankyrin repeat) [A 98.61
PF1360630 Ank_3: Ankyrin repeat 98.6
KOG0522560 consensus Ankyrin repeat protein [General function 98.58
KOG0818669 consensus GTPase-activating proteins of the GIT fa 98.58
PF0002333 Ank: Ankyrin repeat Hereditary spherocytosis; Inte 98.55
KOG07821004 consensus Predicted diacylglycerol kinase [Signal 98.55
KOG0522560 consensus Ankyrin repeat protein [General function 98.39
KOG0705749 consensus GTPase-activating protein Centaurin gamm 98.36
KOG0705749 consensus GTPase-activating protein Centaurin gamm 98.27
KOG0511516 consensus Ankyrin repeat protein [General function 98.17
KOG0520975 consensus Uncharacterized conserved protein, conta 98.17
KOG2384223 consensus Major histocompatibility complex protein 98.14
KOG0521785 consensus Putative GTPase activating proteins (GAP 98.04
KOG2384223 consensus Major histocompatibility complex protein 97.95
KOG3609 822 consensus Receptor-activated Ca2+-permeable cation 97.89
KOG0511516 consensus Ankyrin repeat protein [General function 97.86
KOG0521785 consensus Putative GTPase activating proteins (GAP 97.85
KOG3609 822 consensus Receptor-activated Ca2+-permeable cation 97.6
KOG0520975 consensus Uncharacterized conserved protein, conta 97.55
smart0024830 ANK ankyrin repeats. Ankyrin repeats are about 33 96.79
smart0024830 ANK ankyrin repeats. Ankyrin repeats are about 33 96.42
KOG2505591 consensus Ankyrin repeat protein [General function 96.27
KOG2505591 consensus Ankyrin repeat protein [General function 96.26
PF06128284 Shigella_OspC: Shigella flexneri OspC protein; Int 90.4
PF1192976 DUF3447: Domain of unknown function (DUF3447); Int 87.4
PF1192976 DUF3447: Domain of unknown function (DUF3447); Int 87.3
PF06570206 DUF1129: Protein of unknown function (DUF1129); In 84.17
PF06128284 Shigella_OspC: Shigella flexneri OspC protein; Int 84.05
>PHA02946 ankyin-like protein; Provisional Back     alignment and domain information 
Probab=100.00  E-value=2.5e-41  Score=361.13  Aligned_cols=302  Identities=17%  Similarity=0.139  Sum_probs=225.7

Q ss_pred             hhHHHHHhcccccccccCCCCCChHHHHHHhcCCHHHHHHHHhhCCccccCCCCCCChHHHHHHHcCC--HHHHHHHHhh
Q 038131            2 DLVGIIQEKQQLKVLKIGDERGSTPLHIAAGLGNVSMCKCIATADPRLIGERNHENETPFFLAALHGH--KDAFLCLHYL   79 (654)
Q Consensus         2 ~iv~~Ll~~~~~~~l~~~d~~g~T~Lh~Aa~~G~~~~v~~Ll~~~~~~~~~~d~~G~TpLh~Aa~~g~--~~iv~~Ll~~   79 (654)
                      ++|+.|+++|+  ++|.+|.+|+||||+||..|+.++|++|++.|++ ++.+|.+|.||||+|+..++  .+++++|+++
T Consensus        53 ~iv~~Ll~~Ga--dvn~~d~~G~TpLh~Aa~~g~~eiv~lLL~~GAd-in~~d~~g~TpLh~A~~~~~~~~e~v~lLl~~  129 (446)
T PHA02946         53 RFVEELLHRGY--SPNETDDDGNYPLHIASKINNNRIVAMLLTHGAD-PNACDKQHKTPLYYLSGTDDEVIERINLLVQY  129 (446)
T ss_pred             HHHHHHHHCcC--CCCccCCCCCCHHHHHHHcCCHHHHHHHHHCcCC-CCCCCCCCCCHHHHHHHcCCchHHHHHHHHHc
Confidence            68999999988  7899999999999999999999999999999988 89999999999999988664  7889999999


Q ss_pred             cCCCCCCCccccCCCCCcHHHHHHHcCCHHHHHHHHHhccccccccccCCCCHHHHHhcCCCCCccCCchHHHHHHhhcc
Q 038131           80 CASVDDGYTYSRRNEGDTVLHCAISGDYFDLAFQIIHRCEKLVNSVNEQGVSPLHLLATKPNAFRSGSHLGLCTGIIYHC  159 (654)
Q Consensus        80 g~~~~~~~~~~~~~~g~T~Lh~A~~~g~~~~v~~Ll~~~~~~~~~~d~~g~TpLh~A~~~~~~~~~~~~~~~v~~Ll~~~  159 (654)
                      |++++.    ..|.+|.|||| |+..|+.+++++|++.+++ ++.+|..|+||||+|+..++.     +.+++++|++.|
T Consensus       130 Gadin~----~~d~~g~tpL~-aa~~~~~~vv~~Ll~~gad-~~~~d~~G~t~Lh~A~~~~~~-----~~~~v~~Ll~~G  198 (446)
T PHA02946        130 GAKINN----SVDEEGCGPLL-ACTDPSERVFKKIMSIGFE-ARIVDKFGKNHIHRHLMSDNP-----KASTISWMMKLG  198 (446)
T ss_pred             CCCccc----ccCCCCCcHHH-HHHCCChHHHHHHHhcccc-ccccCCCCCCHHHHHHHhcCC-----CHHHHHHHHHcC
Confidence            998871    35888999997 6667889999999999887 899999999999998876521     568899999999


Q ss_pred             CcccccchhhhhhhhhhhhccccCCCCchHHHHhhHHHHHHHHHHHHhcCCCCCCCCCCCCCCCccccCCCCCCCCCCCc
Q 038131          160 ISVDKLQEETSYDQYQLETSKKQTNYPENYETCLNFIRLLKTMFIVLSNRGNTKKEQTPTDAEDPERSKGIDDSGDQGEE  239 (654)
Q Consensus       160 ~~~~~~~~~~~~~~~~l~~~~~~~~~p~~~~~~~~~~~~~~~~l~~l~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  239 (654)
                      ++++..+              ..|.+|+++++..+.                                            
T Consensus       199 adin~~d--------------~~G~TpLH~Aa~~~~--------------------------------------------  220 (446)
T PHA02946        199 ISPSKPD--------------HDGNTPLHIVCSKTV--------------------------------------------  220 (446)
T ss_pred             CCCcccC--------------CCCCCHHHHHHHcCC--------------------------------------------
Confidence            9888666              446677776654210                                            


