Citrus Sinensis ID: 038165

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-

MGNLISTFLQPDFFNRTLNCVGQQAKYIWGLEKNLEGLETELHKLTRTRDDLKTRVEVEEQRPRTRRTNQVAGWLEDVQKLENEFTKLQQVKAQEMDRLCLGGLCSKNLASSYDFGRKVVMLTDRVINLRKDGEKIEVVVEKAPDGAAIELPLAQTIVGQELLVDRLAETLARECGGLPLALKTVGRAMKSQRKVGDWKRAIHKMTTSASKFSGMKEEVFSRLKFSYDSLSTDELRSCLLYCCLYPEDYEIPRRELIDYWISEGFVYDFDDGCDFIDDLLQACLLEEEGDDHVKMHDMIREMSLWIACTVDKEEQNFLVRAGVKLTEAPKIEEWEGAKRVSLMGNGIESLSEIPTCPRLVTLLVDENPIVEITDGFFQSMSSLRVLSLSENFHLSTLPSGISSLVSLHHLDLSSADITGLPQELKALEKLRYLNLEYAFNLSIIPHQLISGFSNLEVLRLRGCGCCSVTEEEEANVLCADAEPLMKELLGLKRLNVLSWTFRSSLAVQKFLKYPKLVSITQSVWVYQCESAPFNVLHLAYMENLQELDLEYCNLEEMKIDCPEEVKKLFRNGFRSLNTVVLRSCRGKDLTWLVFVQNLKVLYIGFCGDMEEIVSVDKLRDISGIIGSERNFFAQLESLSVWRGINLKSVYPNPLPFPKLKKIEVRECRQLKKLPLNSSSAKERRVVIEGSKEWWEELQWEDQATQNAFSPGFSQGHFGLGRSGGLLPSQAL

cccccHHHHHHHHHHHcccccccccEEEEEEEEcHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccEEEEEEccHHHHHHccccEEEEccccccHHHHccccccccccccccHHHHHHHHHHHHccccHHHHHHHHcccccccHHHHHHHHHHHHccccccccccccccHHHHcccccccccHHHHHHHHHccccccccccHHHHHHHHHHcccccccccHHHHHHHHHHccccccccccEEEEcccHHHHHHHHHHHHccccccEEEEccccccccccccccccEEEEEEEcccccccccccccccEEEEccccccccccccHHHcccccccEEEcccccccccccccccccccccEEcccccccccccHHHHccccccEEccccccccccccHHHHcccccccEEEEcccccccccHHHHHHHHHcccccccccccccccccEEEEEEEcHHHHHHHcccccccccccEEEEEEEccccccccccccccccEEEEEEEcccccEEEcccccccccccccccccEEEEEEcccccccccccccccccEEEEEccccccccccccccccccccccccccccccccEEEccccccccEEcccccccccccEEEEccccccccccccccccccccEEEEccHHHHHHHccccccHHHHcccccccccccccccccccccccc

cccEEEEEccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHcHHHEHHcccccHcHcHccccccccEEEEEEcccccEEEEEEccHHHHHHccccccEEEEEccHHHHHHHHHccccccccccHHHHHHHHHHHHcccHHHHHHHHHHHHccccHHHHHHHHHHHHHcHHHccccccccHHHHEEcHcccccHHHHHHHHEHEcccccccccHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHcccccccEEEHHHHHHHHHHHHHHHcHcHHHEEEEcccccccccccccHHHHHEHHcccccHHHccccccccccEEEEEcccccccccHHHHccccccEEEEEcccccccccccccccccccEEEEccccccccccHHHcccccccEEEEccccccccccHcHHcccccccEEEEcccccccccccHccccccccHHHcHHHHcccccccEEEEEEcccccHHHHccccccccccEEEEEcccccccccHHcccccccccEEEEEccccccccccccccccccccccccccEEEEEEcccccccccccccccccEEEEcccccHcccccccccccHHHHccccccccccccEEEEcccHcHHHccccccccccccEEEEcccccHHccccccccHHHcEEEEcccHHHHHHcccccHHHHHHHccccccEEEEccccccccccccc

mgnlistflqpdffnrtlncvGQQAKYIWGLEKNLEGLETELHKLTRTRDDLKTRVEveeqrprtrrtnqvAGWLEDVQKLENEFTKLQQVKAQEMDRLClgglcsknlassydfgrKVVMLTDRVINLRKDGEKIEVVVEkapdgaaielplaQTIVGQELLVDRLAETLARECGGLPLALKTVGRAMKSQRKVGDWKRAIHKMTtsaskfsgmKEEVFSRLKfsydslstdeLRSCLLYCclypedyeiprRELIDYWIsegfvydfddgcDFIDDLLQACLLeeegddhvKMHDMIREMSLWIACTVDKEEQNFLVRAGvklteapkieewegAKRVSLmgngieslseiptcprlvtllvdenpiveitdgffqsMSSLRVLslsenfhlstlpsgisSLVSLhhldlssaditGLPQELKALEKLRYLNLEYAfnlsiiphqlisgfsnLEVLRLrgcgccsvteeEEANVLCADAEPLMKELLglkrlnvlswTFRSSLAVQKFLKYPKLVSITQSVWVYQCESAPFNVLHLAYMENLQELDLEYcnleemkidcPEEVKKLFRNGFRSLNTVVLRSCRGKDLTWLVFVQNLKVLYIGfcgdmeeiVSVDKLRDISGIIGSERNFFAQLESLSVWRGinlksvypnplpfpklkkIEVRECRqlkklplnsssakERRVVIEGSKEWWEELQWEDQatqnafspgfsqghfglgrsggllpsqal

MGNLISTFLQPDFFNRTLNCVGQQAKYIWGLEKNLEGLETElhkltrtrddlktrveveeqrprtrrtnqvagwledVQKLENEFTKLQQVKAQEMDRLCLGGLCSKNLASSYDFGRKVVMLTDRVinlrkdgekiEVVVEKAPDGAAIELPLAQTIVGQELLVDRLAETLARECgglplalktvgramksqrkvgdwkrAIHKmttsaskfsgmkEEVFSRLKFSYDSLSTDELRSCLLYCCLYPEDYEIPRRELIDYWISEGFVYDFDDGCDFIDDLLQACLLEEEGDDHVKMHDMIREMSLWIACTVDKEEQNFLVRagvklteapkieewegakRVSLMGNGIESLSEIPTCPRLVTLLVDENPIVEITDGFFQSMSSLRVLSLSENFHLSTLPSGISSLVSLHHLDLSSADITGLPQELKALEKLRYLNLEYAFNLSIIPHQLISGFSNLEVLRLRGCGCCSVTEEEEANVLCADAEPLMKELLGLKRLNVLSWTFRSSLAVQKFLKYPKLVSITQSVWVYQCESAPFNVLHLAYMENLQELDLEYCNLEEMKIDCPEEVKKLFRNGFRSLNTVVLRSCRGKDLTWLVFVQNLKVLYIGFCGDMEEIVSVDKLRDISGIIGSERNFFAQLESLSVWRGINLKsvypnplpfpklKKIEVRECRqlkklplnsssakerrVVIEGSKEWWEELQWEDQATQNAFSPGFSQGHFglgrsggllpsqal