Q ss_pred             ccccCCCCCCCCCCCCcchhhHHHHHHhhhhhHHHHHHhhchHHHHHHHHHhhhhhhHHHHHHHHHHccccccccCCCCC
Q 038131          240 SRHNFGAQGHQFFPPNYGTCFEFVKLVMLVPKAMLVILALGSTKIRKIREKKQKHTWSVQILDELLRRASLYEYDDDGGK  319 (654)
Q Consensus       240 ~~~~~g~~~~~~~~~~~~~~~~~vk~L~~~~~~~~~~~~~g~~~~~~~~~~~~~~~~~~~il~~Ll~~~~~~~~d~~g~t  319 (654)
                                                                           .   ..++++.|++....+..|.+|+|
T Consensus       221 -----------------------------------------------------~---~~~iv~lLl~gadin~~d~~G~T  244 (446)
T PHA02946        221 -----------------------------------------------------K---NVDIINLLLPSTDVNKQNKFGDS  244 (446)
T ss_pred             -----------------------------------------------------C---cHHHHHHHHcCCCCCCCCCCCCC
Confidence                                                                 0   03445555543355556666666


Q ss_pred             CCCCCCCccccCCCCCCCcc--------------CCCCchhhhccccCCCccccCCCCcHHHHHHHcChHHHHHHHHHHC
Q 038131          320 PLRRPSSQAEEDETSPYPIV--------------DGGDTDAVLEGKTGSTIPDMAKRETPILIAAKNGITEIVEKILESF  385 (654)
Q Consensus       320 pLh~a~~~~~~~~~~~~~~~--------------~~~~~~~~~~~~~~~~~~~~~~g~tpLh~Aa~~G~~eiv~~LL~~~  385 (654)
                      |||+|+......+.....+.              ..+..+.+..+.    ...+..|+||||+|+++|+.++|++||++ 
T Consensus       245 pLh~A~~~~~~~~~~~~Ll~~g~~~~~~~~~~a~~~~~~~~~e~l~----~~g~~~~~TpLh~Aa~~g~~eivk~Ll~~-  319 (446)
T PHA02946        245 PLTLLIKTLSPAHLINKLLSTSNVITDQTVNICIFYDRDDVLEIIN----DKGKQYDSTDFKMAVEVGSIRCVKYLLDN-  319 (446)
T ss_pred             HHHHHHHhCChHHHHHHHHhCCCCCCCcHHHHHHHcCchHHHHHHH----HcCcccCCCHHHHHHHcCCHHHHHHHHHC-
Confidence            66666553221000000000              000011111111    11124588999999999999999999996 


Q ss_pred             CCccccccCCCCchhHHHHHcCChHHHHHHHhcCcccccccccccCCCCcHhHHHhhcCCCCC
Q 038131          386 PVAIHDINSEKKNIVLLAVENRQPHVYQLLLKTTIMKDSVFRKVDDQGNSALHLAATLGDHKP  448 (654)
Q Consensus       386 ~~~~~~~d~~G~T~Lh~Av~~~~~~iv~~Ll~~~~~~~~~~~~~D~~G~TpLh~Aa~~g~~~~  448 (654)
                      +       .+|+||||+|+.+++.+++++|+.+++    ++|.+ .+|+||||+|++.++...
T Consensus       320 ~-------~~~~t~L~~A~~~~~~~~v~~Ll~~ga----~~n~~-~~G~t~l~~a~~~~~~~~  370 (446)
T PHA02946        320 D-------IICEDAMYYAVLSEYETMVDYLLFNHF----SVDSV-VNGHTCMSECVRLNNPVI  370 (446)
T ss_pred             C-------CccccHHHHHHHhCHHHHHHHHHHCCC----CCCCc-cccccHHHHHHHcCCHHH
Confidence            2       368999999999999999999999998    88885 689999999999998443

>KOG0510 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA02876 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02876 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0510 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA02716 CPXV016; CPX019; EVM010; Provisional Back     alignment and domain information
>PHA03095 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02730 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02917 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02946 ankyin-like protein; Provisional Back     alignment and domain information
>PHA02791 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02874 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02716 CPXV016; CPX019; EVM010; Provisional Back     alignment and domain information
>PHA02874 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA03100 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG4412 consensus 26S proteasome regulatory complex, subunit PSMD10 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA02989 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG4412 consensus 26S proteasome regulatory complex, subunit PSMD10 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4177 consensus Ankyrin [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>PHA02878 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02875 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA03095 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02917 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02875 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG4177 consensus Ankyrin [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>PHA02798 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA03100 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02791 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0508 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0509 consensus Ankyrin repeat and DHHC-type Zn-finger domain containing proteins [General function prediction only] Back     alignment and domain information
>PHA02989 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02730 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02878 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02792 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0509 consensus Ankyrin repeat and DHHC-type Zn-finger domain containing proteins [General function prediction only] Back     alignment and domain information
>PHA02798 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02859 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02795 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0508 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA02792 ankyrin-like protein; Provisional Back     alignment and domain information
>TIGR00870 trp transient-receptor-potential calcium channel protein Back     alignment and domain information
>PHA02795 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0507 consensus CASK-interacting adaptor protein (caskin) and related proteins with ankyrin repeats and SAM domain [Signal transduction mechanisms] Back     alignment and domain information
>PF13962 PGG: Domain of unknown function Back     alignment and domain information
>KOG4369 consensus RTK signaling protein MASK/UNC-44 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0502 consensus Integral membrane ankyrin-repeat protein Kidins220 (protein kinase D substrate) [General function prediction only] Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>PHA02859 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0502 consensus Integral membrane ankyrin-repeat protein Kidins220 (protein kinase D substrate) [General function prediction only] Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>TIGR00870 trp transient-receptor-potential calcium channel protein Back     alignment and domain information
>KOG0505 consensus Myosin phosphatase, regulatory subunit [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PHA02741 hypothetical protein; Provisional Back     alignment and domain information
>PHA02743 Viral ankyrin protein; Provisional Back     alignment and domain information
>KOG0507 consensus CASK-interacting adaptor protein (caskin) and related proteins with ankyrin repeats and SAM domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG0514 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0514 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA02736 Viral ankyrin protein; Provisional Back     alignment and domain information
>KOG4369 consensus RTK signaling protein MASK/UNC-44 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0512 consensus Fetal globin-inducing factor (contains ankyrin repeats) [Transcription] Back     alignment and domain information
>KOG0505 consensus Myosin phosphatase, regulatory subunit [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG0512 consensus Fetal globin-inducing factor (contains ankyrin repeats) [Transcription] Back     alignment and domain information
>KOG0195 consensus Integrin-linked kinase [Signal transduction mechanisms] Back     alignment and domain information
>PHA02743 Viral ankyrin protein; Provisional Back     alignment and domain information
>PHA02884 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02741 hypothetical protein; Provisional Back     alignment and domain information
>KOG3676 consensus Ca2+-permeable cation channel OSM-9 and related channels (OTRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>PHA02884 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02736 Viral ankyrin protein; Provisional Back     alignment and domain information
>PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>KOG3676 consensus Ca2+-permeable cation channel OSM-9 and related channels (OTRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>KOG0195 consensus Integrin-linked kinase [Signal transduction mechanisms] Back     alignment and domain information
>PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>COG0666 Arp FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>KOG4214 consensus Myotrophin and similar proteins [Transcription] Back     alignment and domain information
>PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A Back     alignment and domain information
>PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>KOG4214 consensus Myotrophin and similar proteins [Transcription] Back     alignment and domain information
>COG0666 Arp FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A Back     alignment and domain information
>PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A Back     alignment and domain information
>PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A Back     alignment and domain information
>KOG1710 consensus MYND Zn-finger and ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0515 consensus p53-interacting protein 53BP/ASPP, contains ankyrin and SH3 domains [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1710 consensus MYND Zn-finger and ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>KOG0515 consensus p53-interacting protein 53BP/ASPP, contains ankyrin and SH3 domains [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0818 consensus GTPase-activating proteins of the GIT family [Signal transduction mechanisms] Back     alignment and domain information
>KOG0782 consensus Predicted diacylglycerol kinase [Signal transduction mechanisms] Back     alignment and domain information
>PF13606 Ank_3: Ankyrin repeat Back     alignment and domain information
>KOG0783 consensus Uncharacterized conserved protein, contains ankyrin and BTB/POZ domains [Function unknown] Back     alignment and domain information
>KOG0783 consensus Uncharacterized conserved protein, contains ankyrin and BTB/POZ domains [Function unknown] Back     alignment and domain information
>PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature Back     alignment and domain information
>KOG0506 consensus Glutaminase (contains ankyrin repeat) [Amino acid transport and metabolism] Back     alignment and domain information
>KOG0506 consensus Glutaminase (contains ankyrin repeat) [Amino acid transport and metabolism] Back     alignment and domain information
>PF13606 Ank_3: Ankyrin repeat Back     alignment and domain information
>KOG0522 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0818 consensus GTPase-activating proteins of the GIT family [Signal transduction mechanisms] Back     alignment and domain information
>PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature Back     alignment and domain information
>KOG0782 consensus Predicted diacylglycerol kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0522 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0705 consensus GTPase-activating protein Centaurin gamma (contains Ras-like GTPase, PH and ankyrin repeat domains) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0705 consensus GTPase-activating protein Centaurin gamma (contains Ras-like GTPase, PH and ankyrin repeat domains) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0511 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0520 consensus Uncharacterized conserved protein, contains IPT/TIG domain [Function unknown] Back     alignment and domain information
>KOG2384 consensus Major histocompatibility complex protein BAT4, contains G-patch and ankyrin domains [General function prediction only] Back     alignment and domain information
>KOG0521 consensus Putative GTPase activating proteins (GAPs) [Signal transduction mechanisms] Back     alignment and domain information
>KOG2384 consensus Major histocompatibility complex protein BAT4, contains G-patch and ankyrin domains [General function prediction only] Back     alignment and domain information
>KOG3609 consensus Receptor-activated Ca2+-permeable cation channels (STRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>KOG0511 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0521 consensus Putative GTPase activating proteins (GAPs) [Signal transduction mechanisms] Back     alignment and domain information
>KOG3609 consensus Receptor-activated Ca2+-permeable cation channels (STRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>KOG0520 consensus Uncharacterized conserved protein, contains IPT/TIG domain [Function unknown] Back     alignment and domain information
>smart00248 ANK ankyrin repeats Back     alignment and domain information
>smart00248 ANK ankyrin repeats Back     alignment and domain information
>KOG2505 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG2505 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PF06128 Shigella_OspC: Shigella flexneri OspC protein; InterPro: IPR010366 This family consists of the Shigella flexneri specific protein OspC Back     alignment and domain information
>PF11929 DUF3447: Domain of unknown function (DUF3447); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>PF11929 DUF3447: Domain of unknown function (DUF3447); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>PF06570 DUF1129: Protein of unknown function (DUF1129); InterPro: IPR009214 There are currently no experimental data for members of this group or their homologues Back     alignment and domain information
>PF06128 Shigella_OspC: Shigella flexneri OspC protein; InterPro: IPR010366 This family consists of the Shigella flexneri specific protein OspC Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query654
1n0r_A126 4ank: A Designed Ankyrin Repeat Protein With Four I 1e-04
1ikn_D236 IkappabalphaNF-Kappab Complex Length = 236 4e-04
>pdb|1N0R|A Chain A, 4ank: A Designed Ankyrin Repeat Protein With Four Identical Consensus Repeats Length = 126 Back     alignment and structure 
Iteration: 1