MGNLISTFLQPDFFNRTLNCVGQQAKYIWGLEKNLEGLETELHKLTRTRDDLKTRVEVEEQRPRTRRTNQVAGWLEDVQKLENEFTKLQQVKAQEMDRLCLGGLCSKNLASSYDFGRKVVMLTDRVINLRKDGEKIEVVVEKAPDGAAIELPLAQTIVGQELLVDRLAETLARECGGLPLALKTVGRAMKSQRKVGDWKRAIHKMTTSASKFSGMKEEVFSRLKFSYDSLSTDELRSCLLYCCLYPEDYEIPRRELIDYWISEGFVYdfddgcdfiddLLQACLLEEEGDDHVKMHDMIREMSLWIACTVDKEEQNFLVRAGVKLTEAPKIEEWEGAKRVSLMGNGIESLSEIPTCPRLVTLLVDENPIVEITDGFFQSMSSLRVLSLSENFHLSTLPSGIsslvslhhldlssADITGLPQELKALEKLRYLNLEYAFNLSIIPHQLISGFSNLEVLRLRGCGCCSVTEEEEANVLCADAEPLMKELLGLKRLNVLSWTFRSSLAVQKFLKYPKLVSITQSVWVYQCESAPFNVLHLAYMENLQELDLEYCNLEEMKIDCPEEVKKLFRNGFRSLNTVVLRSCRGKDLTWLVFVQNLKVLYIGFCGDMEEIVSVDKLRDISGIIGSERNFFAQLESLSVWRGINLKSVYPNPLPFPKLKKIEVRECRQLKKLPLNSSSAKERRVVIEGSKEWWEELQWEDQATQNAFSPGFSQGHFGLGRSGGLLPSQAL

***LISTFLQPDFFNRTLNCVGQQAKYIWGLEKNLEGLETELHK**************************VAGWLEDVQKLENEFTKLQQVKAQEMDRLCLGGLCSKNLASSYDFGRKVVMLT*********************DGAAIELPLAQTIVGQELLVDRLAETLARECGGLPLALKTVGRAMKSQRKVGDWKRAIHKM***********EEVFSRLKFSYDSLSTDELRSCLLYCCLYPEDYEIPRRELIDYWISEGFVYDFDDGCDFIDDLLQACLLEEEGDDHVKMHDMIREMSLWIACTVDKEEQNFLVRAGVKLTEAPKIEEWEGAKRVSLMGNGIESLSEIPTCPRLVTLLVDENPIVEITDGFFQSMSSLRVLSLSENFHLSTLPSGISSLVSLHHLDLSSADITGLPQELKALEKLRYLNLEYAFNLSIIPHQLISGFSNLEVLRLRGCGCCSVTEEEEANVLCADAEPLMKELLGLKRLNVLSWTFRSSLAVQKFLKYPKLVSITQSVWVYQCESAPFNVLHLAYMENLQELDLEYCNLEEMKIDCPEEVKKLFRNGFRSLNTVVLRSCRGKDLTWLVFVQNLKVLYIGFCGDMEEIVSVDKLRDISGIIGSERNFFAQLESLSVWRGINLKSVYPNPLPFPKLKKIEVRECRQL*************RVVIEGSKEWWEELQWEDQ*****************************

MGNLISTFLQPDFFNRTLNCVGQQAKYIWGLEKNLEGLETELHKLTRTRDDLK***************NQVAGWLEDVQKLENEFTKLQQVKAQEMDRLCLGGLCSKNLASSYDFGRKVVMLTDRVINLRKDGEKIEVVVEKAPDGAAIELPLAQTIVGQELLVDRLAETLARECGGLPLALKTVGRAMKSQRKVGDWKRAIHKMTT*********EEVFSRLKFSYDSLSTDELRSCLLYCCLYPEDYEIPRRELIDYWISEGFVYDFDDGCDFIDDLLQACLLEEEGDDHVKMHDMIREMSLWIACTVDKEEQNFLVRAGVKLTEAPKIEEWEGAKRVSLMGNGIESLSEIPTCPRLVTLLVDENPIVEITDGFFQSMSSLRVLSLSENFHLSTLPSGISSLVSLHHLDLSSADITGLPQELKALEKLRYLNLEYAFNLSIIPHQLISGFSNLEVLRLRGCGCCSVTEEEEANV*******L**ELLGLKRLNVLSWTFRSSLAVQKFLKYPKLVSITQSVWVYQCESAPFNVLHLAYMENLQELDLEYCNLEEMKIDCPEEVKKLFRNGFRSLNTVVLRSCRGKDLTWLVFVQNLKVLYIGFCGDMEEIVSVDKLRD********RNFFAQLESLSVWRGINLKSVYPNPLPFPKLKKIEVRECRQLKKLPLNS*********IEGSKEWWEELQWEDQATQNAFSPGFSQGHFGLGRSGGLLPS***

MGNLISTFLQPDFFNRTLNCVGQQAKYIWGLEKNLEGLETELHKLTRTRDDLKTRV************NQVAGWLEDVQKLENEFTKLQQVKAQEMDRLCLGGLCSKNLASSYDFGRKVVMLTDRVINLRKDGEKIEVVVEKAPDGAAIELPLAQTIVGQELLVDRLAETLARECGGLPLALKTVG***********WKRAIHKMTTSASKFSGMKEEVFSRLKFSYDSLSTDELRSCLLYCCLYPEDYEIPRRELIDYWISEGFVYDFDDGCDFIDDLLQACLLEEEGDDHVKMHDMIREMSLWIACTVDKEEQNFLVRAGVKLTEAPKIEEWEGAKRVSLMGNGIESLSEIPTCPRLVTLLVDENPIVEITDGFFQSMSSLRVLSLSENFHLSTLPSGISSLVSLHHLDLSSADITGLPQELKALEKLRYLNLEYAFNLSIIPHQLISGFSNLEVLRLRGCGCCSVTEEEEANVLCADAEPLMKELLGLKRLNVLSWTFRSSLAVQKFLKYPKLVSITQSVWVYQCESAPFNVLHLAYMENLQELDLEYCNLEEMKIDCPEEVKKLFRNGFRSLNTVVLRSCRGKDLTWLVFVQNLKVLYIGFCGDMEEIVSVDKLRDISGIIGSERNFFAQLESLSVWRGINLKSVYPNPLPFPKLKKIEVRECRQLKKLPL**********VIEGSKEWWEELQWEDQATQNAFSPGFSQGHFGLGRSGGLLPSQAL

*GNLISTFLQPDFFNRTLNCVGQQAKYIWGLEKNLEGLETELHKLTRTRDDLKTRVEVEEQRPRTRRTNQVAGWLEDVQKLENEFTKLQQVKAQEMDRLCLGGLCSKNLASSYDFGRKVVMLTDRVINLRKDGEKIEVVVEKAPDGAAIELPLAQTIVGQELLVDRLAETLARECGGLPLALKTVGRAMKSQRKVGDWKRAIHKMTTSASKFSGMKEEVFSRLKFSYDSLSTDELRSCLLYCCLYPEDYEIPRRELIDYWISEGFVYDFDDGCDFIDDLLQACLLEEEGDDHVKMHDMIREMSLWIACTVDKEEQNFLVRAGVKLTEAPKIEEWEGAKRVSLMGNGIESLSEIPTCPRLVTLLVDENPIVEITDGFFQSMSSLRVLSLSENFHLSTLPSGISSLVSLHHLDLSSADITGLPQELKALEKLRYLNLEYAFNLSIIPHQLISGFSNLEVLRLRGCGCCSVTEEEEANVLCADAEPLMKELLGLKRLNVLSWTFRSSLAVQKFLKYPKLVSITQSVWVYQCESAPFNVLHLAYMENLQELDLEYCNLEEMKIDCPEEVKKLFRNGFRSLNTVVLRSCRGKDLTWLVFVQNLKVLYIGFCGDMEEIVSVDKLRDISGIIGSERNFFAQLESLSVWRGINLKSVYPNPLPFPKLKKIEVRECRQLKKLPLNSSSAKERRVVIEGSKEWWEELQWEDQATQNAFSPGFSQGHFGLGRS*********