 Score = 45.1 bits (105), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 35/117 (29%), Positives = 58/117 (49%), Gaps = 11/117 (9%)
Query: 23  GSTPLHIAAGLGNVSMCKCI--ATADPRLIGERNHENETPFFLAALHGHKDAFLCLHYLC 80
           G TPLH+AA  G++ + K +  A AD   +  ++    TP  LAA +GH +    L    
Sbjct: 2   GRTPLHLAARNGHLEVVKLLLEAGAD---VNAKDKNGRTPLHLAARNGHLEVVKLLLEAG 58
Query: 81  ASVDDGYTYSRRNEGDTVLHCAISGDYFDLAFQIIHRCEKLVNSVNEQGVSPLHLLA 137
           A V+     ++   G T LH A    + ++  +++      VN+ ++ G +PLHL A
Sbjct: 59  ADVN-----AKDKNGRTPLHLAARNGHLEVV-KLLLEAGADVNAKDKNGRTPLHLAA 109
>pdb|1IKN|D Chain D, IkappabalphaNF-Kappab Complex Length = 236 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query654
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 2e-11
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 7e-08
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 1e-07
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 2e-05
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 3e-05
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 3e-11
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 8e-09
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 2e-08
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 5e-07
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 7e-07
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 8e-07
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 8e-07
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 5e-11
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 1e-09
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 1e-08
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 6e-08
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 3e-06
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 1e-10
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 5e-07
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 1e-10
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 2e-10
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 8e-10
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 1e-09
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 2e-09
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 3e-09
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 7e-09
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 3e-08
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 3e-06
2etb_A256 Transient receptor potential cation channel subfam 2e-10
2etb_A256 Transient receptor potential cation channel subfam 1e-05
2etb_A256 Transient receptor potential cation channel subfam 2e-04
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 3e-10
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 2e-08
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 4e-07
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 4e-07
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 1e-05
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 3e-05
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 4e-10
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 2e-09
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 5e-06
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 7e-10
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 2e-09
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 3e-06
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 9e-10
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 5e-07
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 2e-06
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 2e-04
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 9e-10
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 1e-07
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 8e-06
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 2e-04
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 9e-10
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 2e-08
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 3e-08
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 5e-07
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 2e-05
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 1e-09
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 1e-09
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 1e-07
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 8e-06
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 2e-09
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 3e-09
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 1e-08
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 4e-08
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 8e-08
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 4e-07
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 1e-06
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 4e-04
2rfa_A232 Transient receptor potential cation channel subfa 5e-09
2rfa_A232 Transient receptor potential cation channel subfa 7e-09
2rfa_A232 Transient receptor potential cation channel subfa 2e-07
2rfa_A232 Transient receptor potential cation channel subfa 3e-07
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 5e-09
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 2e-08
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 8e-06
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 7e-09
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 3e-08
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 2e-07
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 8e-05
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 7e-09
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 1e-08
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 4e-07
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 4e-07
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 9e-05
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 2e-04
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 4e-04
3v30_A172 DNA-binding protein rfxank; structural genomics co 8e-09
3v30_A172 DNA-binding protein rfxank; structural genomics co 4e-08
3v30_A172 DNA-binding protein rfxank; structural genomics co 2e-05
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 8e-09
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 9e-08
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 1e-07
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 5e-07
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 4e-06
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 9e-09
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 2e-08
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 3e-08
3deo_A183 Signal recognition particle 43 kDa protein; chloro 1e-08
3deo_A183 Signal recognition particle 43 kDa protein; chloro 1e-07
3deo_A183 Signal recognition particle 43 kDa protein; chloro 8e-06
3deo_A183 Signal recognition particle 43 kDa protein; chloro 6e-05
3deo_A183 Signal recognition particle 43 kDa protein; chloro 7e-04
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 1e-08
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 2e-08
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 1e-07
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 2e-07
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 7e-05
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 1e-08
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 2e-07
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 9e-07
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 2e-08
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 2e-06
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 3e-06
2pnn_A273 Transient receptor potential cation channel subfa 2e-08
2pnn_A273 Transient receptor potential cation channel subfa 4e-06
2pnn_A273 Transient receptor potential cation channel subfa 7e-06
2pnn_A273 Transient receptor potential cation channel subfa 2e-04
2pnn_A273 Transient receptor potential cation channel subfa 6e-04
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 2e-08
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 1e-06
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 1e-05
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 3e-05
1awc_B153 Protein (GA binding protein beta 1); complex (tran 3e-08
1awc_B153 Protein (GA binding protein beta 1); complex (tran 1e-07
1awc_B153 Protein (GA binding protein beta 1); complex (tran 8e-06
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 3e-08
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 4e-08
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 4e-06
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 7e-06
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 3e-04
3v31_A167 Ankyrin repeat family A protein 2; structural geno 3e-08
3v31_A167 Ankyrin repeat family A protein 2; structural geno 1e-07
3v31_A167 Ankyrin repeat family A protein 2; structural geno 4e-05
1sw6_A327 Regulatory protein SWI6; transcription regulation, 4e-08
1sw6_A327 Regulatory protein SWI6; transcription regulation, 2e-06
1sw6_A327 Regulatory protein SWI6; transcription regulation, 1e-04
3jxi_A260 Vanilloid receptor-related osmotically activated p 5e-08
3jxi_A260 Vanilloid receptor-related osmotically activated p 2e-04
3jxi_A260 Vanilloid receptor-related osmotically activated p 2e-04
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 7e-08
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 7e-07
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 5e-05
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 1e-07
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 2e-07
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 1e-05
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 2e-07
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 6e-07
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 4e-06
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 7e-05
3hra_A201 Ankyrin repeat family protein; structural protein; 2e-07
3hra_A201 Ankyrin repeat family protein; structural protein; 4e-07
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 2e-07
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 4e-07
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 6e-07
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 1e-06
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 2e-07
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 1e-06
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 1e-06
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 3e-07
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 6e-06
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 2e-04
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 3e-07
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 1e-06
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 1e-06
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 3e-05
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 6e-07
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 5e-06
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 4e-06
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 4e-06
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 1e-05
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 5e-06
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 3e-05
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 2e-05
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 1e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-05
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 2e-05
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 4e-05
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 6e-05
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 4e-04
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 4e-04
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 7e-04
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
 Score = 63.2 bits (155), Expect = 2e-11
 Identities = 27/127 (21%), Positives = 41/127 (32%), Gaps = 21/127 (16%)

Query: 20  DERGSTPLHIAAGLGNVSMCKCIAT------ADPRLIGERNHENETPFFLAALHGHKDA- 72
           DE G TPLHIA   GN+     +         +   +   N+  +TP  LA +       
Sbjct: 6   DEDGDTPLHIAVVQGNLPAVHRLVNLFQQGGRE---LDIYNNLRQTPLHLAVITTLPSVV 62

Query: 73  -FLCLHYLCASVDDGYTYSRRNEGDTVLHCAISGDYFDLA-FQIIHRCEKL--VNSVNEQ 128
             L      AS       +    G T  H A            +         + + N  
Sbjct: 63  RLLVTA--GASPM-----ALDRHGQTAAHLACEHRSPTCLRALLDSAAPGTLDLEARNYD 115

Query: 129 GVSPLHL 135
           G++ LH+
Sbjct: 116 GLTALHV 122
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query654
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 100.0
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 100.0
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 100.0
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 100.0
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 100.0
4g8k_A337 2-5A-dependent ribonuclease; ankyrin-repeat domain 100.0
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 100.0
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 100.0
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 100.0
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 100.0
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 100.0
4g8k_A337 2-5A-dependent ribonuclease; ankyrin-repeat domain 100.0
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 100.0
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 100.0
4b93_B269 Ankyrin repeat domain-containing protein 27; endoc 100.0
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 100.0
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 100.0
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 100.0
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 100.0
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 100.0
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 100.0
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 100.0
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 100.0
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 100.0
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 100.0
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 100.0
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 100.0
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 100.0
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 100.0
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 100.0
4b93_B269 Ankyrin repeat domain-containing protein 27; endoc 100.0
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 100.0
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 100.0
1sw6_A327 Regulatory protein SWI6; transcription regulation, 100.0
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 100.0
2rfa_A232 Transient receptor potential cation channel subfa 100.0
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 100.0
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 100.0
3hra_A201 Ankyrin repeat family protein; structural protein; 100.0
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 100.0
2pnn_A273 Transient receptor potential cation channel subfa 100.0
2etb_A256 Transient receptor potential cation channel subfam 100.0
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 100.0
2rfa_A232 Transient receptor potential cation channel subfa 99.98
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 99.97
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 99.97
4gpm_A169 Engineered protein OR264; de novo protein, structu 99.97
4gpm_A169 Engineered protein OR264; de novo protein, structu 99.97
3jxi_A260 Vanilloid receptor-related osmotically activated p 99.97
3hra_A201 Ankyrin repeat family protein; structural protein; 99.97
1sw6_A327 Regulatory protein SWI6; transcription regulation, 99.97
2etb_A256 Transient receptor potential cation channel subfam 99.97
2pnn_A273 Transient receptor potential cation channel subfa 99.97
4hbd_A276 KN motif and ankyrin repeat domain-containing Pro; 99.96
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 99.96
3v30_A172 DNA-binding protein rfxank; structural genomics co 99.96
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 99.96
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 99.96
3jxi_A260 Vanilloid receptor-related osmotically activated p 99.96
4hbd_A276 KN motif and ankyrin repeat domain-containing Pro; 99.96
3v31_A167 Ankyrin repeat family A protein 2; structural geno 99.95
3v30_A172 DNA-binding protein rfxank; structural genomics co 99.95
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 99.95
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 99.95
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 99.95
3v31_A167 Ankyrin repeat family A protein 2; structural geno 99.95
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 99.95
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 99.95
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 99.95
1awc_B153 Protein (GA binding protein beta 1); complex (tran 99.95
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 99.94
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 99.94
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 99.94
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 99.94
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 99.94
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 99.94
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 99.94
1awc_B153 Protein (GA binding protein beta 1); complex (tran 99.94
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 99.93
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 99.93
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 99.93
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 99.92
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 99.92
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 99.92
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 99.91
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 99.91
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 99.9
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 99.9
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 99.9
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 99.9
3deo_A183 Signal recognition particle 43 kDa protein; chloro 99.9
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 99.89
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 99.89
3deo_A183 Signal recognition particle 43 kDa protein; chloro 99.88
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 99.87
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 99.86
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 99.86
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 99.85
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 99.84
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 99.84
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 99.84
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 99.83
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 99.83
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 99.82
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 99.82
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 99.82
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 99.81
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 99.8
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 99.8
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 99.79
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 99.79
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 99.77
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 99.76
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 99.7
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
Probab=100.00  E-value=7.5e-47  Score=408.08  Aligned_cols=379  Identities=19%  Similarity=0.195  Sum_probs=267.6

Q ss_pred             ccccCCCCCChHHHHHHhcCCHHHHHHHHhhCCccccCCCCCCChHHHHHHHcCCHHHHHHHHhhcCCCCCCCccccCCC
Q 038131           15 VLKIGDERGSTPLHIAAGLGNVSMCKCIATADPRLIGERNHENETPFFLAALHGHKDAFLCLHYLCASVDDGYTYSRRNE   94 (654)
Q Consensus        15 ~l~~~d~~g~T~Lh~Aa~~G~~~~v~~Ll~~~~~~~~~~d~~G~TpLh~Aa~~g~~~iv~~Ll~~g~~~~~~~~~~~~~~   94 (654)
                      +++..|..|+||||+||..|+.++|++|++++++ ++.+|..|+||||+||..|+.+++++|+++|++++     .++..
T Consensus         6 ~~~~~~~~g~t~L~~Aa~~g~~~~v~~Ll~~g~~-~~~~~~~~~t~L~~A~~~g~~~~v~~Ll~~g~~~~-----~~~~~   79 (437)
T 1n11_A            6 SGGGGGESGLTPLHVASFMGHLPIVKNLLQRGAS-PNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKVN-----AKAKD   79 (437)
T ss_dssp             ---------CCHHHHHHHHTCHHHHHHHHHTTCC-SCCSSSCCCCHHHHHHHHTCHHHHHHHHHHTCCSS-----CCCTT
T ss_pred             CccccCCCCCCHHHHHHHCCCHHHHHHHHHcCCC-CCCCCCCCCCHHHHHHHcCCHHHHHHHHhCCCCCC-----CCCCC
Confidence            5677777788888888888888888888877776 77777778888888888888888888888877776     67777


Q ss_pred             CCcHHHHHHHcCCHHHHHHHHHhccccccccccCCCCHHHHHhcCCCCCccCCchHHHHHHhhccCcccccchhhhhhhh
Q 038131           95 GDTVLHCAISGDYFDLAFQIIHRCEKLVNSVNEQGVSPLHLLATKPNAFRSGSHLGLCTGIIYHCISVDKLQEETSYDQY  174 (654)
Q Consensus        95 g~T~Lh~A~~~g~~~~v~~Ll~~~~~~~~~~d~~g~TpLh~A~~~~~~~~~~~~~~~v~~Ll~~~~~~~~~~~~~~~~~~  174 (654)
                      |.||||+|++.|+.+++++|++++++ ++.+|..|.||||+|+..|       +.++++.|++.+.+.+..+        
T Consensus        80 g~t~L~~A~~~g~~~~v~~Ll~~ga~-~~~~~~~g~t~L~~A~~~g-------~~~~v~~Ll~~~~~~~~~~--------  143 (437)
T 1n11_A           80 DQTPLHCAARIGHTNMVKLLLENNAN-PNLATTAGHTPLHIAAREG-------HVETVLALLEKEASQACMT--------  143 (437)
T ss_dssp             SCCHHHHHHHHTCHHHHHHHHHHTCC-TTCCCTTCCCHHHHHHHHT-------CHHHHHHHHHTTCCSCCCC--------
T ss_pred             CCCHHHHHHHCCCHHHHHHHHhCCCC-CCCCCCCCCcHHHHHHHcC-------CHHHHHHHHhCCCCCcCCC--------
Confidence            88888888888888888888887776 7777777888888888777       7778888887777665444        


Q ss_pred             hhhhccccCCCCchHHHHhhHHHHHHHHHHHHhcCCCCCCCCCCCCCCCccccCCCCCCCCCCCcccccCCCCCCCCCCC
Q 038131          175 QLETSKKQTNYPENYETCLNFIRLLKTMFIVLSNRGNTKKEQTPTDAEDPERSKGIDDSGDQGEESRHNFGAQGHQFFPP  254 (654)
Q Consensus       175 ~l~~~~~~~~~p~~~~~~~~~~~~~~~~l~~l~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~  254 (654)
                            ..|.+|.++++..+....+.    .+++.|.+++.. +..+.+|                       .|.+   
T Consensus       144 ------~~g~t~L~~A~~~g~~~~v~----~Ll~~g~~~~~~-~~~g~t~-----------------------L~~A---  186 (437)
T 1n11_A          144 ------KKGFTPLHVAAKYGKVRVAE----LLLERDAHPNAA-GKNGLTP-----------------------LHVA---  186 (437)
T ss_dssp             ------TTSCCHHHHHHHTTCHHHHH----HHHHTTCCTTCC-CSSCCCH-----------------------HHHH---
T ss_pred             ------CCCCCHHHHHHHcCCHHHHH----HHHhCCCCCCCC-CCCCCCH-----------------------HHHH---
Confidence                  34556777766665554333    334445443322 1112222                       1111   