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MGNLISTFLQPDFFNRTLNCVGQQAKYxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxPRTRRTNQxxxxxxxxxxxxxxxxxxxxxxxxxxxxLCLGGLCSKNLASSYDFGRKVVMLTDRVINLRKDGEKIEVVVEKAPDGAAIELPLAQTIVGQELLVDRLAETLARECGGLPLALKTVGRAMKSQRKVGDWKRAIHKMTTSASKFSGMKEEVFSRLKFSYDSLSTDELRSCLLYCCLYPEDYEIPRRELIDYWISEGFVYDFDDGCDFIDDLLQACLLEEEGDDHVKMHDMIREMSLWIACTVDKEEQNFLVRAGVKLTEAPKIEEWEGAKRVSLMGNGIESLSEIPTCPRLVTLLVDENPIVEITDGFFQSMSSLRVLSLSENFHLSTLPSGISSLVSLHHLDLSSADITGLPQELKALEKLRYLNLEYAFNLSIIPHQLISGFSNLEVLRLRGCGCCSVTEEEEANVLCADAEPLMKELLGLKRLNVLSWTFRSSLAVQKFLKYPKLVSITQSVWVYQCESAPFNVLHLAYMENLQELDLEYCNLEEMKIDCPEEVKKLFRNGFRSLNTVVLRSCRGKDLTWLVFVQNLKVLYIGFCGDMEEIVSVDKLRDISGIIGSERNFFAQLESLSVWRGINLKSVYPNPLPFPKLKKIEVRECRQLKKLPLNSSSAKERRVVIEGSKEWWEELQWEDQATQNAFSPGFSQGHFGLGRSGGLLPSQAL

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		731	2.2.26 [Sep-21-2011]
O64973		889	Disease resistance protei	yes	no	0.742	0.610	0.392	1e-99
Q8RXS5		888	Probable disease resistan	no	no	0.745	0.613	0.379	6e-96
Q8L3R3		885	Disease resistance protei	no	no	0.735	0.607	0.379	5e-88
Q9C8T9		898	Putative disease resistan	no	no	0.737	0.600	0.368	8e-86
P60838		894	Probable disease resistan	no	no	0.730	0.597	0.379	1e-85
O82484		892	Putative disease resistan	no	no	0.735	0.603	0.361	2e-83
Q9FLB4		874	Putative disease resistan	no	no	0.711	0.594	0.362	2e-82
P60839		884	Probable disease resistan	no	no	0.714	0.590	0.380	1e-80
Q940K0		889	Probable disease resistan	no	no	0.705	0.580	0.362	7e-80
Q9SH22		884	Probable disease resistan	no	no	0.719	0.595	0.346	7e-79

>sp\|O64973\|RPS5_ARATH Disease resistance protein RPS5 OS=Arabidopsis thaliana GN=RPS5 PE=1 SV=2	Back alignment and function desciption

 Score =  364 bits (935), Expect = 1e-99,   Method: Compositional matrix adjust.
 Identities = 227/578 (39%), Positives = 329/578 (56%), Gaps = 35/578 (6%)

Query: 150 ELPLAQTIVGQELLVDRLAETLARECGGLPLALKTVGRAMKSQRKVGDWKRAIHKMTTSA 209
           ++ + +  +G    +  LA  +AR+C GLPLAL  +G AM  +R V +W  AI  +T+SA
Sbjct: 323 QMKVGKNTLGSHPDIPGLARKVARKCRGLPLALNVIGEAMACKRTVHEWCHAIDVLTSSA 382

Query: 210 SKFSGMKEEVFSRLKFSYDSLSTDELRSCLLYCCLYPEDYEIPRRELIDYWISEGFV--- 266
             FSGM++E+   LK+SYD+L+ + ++SC LYC L+PEDY I +  L+DYWISEGF+   
Sbjct: 383 IDFSGMEDEILHVLKYSYDNLNGELMKSCFLYCSLFPEDYLIDKEGLVDYWISEGFINEK 442

Query: 267 ----YDFDDGCDFIDDLLQACLL--EEEGDDHVKMHDMIREMSLWIACTVDKEEQNFLVR 320
                + + G + I  L++ACLL  EE    +VKMHD++REM+LWI+  + K+++  +VR
Sbjct: 443 EGRERNINQGYEIIGTLVRACLLLEEERNKSNVKMHDVVREMALWISSDLGKQKEKCIVR 502

Query: 321 AGVKLTEAPKIEEWEGAKRVSLMGNGIESLSEIPTCPRLVTLLVDENPIVEITDGFFQSM 380
           AGV L E PK+++W   +++SLM N IE + +   C  L TL + +N +V+I+  FF+ M
Sbjct: 503 AGVGLREVPKVKDWNTVRKISLMNNEIEEIFDSHECAALTTLFLQKNDVVKISAEFFRCM 562

Query: 381 SSLRVLSLSENFHLSTLPSGISSLVSLHHLDLSSADITGLPQELKALEKLRYLNLEYAFN 440
             L VL LSEN  L+ LP  IS L SL + +LS   I  LP  L  L+KL +LNLE+  +
Sbjct: 563 PHLVVLDLSENQSLNELPEEISELASLRYFNLSYTCIHQLPVGLWTLKKLIHLNLEHMSS 622

Query: 441 LSIIPHQLISGFSNLEVLRLRGCGCCSVTEEEEANVLCADAEPLMKELLGLKRLNVLSWT 500
           L  I    IS   NL  L LR             + L  D   L+KEL  L+ L V++  
Sbjct: 623 LGSILG--ISNLWNLRTLGLRD------------SRLLLDM-SLVKELQLLEHLEVITLD 667

Query: 501 FRSSLAVQKFLKYPKLVSITQSVWVYQCESAPFNVLHLAYMENLQELDLEYCNLEEMKID 560
             SSL  +  L   +LV   + V     +     VL L  M NL++L ++ C + E+KI+
Sbjct: 668 ISSSLVAEPLLCSQRLVECIKEVDFKYLKEESVRVLTLPTMGNLRKLGIKRCGMREIKIE 727

Query: 561 ----CPEEVKKLFRNGFRSLNTVVLRSCRG-KDLTWLVFVQNLKVLYIGFCGDMEEIVSV 615
                    K      F +L+ V +  C G KDLTWL+F  NL  L +GF  ++E+I+S 
Sbjct: 728 RTTSSSSRNKSPTTPCFSNLSRVFIAKCHGLKDLTWLLFAPNLTFLEVGFSKEVEDIISE 787

Query: 616 DKLRDISGIIGSERNFFAQLESLSVWRGINLKSVYPNPLPFPKLKKIEVRECRQLKKLPL 675
           +K  + S  I      F +LE+L ++    LK +Y   L FP LK I V +C +L+KLPL
Sbjct: 788 EKAEEHSATIVP----FRKLETLHLFELRGLKRIYAKALHFPCLKVIHVEKCEKLRKLPL 843

Query: 676 NSSS--AKERRVVIEGSKEWWEELQWEDQATQNAFSPG 711
           +S S  A E  V+  G +EW E ++WEDQATQ  F P 
Sbjct: 844 DSKSGIAGEELVIYYGEREWIERVEWEDQATQLRFLPS 881

Disease resistance (R) protein that specifically recognizes the avrPphB type III effector avirulence protein from Pseudomonas syringae. Also confers resistance against Hyaloperonospora parasitica (downy mildew). Resistance proteins guard the plant against pathogens that contain an appropriate avirulence protein via an indirect interaction with this avirulence protein. That triggers a defense system including the hypersensitive response, which restricts the pathogen growth. Requires PBS1 to trigger the defense reaction against avrPphB. Probably triggers the defense mechanism when PBS1 is cleaved by avrPphB, suggesting that it detects indirectly the protease activity of avrPphB, and possibly binds to the cleaved RPS5.
Arabidopsis thaliana (taxid: 3702)

>sp\|Q8RXS5\|DRL40_ARATH Probable disease resistance protein At5g63020 OS=Arabidopsis thaliana GN=At5g63020 PE=2 SV=2	Back alignment and function description

>sp\|Q8L3R3\|RFL1_ARATH Disease resistance protein RFL1 OS=Arabidopsis thaliana GN=RFL1 PE=3 SV=2	Back alignment and function description

>sp\|Q9C8T9\|DRL19_ARATH Putative disease resistance protein At1g63350 OS=Arabidopsis thaliana GN=At1g63350 PE=2 SV=1	Back alignment and function description