Q ss_pred             CcchhhHHHHHHhhhhhHHHHHHhhchHHHHHHHHHhhhhhhHHHHHHHHHHcc-ccccccCCCCCCCCCCCCccccCCC
Q 038131          255 NYGTCFEFVKLVMLVPKAMLVILALGSTKIRKIREKKQKHTWSVQILDELLRRA-SLYEYDDDGGKPLRRPSSQAEEDET  333 (654)
Q Consensus       255 ~~~~~~~~vk~L~~~~~~~~~~~~~g~~~~~~~~~~~~~~~~~~~il~~Ll~~~-~~~~~d~~g~tpLh~a~~~~~~~~~  333 (654)
                      ...++.+++++|+..+..+......|.+.+.....  .++   .++++.|++.+ ..+..|..|+||||+|+.       
T Consensus       187 ~~~~~~~~v~~Ll~~g~~~~~~~~~g~t~L~~A~~--~~~---~~~~~~Ll~~g~~~~~~~~~g~t~L~~A~~-------  254 (437)
T 1n11_A          187 VHHNNLDIVKLLLPRGGSPHSPAWNGYTPLHIAAK--QNQ---VEVARSLLQYGGSANAESVQGVTPLHLAAQ-------  254 (437)
T ss_dssp             HHTTCHHHHHHHGGGTCCSCCCCTTCCCHHHHHHH--TTC---HHHHHHHHHTTCCTTCCCTTCCCHHHHHHH-------
T ss_pred             HHcCCHHHHHHHHhCCCCCCCcCCCCCCHHHHHHH--cCC---HHHHHHHHHcCCCCCCCCCCCCCHHHHHHH-------
Confidence            22345667777764443332222334555544332  233   78999999988 567778899999999987       


Q ss_pred             CCCCccCCCCchhhhccccCCC--ccccCCCCcHHHHHHHcChHHHHHHHHHHCCCccccccCCCCchhHHHHHcCChHH
Q 038131          334 SPYPIVDGGDTDAVLEGKTGST--IPDMAKRETPILIAAKNGITEIVEKILESFPVAIHDINSEKKNIVLLAVENRQPHV  411 (654)
Q Consensus       334 ~~~~~~~~~~~~~~~~~~~~~~--~~~~~~g~tpLh~Aa~~G~~eiv~~LL~~~~~~~~~~d~~G~T~Lh~Av~~~~~~i  411 (654)
                             .+..+.+..++....  +..|..|.||||+|++.|+.+++++|+++ +.+++.+|..|+||||+|+.+|+.++
T Consensus       255 -------~g~~~~v~~Ll~~~~~~~~~~~~g~t~L~~A~~~~~~~~~~~Ll~~-g~~~~~~~~~g~t~L~~A~~~g~~~~  326 (437)
T 1n11_A          255 -------EGHAEMVALLLSKQANGNLGNKSGLTPLHLVAQEGHVPVADVLIKH-GVMVDATTRMGYTPLHVASHYGNIKL  326 (437)
T ss_dssp             -------TTCHHHHHHHHTTTCCTTCCCTTCCCHHHHHHHHTCHHHHHHHHHH-TCCTTCCCSSCCCHHHHHHHSSCSHH
T ss_pred             -------CCCHHHHHHHHhcCCCCCCCCCCCCCHHHHHHHcCCHHHHHHHHhC-CccCCCCCCCCCCHHHHHHHcCcHHH
Confidence                   567788888887665  44578899999999999999999999998 88999999999999999999999999


Q ss_pred             HHHHHhcCcccccccccccCCCCcHhHHHhhcCCCCCcCCcchhhhhHHHHH-HhhcCCChhhhhhhhh
Q 038131          412 YQLLLKTTIMKDSVFRKVDDQGNSALHLAATLGDHKPWLTPGAALQMQWELR-WYEQDKSAEDLFTETH  479 (654)
Q Consensus       412 v~~Ll~~~~~~~~~~~~~D~~G~TpLh~Aa~~g~~~~~~~~~~~~~~~~~~~-~~~~g~t~~di~~~~~  479 (654)
                      |++|+++++    ++|.+|..|+||||+|++.|+.+++...   ++...+.. ..++|.||.+++.+..
T Consensus       327 v~~Ll~~ga----d~n~~~~~g~t~L~~A~~~g~~~iv~~L---l~~ga~~~~~~~~g~t~l~~A~~~g  388 (437)
T 1n11_A          327 VKFLLQHQA----DVNAKTKLGYSPLHQAAQQGHTDIVTLL---LKNGASPNEVSSDGTTPLAIAKRLG  388 (437)
T ss_dssp             HHHHHHTTC----CTTCCCTTSCCHHHHHHHTTCHHHHHHH---HHTTCCSCCCCSSSCCHHHHHHHTT
T ss_pred             HHHHHhcCC----CCCCCCCCCCCHHHHHHHCChHHHHHHH---HHCcCCCCCCCCCCCCHHHHHHHcC
Confidence            999999998    9999999999999999999985443211   00000011 1238999999987664
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Back     alignment and structure
>4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Back     alignment and structure
>4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Back     alignment and structure
>4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Back     alignment and structure
>4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Back     alignment and structure
>4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A Back     alignment and structure
>4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Back     alignment and structure
>4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* Back     alignment and structure
>4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 654
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 1e-09
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 9e-08
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 6e-07
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 1e-06
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 1e-06
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 2e-06
d1n11a_ 408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 4e-06
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 2e-08
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 1e-07
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 7e-06
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 4e-04
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 7e-04
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 0.001
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 0.004
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 2e-07
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 2e-05
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 3e-07
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 5e-06
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 0.003
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 2e-05
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 6e-04
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 6e-05
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 2e-04
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 0.001
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 0.003
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 9e-05
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 4e-04
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 0.001
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 0.003
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: beta-hairpin-alpha-hairpin repeat
superfamily: Ankyrin repeat
family: Ankyrin repeat
domain: Ankyrin-R
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 58.4 bits (140), Expect = 1e-09
 Identities = 25/96 (26%), Positives = 44/96 (45%), Gaps = 10/96 (10%)

Query: 25  TPLHIAAGLGNVSMCKCI--ATADPRLIGERNHENETPFFLAALHGHKDAFLCLHYLCAS 82
           TPLH+A+ +G++ + K +    A P      N + ETP  +AA  GH +    L    A 
Sbjct: 2   TPLHVASFMGHLPIVKNLLQRGASPN---VSNVKVETPLHMAARAGHTEVAKYLLQNKAK 58

Query: 83  VDDGYTYSRRNEGDTVLHCAISGDYFDLAFQIIHRC 118
           V+     ++  +  T LHCA    + ++   ++   
Sbjct: 59  VN-----AKAKDDQTPLHCAARIGHTNMVKLLLENN 89
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query654
d1n11a_408 Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1n11a_408 Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1uoha_223 26S proteasome non-ATPase regulatory subunit 10, g 100.0
d1oy3d_255 Transcription factor inhibitor I-kappa-B-beta, IKB 100.0
d1uoha_223 26S proteasome non-ATPase regulatory subunit 10, g 100.0
d1ixva_229 26S proteasome non-ATPase regulatory subunit 10, g 100.0
d1oy3d_255 Transcription factor inhibitor I-kappa-B-beta, IKB 100.0
d1s70b_291 Myosin phosphatase targeting subunit 1, MYPT1 {Chi 100.0
d2fo1e1277 Lin-12 {Caenorhabditis elegans [TaxId: 6239]} 100.0
d1wdya_285 RNase L, 2-5a-dependent ribonuclease {Human (Homo 99.98
d1k1aa_228 bcl-3 {Human (Homo sapiens) [TaxId: 9606]} 99.97
d1iknd_221 I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 99.97
d1ixva_229 26S proteasome non-ATPase regulatory subunit 10, g 99.96
d1ot8a_209 Neurogenic locus notch receptor domain {Fruit fly 99.96
d1s70b_291 Myosin phosphatase targeting subunit 1, MYPT1 {Chi 99.96
d1iknd_221 I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 99.96
d1ot8a_209 Neurogenic locus notch receptor domain {Fruit fly 99.95
d2ajaa1346 Hypothetical protein LPG2416 {Legionella pneumophi 99.95
d2fo1e1277 Lin-12 {Caenorhabditis elegans [TaxId: 6239]} 99.94
d1wdya_285 RNase L, 2-5a-dependent ribonuclease {Human (Homo 99.94
d1ihba_156 p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] 99.94
d1k1aa_228 bcl-3 {Human (Homo sapiens) [TaxId: 9606]} 99.93
d1sw6a_301 Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch 99.92
d1bd8a_156 Cell cycle inhibitor p19ink4D {Human (Homo sapiens 99.92
d2ajaa1346 Hypothetical protein LPG2416 {Legionella pneumophi 99.91
d1awcb_153 GA bindinig protein (GABP) beta 1 {Mouse (Mus musc 99.91
d1awcb_153 GA bindinig protein (GABP) beta 1 {Mouse (Mus musc 99.91
d1ihba_156 p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] 99.91
d1bi7b_125 Cell cycle inhibitor p16ink4A {Human (Homo sapiens 99.9
d1bd8a_156 Cell cycle inhibitor p19ink4D {Human (Homo sapiens 99.9
d1sw6a_301 Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch 99.9
d1myoa_118 Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] 99.9
d1ycsb1130 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 99.89
d1dcqa1154 Pyk2-associated protein beta {Mouse (Mus musculus) 99.85
d1dcqa1154 Pyk2-associated protein beta {Mouse (Mus musculus) 99.84
d1bi7b_125 Cell cycle inhibitor p16ink4A {Human (Homo sapiens 99.83
d1ycsb1130 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 99.83
d1myoa_118 Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] 99.82
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: beta-hairpin-alpha-hairpin repeat
superfamily: Ankyrin repeat
family: Ankyrin repeat
domain: Ankyrin-R
species: Human (Homo sapiens) [TaxId: 9606]

Probab=100.00  E-value=3.3e-40  Score=349.70  Aligned_cols=334  Identities=18%  Similarity=0.226  Sum_probs=266.6

Q ss_pred             hhHHHHHhcccccccccCCCCCChHHHHHHhcCCHHHHHHHHhhCCccccCCCCCCChHHHHHHHcCCHHHHHHHHhhcC
Q 038131            2 DLVGIIQEKQQLKVLKIGDERGSTPLHIAAGLGNVSMCKCIATADPRLIGERNHENETPFFLAALHGHKDAFLCLHYLCA   81 (654)
Q Consensus         2 ~iv~~Ll~~~~~~~l~~~d~~g~T~Lh~Aa~~G~~~~v~~Ll~~~~~~~~~~d~~G~TpLh~Aa~~g~~~iv~~Ll~~g~   81 (654)
                      ++|++|+++|+  ++|.+|..|+||||+||..|+.++|++|+++|++ ++.+|.+|+||||+|+..|+.+++++|+..+.
T Consensus        14 ~~v~~Ll~~g~--~in~~d~~g~TpL~~A~~~g~~~iv~~Ll~~gad-i~~~~~~g~t~L~~A~~~g~~~~~~~Ll~~~~   90 (408)
T d1n11a_          14 PIVKNLLQRGA--SPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAK-VNAKAKDDQTPLHCAARIGHTNMVKLLLENNA   90 (408)
T ss_dssp             HHHHHHHHTTC--CSCCSSSCCCCHHHHHHHHTCHHHHHHHHHHTCC-SSCCCTTSCCHHHHHHHHTCHHHHHHHHHHTC
T ss_pred             HHHHHHHHCCC--CCCCCCCCCCCHHHHHHHcCCHHHHHHHHHCcCC-CCCCCCCCCCHHHHHHHcCCHHHHHHHHHhhh
Confidence            68999999998  7999999999999999999999999999999998 99999999999999999999999999998877