>sp\|P60838\|DRL1_ARATH Probable disease resistance protein At1g12280 OS=Arabidopsis thaliana GN=At1g12280 PE=3 SV=1	Back alignment and function description

>sp\|O82484\|DRL23_ARATH Putative disease resistance protein At4g10780 OS=Arabidopsis thaliana GN=At4g10780 PE=2 SV=1	Back alignment and function description

>sp\|Q9FLB4\|DRL31_ARATH Putative disease resistance protein At5g05400 OS=Arabidopsis thaliana GN=At5g05400 PE=2 SV=1	Back alignment and function description

>sp\|P60839\|DRL2_ARATH Probable disease resistance protein At1g12290 OS=Arabidopsis thaliana GN=At1g12290 PE=2 SV=1	Back alignment and function description

>sp\|Q940K0\|DRL15_ARATH Probable disease resistance protein At1g61180 OS=Arabidopsis thaliana GN=At1g61180 PE=2 SV=2	Back alignment and function description

>sp\|Q9SH22\|DRL20_ARATH Probable disease resistance protein At1g63360 OS=Arabidopsis thaliana GN=At1g63360 PE=2 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		731
24461866		890	NBS-LRR type disease resistance protein	0.757	0.622	0.484	1e-139
24461865		892	NBS-LRR type disease resistance protein	0.746	0.612	0.493	1e-132
24461864		899	NBS-LRR type disease resistance protein	0.751	0.610	0.473	1e-126
24461861		890	NBS-LRR type disease resistance protein	0.745	0.612	0.473	1e-122
24461863		889	NBS-LRR type disease resistance protein	0.751	0.617	0.466	1e-118
225443158		903	PREDICTED: probable disease resistance p	0.755	0.611	0.442	1e-117
255553103		910	Disease resistance protein RPS5, putativ	0.796	0.639	0.413	1e-113
225442867		893	PREDICTED: probable disease resistance p	0.730	0.597	0.434	1e-112
359482672		905	PREDICTED: probable disease resistance p	0.746	0.603	0.441	1e-112
224122896		820	cc-nbs-lrr resistance protein [Populus t	0.744	0.663	0.421	1e-111

>gi\|24461866\|gb\|AAN62353.1\|AF506028_20 NBS-LRR type disease resistance protein [Citrus trifoliata]	Back alignment and taxonomy information

 Score =  503 bits (1294), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 278/574 (48%), Positives = 381/574 (66%), Gaps = 20/574 (3%)

Query: 153 LAQTIVGQELL----VDRLAETLARECGGLPLALKTVGRAMKSQRKVGDWKRAIHKMTTS 208
           L Q  VG+E L    + +LA+T A+ECGGLPLAL T+GRAM  ++   +W  AI  + TS
Sbjct: 321 LFQQKVGEETLKSPDIRQLAQTAAKECGGLPLALITIGRAMACKKTPEEWTYAIEVLRTS 380

Query: 209 ASKFSGMKEEVFSRLKFSYDSLSTDELRSCLLYCCLYPEDYEIPRRELIDYWISEGFVYD 268
           +S+F G+  EV+  LKFSYDSL +D +RSCLLYCCLYPEDY I +  LID WI EGF+ +
Sbjct: 381 SSQFPGLGNEVYPLLKFSYDSLPSDTIRSCLLYCCLYPEDYCISKEILIDCWIGEGFLTE 440

Query: 269 FD------DGCDFIDDLLQACLLEEEGDDHVKMHDMIREMSLWIACTVDKEEQNFLVRAG 322
            D       G   +  LL ACLLEE GD  VKMHD++R+M+LWIAC ++KE+ NFLV AG
Sbjct: 441 RDRFGEQNQGYHILGILLHACLLEEGGDGEVKMHDVVRDMALWIACAIEKEKDNFLVYAG 500

Query: 323 VKLTEAPKIEEWEGAKRVSLMGNGIESLSEIPTCPRLVTLLVDENPIVEITDGFFQSMSS 382
           V L EAP +  WE A+R+SLM N I +LSE+ TCP L+TL ++EN +  I + FF+ M S
Sbjct: 501 VGLIEAPDVSGWEKARRLSLMHNQITNLSEVATCPHLLTLFLNENELQMIHNDFFRFMPS 560

Query: 383 LRVLSLSENFHLSTLPSGISSLVSLHHLDLSSADITGLPQELKALEKLRYLNLEYAFNLS 442
           L+VL+L+++  L+ LP GIS LVSL HLDLS + I  LP ELKAL  L+ LNLEY ++L+
Sbjct: 561 LKVLNLADS-SLTNLPEGISKLVSLQHLDLSKSSIEELPLELKALVNLKCLNLEYTWSLT 619

Query: 443 IIPHQLISGFSNLEVLRLRGCGCCSVTEEEEANVLCADAEPLMKELLGLKRLNVLSWTFR 502
            IP QLIS  S L VLR+      +     E ++L    E +++ELLGLK L V+S+T R
Sbjct: 620 TIPRQLISNLSRLHVLRMFAASHSAFDRASEDSILFGGGELIVEELLGLKYLEVISFTLR 679

Query: 503 SSLAVQKFLKYPKLVSITQSVWVYQC--ESAPFNVLHLAYMENLQELDLEYC-NLEEMKI 559
           SS  +Q FL   KL S T+++ + QC  +S    V  LA ++ L  L +  C  LEE+K+
Sbjct: 680 SSHGLQSFLSSHKLRSCTRAL-LLQCFNDSTSLEVSALADLKQLNRLWITECKKLEELKM 738

Query: 560 DCPEEVKKLFRNGFRSLNTVVLRSC-RGKDLTWLVFVQNLKVLYIGFCGDMEEIVSVDKL 618
           D   EV++     F SL  V + +C + KDLT+LVF  NL+ + +  C  MEE+VS+ K 
Sbjct: 739 DYTREVQQFV---FHSLKKVEILACSKLKDLTFLVFAPNLESIELMGCPAMEEMVSMGKF 795

Query: 619 RDISGIIGSERNFFAQLESLSVWRGINLKSVYPNPLPFPKLKKIEVRECRQLKKLPLNSS 678
            ++  ++ +  N FA+L++L ++   NLKS+Y  PLPFP LK +    C +LKKLPL+S+
Sbjct: 796 AEVPEVVAN-LNPFAKLQNLKLFGATNLKSIYWKPLPFPHLKSMSFSHCYKLKKLPLDSN 854

Query: 679 SAKERRVVIEGSKEWWEELQWEDQATQNAFSPGF 712
           SA+ER +VI G++ WWE+L+W D+AT+NAF P F
Sbjct: 855 SARERNIVISGTRRWWEQLEWVDEATRNAFLPCF 888

Source: Citrus trifoliata

Species: Citrus trifoliata

Genus: Citrus

Family: Rutaceae

Order: Sapindales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|24461865\|gb\|AAN62352.1\|AF506028_19 NBS-LRR type disease resistance protein [Citrus trifoliata]	Back alignment and taxonomy information

>gi\|24461864\|gb\|AAN62351.1\|AF506028_18 NBS-LRR type disease resistance protein [Citrus trifoliata]	Back alignment and taxonomy information

>gi\|24461861\|gb\|AAN62348.1\|AF506028_15 NBS-LRR type disease resistance protein [Citrus trifoliata]	Back alignment and taxonomy information

>gi\|24461863\|gb\|AAN62350.1\|AF506028_17 NBS-LRR type disease resistance protein [Citrus trifoliata]	Back alignment and taxonomy information

>gi\|225443158\|ref\|XP_002263674.1\| PREDICTED: probable disease resistance protein At5g63020-like [Vitis vinifera]	Back alignment and taxonomy information

>gi\|255553103\|ref\|XP_002517594.1\| Disease resistance protein RPS5, putative [Ricinus communis] gi\|223543226\|gb\|EEF44758.1\| Disease resistance protein RPS5, putative [Ricinus communis]	Back alignment and taxonomy information

>gi\|225442867\|ref\|XP_002281592.1\| PREDICTED: probable disease resistance protein At5g63020-like [Vitis vinifera]	Back alignment and taxonomy information

>gi\|359482672\|ref\|XP_003632805.1\| PREDICTED: probable disease resistance protein At1g12280-like [Vitis vinifera]	Back alignment and taxonomy information

>gi\|224122896\|ref\|XP_002318943.1\| cc-nbs-lrr resistance protein [Populus trichocarpa] gi\|222857319\|gb\|EEE94866.1\| cc-nbs-lrr resistance protein [Populus trichocarpa]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		731
TAIR\|locus:2201996		889	RPS5 "AT1G12220" [Arabidopsis	0.741	0.609	0.377	6.1e-114
TAIR\|locus:2034770		894	SUMM2 "AT1G12280" [Arabidopsis	0.734	0.600	0.366	8.2e-112
TAIR\|locus:2201986		885	RFL1 "AT1G12210" [Arabidopsis	0.735	0.607	0.36	8.2e-106
TAIR\|locus:2034765		884	AT1G12290 [Arabidopsis thalian	0.715	0.591	0.367	1.2e-102
TAIR\|locus:2132741		892	AT4G10780 [Arabidopsis thalian	0.737	0.604	0.344	1.4e-99
TAIR\|locus:2008440		899	AT1G61180 [Arabidopsis thalian	0.725	0.589	0.348	3.3e-98
TAIR\|locus:2036214		851	AT1G15890 [Arabidopsis thalian	0.733	0.629	0.356	1.3e-96
TAIR\|locus:2008510		967	AT1G61190 "AT1G61190" [Arabido	0.715	0.540	0.343	5.2e-90
TAIR\|locus:2166320		888	AT5G63020 [Arabidopsis thalian	0.748	0.615	0.368	5.3e-88
TAIR\|locus:2171589		948	AT5G47260 [Arabidopsis thalian	0.782	0.603	0.319	1.5e-85

TAIR\|locus:2201996 RPS5 "AT1G12220" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 893 (319.4 bits), Expect = 6.1e-114, Sum P(2) = 6.1e-114
 Identities = 218/577 (37%), Positives = 319/577 (55%)

Query:   150 ELPLAQTIVGQELLVDRLAETLARECGGLPLALKTVGRAMKSQRKVGDWKRAIHKMTTSA 209
             ++ + +  +G    +  LA  +AR+C GLPLAL  +G AM  +R V +W  AI  +T+SA
Sbjct:   323 QMKVGKNTLGSHPDIPGLARKVARKCRGLPLALNVIGEAMACKRTVHEWCHAIDVLTSSA 382

Query:   210 SKFSGMKEEVFSRLKFSYDSLSTDELRSCLLYCCLYPEDYEIPRRELIDYWISEGFVYXX 269
               FSGM++E+   LK+SYD+L+ + ++SC LYC L+PEDY I +  L+DYWISEGF+   
Sbjct:   383 IDFSGMEDEILHVLKYSYDNLNGELMKSCFLYCSLFPEDYLIDKEGLVDYWISEGFINEK 442

Query:   270 XXXXXXXX-------XLLQACLL--EEEGDDHVKMHDMIREMSLWIACTVDKEEQNFLVR 320
                             L++ACLL  EE    +VKMHD++REM+LWI+  + K+++  +VR
Sbjct:   443 EGRERNINQGYEIIGTLVRACLLLEEERNKSNVKMHDVVREMALWISSDLGKQKEKCIVR 502

Query:   321 AGVKLTEAPKIEEWEGAKRVSLMGNGIESLSEIPTCPRLVTLLVDENPIVEITDGFFQSM 380
             AGV L E PK+++W   +++SLM N IE + +   C  L TL + +N +V+I+  FF+ M
Sbjct:   503 AGVGLREVPKVKDWNTVRKISLMNNEIEEIFDSHECAALTTLFLQKNDVVKISAEFFRCM 562

Query:   381 SSLRVLSLSENFHLSTLPSGIXXXXXXXXXXXXXADITGLPQELKALEKLRYLNLEYAFN 440
               L VL LSEN  L+ LP  I               I  LP  L  L+KL +LNLE+  +
Sbjct:   563 PHLVVLDLSENQSLNELPEEISELASLRYFNLSYTCIHQLPVGLWTLKKLIHLNLEHMSS 622

Query:   441 LSIIPHQLISGFSNLEVLRLRGCGCCSVTEEEEANVLCADAEPLMKELLGLKRLNVLSWT 500
             L  I      G SNL  LR  G          ++ +L  D   L+KEL  L+ L V++  
Sbjct:   623 LGSI-----LGISNLWNLRTLGL--------RDSRLLL-DMS-LVKELQLLEHLEVITLD 667

Query:   501 FRSSLAVQKFLKYPKLVSITQSVWVYQCESAPFNVLHLAYMENLQELDLEYCNLEEMKID 560
               SSL  +  L   +LV   + V     +     VL L  M NL++L ++ C + E+KI+
Sbjct:   668 ISSSLVAEPLLCSQRLVECIKEVDFKYLKEESVRVLTLPTMGNLRKLGIKRCGMREIKIE 727

Query:   561 CPEEVKKLFRNG----FRSLNTVVLRSCRG-KDLTWLVFVQNLKVLYIGFCGDMEEIVSV 615
                      ++     F +L+ V +  C G KDLTWL+F  NL  L +GF  ++E+I+S 
Sbjct:   728 RTTSSSSRNKSPTTPCFSNLSRVFIAKCHGLKDLTWLLFAPNLTFLEVGFSKEVEDIISE 787

Query:   616 DKLRDISGIIGSERNFFAQLESLSVWRGINLKSVYPNPLPFPKLKKIEVRECRQLKKLPL 675
             +K  + S  I      F +LE+L ++    LK +Y   L FP LK I V +C +L+KLPL
Sbjct:   788 EKAEEHSATIVP----FRKLETLHLFELRGLKRIYAKALHFPCLKVIHVEKCEKLRKLPL 843

Query:   676 NSSS--AKERRVVIEGSKEWWEELQWEDQATQNAFSP 710
             +S S  A E  V+  G +EW E ++WEDQATQ  F P
Sbjct:   844 DSKSGIAGEELVIYYGEREWIERVEWEDQATQLRFLP 880

GO:0009626 "plant-type hypersensitive response" evidence=IMP

GO:0006952 "defense response" evidence=IMP;TAS

GO:0009816 "defense response to bacterium, incompatible interaction" evidence=IDA

GO:0005886 "plasma membrane" evidence=IDA

GO:0005515 "protein binding" evidence=IPI

GO:0008219 "cell death" evidence=IMP

GO:0038023 "signaling receptor activity" evidence=IMP

GO:0000166 "nucleotide binding" evidence=IMP

GO:0005622 "intracellular" evidence=ISS

TAIR\|locus:2034770 SUMM2 "AT1G12280" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2201986 RFL1 "AT1G12210" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2034765 AT1G12290 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2132741 AT4G10780 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2008440 AT1G61180 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2036214 AT1G15890 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2008510 AT1G61190 "AT1G61190" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2166320 AT5G63020 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2171589 AT5G47260 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Your Input:
	fgenesh4_pg.C_LG_XIII000034	cc-nbs-lrr resistance protein (820 aa)
		(Populus trichocarpa)
Predicted Functional Partners:
		Sorry, there are no predicted associations at the current settings.

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		731
pfam00931		285	pfam00931, NB-ARC, NB-ARC domain	3e-24
pfam13855		60	pfam13855, LRR_8, Leucine rich repeat	3e-07
COG4886		394	COG4886, COG4886, Leucine-rich repeat (LRR) protei	1e-05
PLN00113		968	PLN00113, PLN00113, leucine-rich repeat receptor-l	4e-05
pfam13855		60	pfam13855, LRR_8, Leucine rich repeat	5e-05
PLN00113		968	PLN00113, PLN00113, leucine-rich repeat receptor-l	2e-04
PLN00113		968	PLN00113, PLN00113, leucine-rich repeat receptor-l	0.001
pfam13855		60	pfam13855, LRR_8, Leucine rich repeat	0.003

>gnl\|CDD\|216202 pfam00931, NB-ARC, NB-ARC domain	Back alignment and domain information

 Score =  103 bits (258), Expect = 3e-24
 Identities = 40/106 (37%), Positives = 60/106 (56%), Gaps = 2/106 (1%)

Query: 166 RLAETLARECGGLPLALKTVGRAMKSQRKVGDWKRAIHKMTTSASKFSGMKEEVFSRLKF 225
            +A+ +  +C GLPLALK +G  +  +  V +W+  + ++    +   G+  EV S L  
Sbjct: 182 EVAKEIVEKCKGLPLALKVLGGLLAFKSTVQEWEHVLEQLNNELAGRDGL-NEVLSILSL 240

Query: 226 SYDSLSTDELRSCLLYCCLYPEDYEIPRRELIDYWISEGFVYDFDD 271
           SYD+L    L+ C LY  L+PEDY I + +LI  WI+EGFV   D 
Sbjct: 241 SYDNLP-MHLKRCFLYLALFPEDYNIRKEQLIKLWIAEGFVIPSDI 285

Length = 285

>gnl\|CDD\|206026 pfam13855, LRR_8, Leucine rich repeat	Back alignment and domain information

>gnl\|CDD\|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown]	Back alignment and domain information

>gnl\|CDD\|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional	Back alignment and domain information

>gnl\|CDD\|206026 pfam13855, LRR_8, Leucine rich repeat	Back alignment and domain information

>gnl\|CDD\|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional	Back alignment and domain information

>gnl\|CDD\|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional	Back alignment and domain information

>gnl\|CDD\|206026 pfam13855, LRR_8, Leucine rich repeat	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		731
KOG4658		889	consensus Apoptotic ATPase [Signal transduction me	100.0
PLN03210		1153	Resistant to P. syringae 6; Provisional	100.0
KOG0444		1255	consensus Cytoskeletal regulator Flightless-I (con	99.9
PLN00113		968	leucine-rich repeat receptor-like protein kinase;	99.89
PLN00113		968	leucine-rich repeat receptor-like protein kinase;	99.88
PLN03210		1153	Resistant to P. syringae 6; Provisional	99.88
PF00931		287	NB-ARC: NB-ARC domain; InterPro: IPR002182 This is	99.87
KOG4658		889	consensus Apoptotic ATPase [Signal transduction me	99.85
KOG0444		1255	consensus Cytoskeletal regulator Flightless-I (con	99.84
KOG4194		873	consensus Membrane glycoprotein LIG-1 [Signal tran	99.83
KOG4194		873	consensus Membrane glycoprotein LIG-1 [Signal tran	99.82
KOG0472		565	consensus Leucine-rich repeat protein [Function un	99.74
KOG0472		565	consensus Leucine-rich repeat protein [Function un	99.64
PRK15387		788	E3 ubiquitin-protein ligase SspH2; Provisional	99.62
KOG0618		1081	consensus Serine/threonine phosphatase 2C containi	99.56
PRK15387		788	E3 ubiquitin-protein ligase SspH2; Provisional	99.55
PRK15370		754	E3 ubiquitin-protein ligase SlrP; Provisional	99.54
PRK15370		754	E3 ubiquitin-protein ligase SlrP; Provisional	99.53
KOG0618		1081	consensus Serine/threonine phosphatase 2C containi	99.48
KOG0617		264	consensus Ras suppressor protein (contains leucine	99.45
KOG0617		264	consensus Ras suppressor protein (contains leucine	99.37
KOG4237		498	consensus Extracellular matrix protein slit, conta	99.32
KOG4237		498	consensus Extracellular matrix protein slit, conta	99.25
cd00116		319	LRR_RI Leucine-rich repeats (LRRs), ribonuclease i	99.17
cd00116		319	LRR_RI Leucine-rich repeats (LRRs), ribonuclease i	99.07
PF14580		175	LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ	98.96
KOG3207		505	consensus Beta-tubulin folding cofactor E [Posttra	98.87
PF14580		175	LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ	98.87
KOG0532		722	consensus Leucine-rich repeat (LRR) protein, conta	98.8
KOG4341		483	consensus F-box protein containing LRR [General fu	98.79
KOG1259		490	consensus Nischarin, modulator of integrin alpha5	98.66
COG4886		394	Leucine-rich repeat (LRR) protein [Function unknow	98.65
COG4886		394	Leucine-rich repeat (LRR) protein [Function unknow	98.65
KOG3207		505	consensus Beta-tubulin folding cofactor E [Posttra	98.65
KOG1259		490	consensus Nischarin, modulator of integrin alpha5	98.54
KOG2120		419	consensus SCF ubiquitin ligase, Skp2 component [Po	98.5
PF13855		61	LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF	98.48
KOG0532		722	consensus Leucine-rich repeat (LRR) protein, conta	98.46
KOG4341		483	consensus F-box protein containing LRR [General fu	98.39
PLN03150		623	hypothetical protein; Provisional	98.39
PF13855		61	LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF	98.38
KOG1909		382	consensus Ran GTPase-activating protein [RNA proce	98.31
KOG2120		419	consensus SCF ubiquitin ligase, Skp2 component [Po	98.24
PRK15386		426	type III secretion protein GogB; Provisional	98.18
KOG0531		414	consensus Protein phosphatase 1, regulatory subuni	98.16
PLN03150		623	hypothetical protein; Provisional	98.1
KOG0531		414	consensus Protein phosphatase 1, regulatory subuni	98.05
PF12799		44	LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_	98.02
PF12799		44	LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_	97.99
KOG4579		177	consensus Leucine-rich repeat (LRR) protein associ	97.91
KOG1859		1096	consensus Leucine-rich repeat proteins [General fu	97.88
PRK15386		426	type III secretion protein GogB; Provisional	97.85
KOG1909		382	consensus Ran GTPase-activating protein [RNA proce	97.85
KOG2982		418	consensus Uncharacterized conserved protein [Funct	97.77
KOG1644		233	consensus U2-associated snRNP A' protein [RNA proc	97.72
KOG2982		418	consensus Uncharacterized conserved protein [Funct	97.65
KOG1859		1096	consensus Leucine-rich repeat proteins [General fu	97.63
KOG3665		699	consensus ZYG-1-like serine/threonine protein kina	97.59
KOG3665		699	consensus ZYG-1-like serine/threonine protein kina	97.25
KOG4579		177	consensus Leucine-rich repeat (LRR) protein associ	97.2
KOG1644		233	consensus U2-associated snRNP A' protein [RNA proc	96.84
KOG2739		260	consensus Leucine-rich acidic nuclear protein [Cel	96.39
KOG2739		260	consensus Leucine-rich acidic nuclear protein [Cel	96.31
KOG1947		482	consensus Leucine rich repeat proteins, some prote	96.31
KOG2123		388	consensus Uncharacterized conserved protein [Funct	96.26
KOG1947		482	consensus Leucine rich repeat proteins, some prote	96.14
COG5238		388	RNA1 Ran GTPase-activating protein (RanGAP) involv	96.08
KOG2123		388	consensus Uncharacterized conserved protein [Funct	95.99
COG5238		388	RNA1 Ran GTPase-activating protein (RanGAP) involv	95.72
PF00560		22	LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le	95.5
PF00560		22	LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le	94.89
PF13306		129	LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_	94.81
PF13306		129	LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_	94.37
KOG3864		221	consensus Uncharacterized conserved protein [Funct	94.27
PF13504		17	LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO	93.95
PF13504		17	LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO	93.92
KOG3864		221	consensus Uncharacterized conserved protein [Funct	92.58
KOG0473		326	consensus Leucine-rich repeat protein [Function un	91.06
KOG0473		326	consensus Leucine-rich repeat protein [Function un	90.98
smart00369		26	LRR_TYP Leucine-rich repeats, typical (most popula	90.11
smart00370		26	LRR Leucine-rich repeats, outliers.	90.11
PRK04841		903	transcriptional regulator MalT; Provisional	84.26
smart00367		26	LRR_CC Leucine-rich repeat - CC (cysteine-containi	82.54
smart00369		26	LRR_TYP Leucine-rich repeats, typical (most popula	81.86
smart00370		26	LRR Leucine-rich repeats, outliers.	81.86

>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms]	Back alignment and domain information

Probab=100.00  E-value=2.8e-69  Score=609.68  Aligned_cols=686  Identities=39%  Similarity=0.637  Sum_probs=573.4

Q ss_pred             CCCceecccc-hh-hHHhHHhhhccccchhhchHHhHHHHHHHHHHhhhhhHHHHHHHHHhhhcccccchhHHHhHHHHH
Q 038165            1 MGNLISTFLQ-PD-FFNRTLNCVGQQAKYIWGLEKNLEGLETELHKLTRTRDDLKTRVEVEEQRPRTRRTNQVAGWLEDV   78 (731)
Q Consensus         1 m~~~~~~~~~-~~-~~~~~~~~~~~~~~~~~~~~~~l~~l~~~~~~l~~~~~~l~~~~~~~~~~~~~~~~~~v~~wL~~v   78 (731)
                      ||++.++.+- ++ +.+....|+...-.|+...++|+..+++.++++++.+++...++..++..+...+..+++.|+..+
T Consensus         1 ~~~~~s~~~~~~~~~l~~~~~~~~~~~~~i~~Lk~~L~~l~~~l~d~~a~~~~~~~~~~~~e~~~~~~~~~e~~~~~~~v   80 (889)
T KOG4658|consen    1 MGACVSFGVEKLDQLLNRESECLDGKDNYILELKENLKALQSALEDLDAKRDDLERRVNWEEDVGDLVYLAEDIIWLFLV   80 (889)
T ss_pred             CCeEEEEehhhHHHHHHHHHHHHhchHHHHHHHHHHHHHHHHHHHHHHhhcchHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            8899988884 44 999999999999999999999999999999999999999999998877766456777889999999


Q ss_pred             HHHHHHHHHHHHhhHHHhhhcccCCCCCcchhhhhcchHHHHHHHHHHHHHhhCCCcceEeee-cCCccccccccccccc
Q 038165           79 QKLENEFTKLQQVKAQEMDRLCLGGLCSKNLASSYDFGRKVVMLTDRVINLRKDGEKIEVVVE-KAPDGAAIELPLAQTI  157 (731)
Q Consensus        79 ~~~~d~v~~l~~~~~~~~~~~~~~~~~s~~~~~~~~~gsrv~~~~~~~~~l~~~~~~~~~~~~-~~~~~~~~~l~~~~~~  157 (731)
                      ..++....++....+...++.|+++.|+.+....++.+.||...++.++.+...+. +..... ..+.+...+.+.+...
T Consensus        81 ~~~~~~~~~~l~~~~~~~~~~c~~~~~~~~~~~~~~~~~rv~~~l~~ve~l~~~~~-~~~~~~~~~~~~~~e~~~~~~~~  159 (889)
T KOG4658|consen   81 EEIERKANDLLSTRSVERQRLCLCGFCSKNVSDSYKYGKRVSKVLREVESLGSKGV-FEVVGESLDPREKVETRPIQSES  159 (889)
T ss_pred             HHHHHHHhHHhhhhHHHHHHHhhhhhHhHhhhhhHhHHHHHHHHHHHHHHhccccc-eecccccccchhhcccCCCCccc
Confidence            99988899999888889999999999999999999999999999999999988887 555543 2211222222222221


Q ss_pred             -cccccc-------------------------------------------------------------------------
Q 038165          158 -VGQELL-------------------------------------------------------------------------  163 (731)
Q Consensus       158 -~~~~~~-------------------------------------------------------------------------  163 (731)
                       +|.+..                                                                         
T Consensus       160 ~VG~e~~~~kl~~~L~~d~~~iv~i~GMGGvGKTTL~~qi~N~~~~v~~~Fd~~iWV~VSk~f~~~~iq~~Il~~l~~~~  239 (889)
T KOG4658|consen  160 DVGLETMLEKLWNRLMEDDVGIVGIYGMGGVGKTTLARQIFNKFDEVGNHFDGVIWVVVSKEFTTRKIQQTILERLGLLD  239 (889)
T ss_pred             cccHHHHHHHHHHHhccCCCCEEEEECCCcccHHHHHHHHhcccchhcccCceEEEEEEcccccHHhHHHHHHHHhccCC
Confidence             333333                                                                         


Q ss_pred             --------------------------------------------------------------------------------
Q 038165          164 --------------------------------------------------------------------------------  163 (731)
Q Consensus       164 --------------------------------------------------------------------------------  163 (731)
                                                                                                      
T Consensus       240 ~~~~~~~~~~~~~~i~~~L~~krfllvLDDIW~~~dw~~I~~~~p~~~~g~KvvlTTRs~~V~~~~m~~~~~~~v~~L~~  319 (889)
T KOG4658|consen  240 EEWEDKEEDELASKLLNLLEGKRFLLVLDDIWEEVDWDKIGVPFPSRENGSKVVLTTRSEEVCGRAMGVDYPIEVECLTP  319 (889)
T ss_pred             cccchhhHHHHHHHHHHHhccCceEEEEecccccccHHhcCCCCCCccCCeEEEEEeccHhhhhccccCCccccccccCc
Confidence                                                                                            


Q ss_pred             ---------------------HHHHHHHHHHHcCCchHHHHHHHHHhcCCCChhHHHHHHHHhhcc-cCCCCCChHHHHh
Q 038165          164 ---------------------VDRLAETLARECGGLPLALKTVGRAMKSQRKVGDWKRAIHKMTTS-ASKFSGMKEEVFS  221 (731)
Q Consensus       164 ---------------------~~~l~~~iv~~c~GlPLal~~~g~~L~~~~~~~~W~~~l~~l~~~-~~~~~~~~~~i~~  221 (731)
                                           +.++|++||++|+|||||++++|+.|+.|++.++|+++.+.+.+. ..+.+++++.|++
T Consensus       320 ~eaW~LF~~~v~~~~~~~~~~i~~lak~v~~kC~GLPLAl~viG~~ma~K~t~~eW~~~~~~l~s~~~~~~~~~~~~i~~  399 (889)
T KOG4658|consen  320 EEAWDLFQKKVGPNTLGSHPDIEELAKEVAEKCGGLPLALNVLGGLLACKKTVQEWRRALNVLKSSLAADFSGMEESILP  399 (889)
T ss_pred             cccHHHHHHhhccccccccccHHHHHHHHHHHhCChHHHHHHHHHHhcCCCcHHHHHHHHccccccccCCCCchhhhhHH
Confidence                                 799999999999999999999999999999999999999999987 6677788889999


Q ss_pred             hhhhhccCCChhhHHHHHhHhcccCCCcccChhhHHHHHHHcCccccc-------hhhhhHHHHHHHhhcccccC----C
Q 038165          222 RLKFSYDSLSTDELRSCLLYCCLYPEDYEIPRRELIDYWISEGFVYDF-------DDGCDFIDDLLQACLLEEEG----D  290 (731)
Q Consensus       222 ~L~~sy~~L~~~~~k~cfl~~a~fp~~~~~~~~~li~~w~a~g~~~~~-------~~g~~~~~~L~~~sli~~~~----~  290 (731)
                      +|++|||.||+ ++|.||+|||.||+||.|++++|+.+|+||||+...       ++|+.|+.+|++++|++...    .
T Consensus       400 iLklSyd~L~~-~lK~CFLycalFPED~~I~~e~Li~yWiaEGfi~~~~~~~~~~d~G~~~i~~LV~~~Ll~~~~~~~~~  478 (889)
T KOG4658|consen  400 ILKLSYDNLPE-ELKSCFLYCALFPEDYEIKKEKLIEYWIAEGFIDPLDGGETAEDVGYDYIEELVRASLLIEERDEGRK  478 (889)
T ss_pred             hhhccHhhhhH-HHHHHHHhhccCCcccccchHHHHHHHHhccCcCccccccchhcchHHHHHHHHHHHHHhhcccccce
Confidence            99999999996 999999999999999999999999999999999773       89999999999999999963    3


Q ss_pred             CccchhhHHHHHHHHHhhccCcccceEEEEcCCccccCccccccccceEEEeecCCcccCCCCCCCCCeeEEEcccCC--
Q 038165          291 DHVKMHDMIREMSLWIACTVDKEEQNFLVRAGVKLTEAPKIEEWEGAKRVSLMGNGIESLSEIPTCPRLVTLLVDENP--  368 (731)
Q Consensus       291 ~~~~mhdli~dl~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~l~l~~~~~~~l~~~~~~~~L~~L~l~~~~--  368 (731)
                      .+|+|||++||||.++|++.+..+++.++..+.+....|+...+..+|++++.++.+..++.-..+++|++|.+.+|.  
T Consensus       479 ~~~kmHDvvRe~al~ias~~~~~~e~~iv~~~~~~~~~~~~~~~~~~rr~s~~~~~~~~~~~~~~~~~L~tLll~~n~~~  558 (889)
T KOG4658|consen  479 ETVKMHDVVREMALWIASDFGKQEENQIVSDGVGLSEIPQVKSWNSVRRMSLMNNKIEHIAGSSENPKLRTLLLQRNSDW  558 (889)
T ss_pred             eEEEeeHHHHHHHHHHhccccccccceEEECCcCccccccccchhheeEEEEeccchhhccCCCCCCccceEEEeecchh
Confidence            899999999999999999877766777777776777788899999999999999999999999999999999999996  


Q ss_pred             ccccChhhhcCCCCccEEEcCCCCCCCcccccccCCcCCCEEeccCCCCCCcchHHhcCCcCcEeecccccccccccccc
Q 038165          369 IVEITDGFFQSMSSLRVLSLSENFHLSTLPSGISSLVSLHHLDLSSADITGLPQELKALEKLRYLNLEYAFNLSIIPHQL  448 (731)
Q Consensus       369 l~~~~~~~~~~l~~L~~L~L~~~~~~~~lP~~i~~l~~L~~L~L~~~~l~~lp~~i~~L~~L~~L~L~~~~~l~~lp~~~  448 (731)
                      +..++..+|..++.|++|||++|..+.++|++|+.|.|||||+++++.++++|.++++|.+|.+||+..+..+..+|. +
T Consensus       559 l~~is~~ff~~m~~LrVLDLs~~~~l~~LP~~I~~Li~LryL~L~~t~I~~LP~~l~~Lk~L~~Lnl~~~~~l~~~~~-i  637 (889)
T KOG4658|consen  559 LLEISGEFFRSLPLLRVLDLSGNSSLSKLPSSIGELVHLRYLDLSDTGISHLPSGLGNLKKLIYLNLEVTGRLESIPG-I  637 (889)
T ss_pred             hhhcCHHHHhhCcceEEEECCCCCccCcCChHHhhhhhhhcccccCCCccccchHHHHHHhhheeccccccccccccc-h
Confidence            788999999999999999999998999999999999999999999999999999999999999999999988777755 3


Q ss_pred             cCCCCCCcEEEeeCcccCCCchhhhhhhhcCCcccchhhhccCCCCcEEEEEeechhHHHhhhCCchhhccceEEEEeec
Q 038165          449 ISGFSNLEVLRLRGCGCCSVTEEEEANVLCADAEPLMKELLGLKRLNVLSWTFRSSLAVQKFLKYPKLVSITQSVWVYQC  528 (731)
Q Consensus       449 i~~l~~L~~L~l~~~~~~~~~~~~~~~~~~~~~~~~i~~l~~L~~L~~l~~~~~~~~~~~~l~~~~~~~~~L~~L~l~~~  528 (731)
                      ...|++||+|.+......             .....++++..|++|+.+.++..+....+.+.....+.+..+.+.+.++
T Consensus       638 ~~~L~~Lr~L~l~~s~~~-------------~~~~~l~el~~Le~L~~ls~~~~s~~~~e~l~~~~~L~~~~~~l~~~~~  704 (889)
T KOG4658|consen  638 LLELQSLRVLRLPRSALS-------------NDKLLLKELENLEHLENLSITISSVLLLEDLLGMTRLRSLLQSLSIEGC  704 (889)
T ss_pred             hhhcccccEEEeeccccc-------------cchhhHHhhhcccchhhheeecchhHhHhhhhhhHHHHHHhHhhhhccc
Confidence            667999999999876522             2256788889999999999887666555666666666666666666443


Q ss_pred             CCCCcccccccccCCccEEeccCCCccceeecCccccccccccccCCccEEEEeccCC-CCCchhhccCCccEEeeeccc
Q 038165          529 ESAPFNVLHLAYMENLQELDLEYCNLEEMKIDCPEEVKKLFRNGFRSLNTVVLRSCRG-KDLTWLVFVQNLKVLYIGFCG  607 (731)
Q Consensus       529 ~~~~~~~~~l~~l~~L~~L~l~~~~~~~~~~~~~~~~~~~~~~~l~~L~~L~L~~c~~-~~~~~l~~l~~L~~L~L~~~~  607 (731)
                       .......++..+.+|+.|.|.+|.+.+....+.......  ..|+++..+.+.+|.. ..+.|....|+|+.|.+..|.
T Consensus       705 -~~~~~~~~~~~l~~L~~L~i~~~~~~e~~~~~~~~~~~~--~~f~~l~~~~~~~~~~~r~l~~~~f~~~L~~l~l~~~~  781 (889)
T KOG4658|consen  705 -SKRTLISSLGSLGNLEELSILDCGISEIVIEWEESLIVL--LCFPNLSKVSILNCHMLRDLTWLLFAPHLTSLSLVSCR  781 (889)
T ss_pred             -ccceeecccccccCcceEEEEcCCCchhhcccccccchh--hhHHHHHHHHhhccccccccchhhccCcccEEEEeccc
Confidence             234455568889999999999999987555444321111  1367888888999999 999999999999999999999


Q ss_pred             ccccccccccccccccccCCCCccCcCccEe-eccccccccccCCCCcCCCCccEEeeccccCCCCCCCCCCCCC-C--c
Q 038165          608 DMEEIVSVDKLRDISGIIGSERNFFAQLESL-SVWRGINLKSVYPNPLPFPKLKKIEVRECRQLKKLPLNSSSAK-E--R  683 (731)
Q Consensus       608 ~l~~l~~~~~~~~~~~~~~~~~~~~~~L~~L-~L~~~~~L~~l~~~~~~lp~L~~L~l~~C~~L~~lP~~~~~~~-L--~  683 (731)
                      .+++++.........   ......|.++..+ .+.+.+.+.++......+++|+.+.+..||+++++|....... -  .
T Consensus       782 ~~e~~i~~~k~~~~l---~~~i~~f~~~~~l~~~~~l~~l~~i~~~~l~~~~l~~~~ve~~p~l~~~P~~~~~~i~~~~~  858 (889)
T KOG4658|consen  782 LLEDIIPKLKALLEL---KELILPFNKLEGLRMLCSLGGLPQLYWLPLSFLKLEELIVEECPKLGKLPLLSTLTIVGCEE  858 (889)
T ss_pred             ccccCCCHHHHhhhc---ccEEecccccccceeeecCCCCceeEecccCccchhheehhcCcccccCccccccceecccc
Confidence            999887644322111   1134567777777 5888888888888888889999999999999999999776543 1  2


Q ss_pred             ceEEecchhhhhhcccCcccccccc
Q 038165          684 RVVIEGSKEWWEELQWEDQATQNAF  708 (731)
Q Consensus       684 ~l~i~~