Q ss_pred             CCCC----------------------------CCccccCCCCCcHHHHHHHcCCHHHHHHHHHhccccccccccCCCCHH
Q 038131           82 SVDD----------------------------GYTYSRRNEGDTVLHCAISGDYFDLAFQIIHRCEKLVNSVNEQGVSPL  133 (654)
Q Consensus        82 ~~~~----------------------------~~~~~~~~~g~T~Lh~A~~~g~~~~v~~Ll~~~~~~~~~~d~~g~TpL  133 (654)
                      +...                            ......+..+.++|+.|+..++.++++.|++++.+ ++..+.+|.+||
T Consensus        91 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~a~~~~~~~~v~~ll~~~~~-~~~~~~~~~~~L  169 (408)
T d1n11a_          91 NPNLATTAGHTPLHIAAREGHVETVLALLEKEASQACMTKKGFTPLHVAAKYGKVRVAELLLERDAH-PNAAGKNGLTPL  169 (408)
T ss_dssp             CTTCCCTTCCCHHHHHHHHTCHHHHHHHHHTTCCSCCCCTTSCCHHHHHHHTTCHHHHHHHHHTTCC-TTCCCSSCCCHH
T ss_pred             ccccccccccchhhhhhhhcccccccccccccccccccccccchHHHHHHHcCCHHHHHHHHHcCCC-CCcCCCcCchHH
Confidence            6541                            12335678899999999999999999999999987 999999999999


Q ss_pred             HHHhcCCCCCccCCchHHHHHHhhccCcccccchhhhhhhhhhhhccccCCCCchHHHHhhHHHHHHHHHHHHhcCCCCC
Q 038131          134 HLLATKPNAFRSGSHLGLCTGIIYHCISVDKLQEETSYDQYQLETSKKQTNYPENYETCLNFIRLLKTMFIVLSNRGNTK  213 (654)
Q Consensus       134 h~A~~~~~~~~~~~~~~~v~~Ll~~~~~~~~~~~~~~~~~~~l~~~~~~~~~p~~~~~~~~~~~~~~~~l~~l~~~g~~~  213 (654)
                      |+|+..+       +.+++++|+.+|++++..+              ..+.+|.++............++.    .+...
T Consensus       170 ~~A~~~~-------~~~~~~~Ll~~g~~~~~~~--------------~~~~t~l~~~~~~~~~~~~~~l~~----~~~~~  224 (408)
T d1n11a_         170 HVAVHHN-------NLDIVKLLLPRGGSPHSPA--------------WNGYTPLHIAAKQNQVEVARSLLQ----YGGSA  224 (408)
T ss_dssp             HHHHHTT-------CHHHHHHHGGGTCCSCCCC--------------TTCCCHHHHHHHTTCHHHHHHHHH----TTCCT
T ss_pred             HHHHHcC-------CHHHHHHHHhcCCcccccC--------------CCCCCcchhhhccchhhhhhhhhh----ccccc
Confidence            9999999       8999999999999887665              345566666555444433333222    11111


Q ss_pred             CCCCCCCCCCccccCCCCCCCCCCCcccccCCCCCCCCCCCCcchhhHHHHHHhhhhhHHHHHHhhchHHHHHHHHHhhh
Q 038131          214 KEQTPTDAEDPERSKGIDDSGDQGEESRHNFGAQGHQFFPPNYGTCFEFVKLVMLVPKAMLVILALGSTKIRKIREKKQK  293 (654)
Q Consensus       214 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~~~vk~L~~~~~~~~~~~~~g~~~~~~~~~~~~~  293 (654)
                      ... ...                                                           |.+.+..  +....
T Consensus       225 ~~~-~~~-----------------------------------------------------------~~t~l~~--a~~~~  242 (408)
T d1n11a_         225 NAE-SVQ-----------------------------------------------------------GVTPLHL--AAQEG  242 (408)
T ss_dssp             TCC-CTT-----------------------------------------------------------CCCHHHH--HHHTT
T ss_pred             ccc-CCC-----------------------------------------------------------CCCHHHH--HHHhC
Confidence            100 000                                                           1111111  11111


Q ss_pred             hhhHHHHHHHHHHcc-ccccccCCCCCCCCCCCCccccCCCCCCCccCCCCchhhhccccCCC--ccccCCCCcHHHHHH
Q 038131          294 HTWSVQILDELLRRA-SLYEYDDDGGKPLRRPSSQAEEDETSPYPIVDGGDTDAVLEGKTGST--IPDMAKRETPILIAA  370 (654)
Q Consensus       294 ~~~~~~il~~Ll~~~-~~~~~d~~g~tpLh~a~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~--~~~~~~g~tpLh~Aa  370 (654)
                      .   .++++.++... .....|.+|.||||.++.              .+..+.++.+++.+.  +..+..+.||||.|+
T Consensus       243 ~---~~~~~~~~~~~~~~~~~~~~g~~~l~~a~~--------------~~~~~i~~~Ll~~g~~~~~~~~~~~t~L~~~~  305 (408)
T d1n11a_         243 H---AEMVALLLSKQANGNLGNKSGLTPLHLVAQ--------------EGHVPVADVLIKHGVMVDATTRMGYTPLHVAS  305 (408)
T ss_dssp             C---HHHHHHHHTTTCCTTCCCTTCCCHHHHHHH--------------HTCHHHHHHHHHHTCCTTCCCSSCCCHHHHHH
T ss_pred             c---HhHhhhhhccccccccccCCCCChhhhhhh--------------cCcHHHHHHHHHCCCccccccccccccchhhc
Confidence            1   56777777776 555678889999988877              445566666665443  445678999999999


Q ss_pred             HcChHHHHHHHHHHCCCccccccCCCCchhHHHHHcCChHHHHHHHhcCcccccccccccCCCCcHhHHHhhcCCCCC
Q 038131          371 KNGITEIVEKILESFPVAIHDINSEKKNIVLLAVENRQPHVYQLLLKTTIMKDSVFRKVDDQGNSALHLAATLGDHKP  448 (654)
Q Consensus       371 ~~G~~eiv~~LL~~~~~~~~~~d~~G~T~Lh~Av~~~~~~iv~~Ll~~~~~~~~~~~~~D~~G~TpLh~Aa~~g~~~~  448 (654)
                      ..|+.++++++++. +.+++.+|.+|+||||+|+++|+.++|++|+++|+    ++|.+|++|+||||+|++.|+.++
T Consensus       306 ~~~~~~~~~~ll~~-g~~in~~d~~G~T~Lh~A~~~g~~~iv~~Ll~~GA----d~n~~d~~G~t~L~~A~~~~~~~i  378 (408)
T d1n11a_         306 HYGNIKLVKFLLQH-QADVNAKTKLGYSPLHQAAQQGHTDIVTLLLKNGA----SPNEVSSDGTTPLAIAKRLGYISV  378 (408)
T ss_dssp             HSSCSHHHHHHHHT-TCCTTCCCTTSCCHHHHHHHTTCHHHHHHHHHTTC----CSCCCCSSSCCHHHHHHHTTCHHH
T ss_pred             ccCcceeeeeeccc-cccccccCCCCCCHHHHHHHcCCHHHHHHHHHCCC----CCCCCCCCCCCHHHHHHHcCCHHH
Confidence            99999999999996 89999999999999999999999999999999998    999999999999999999999443
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure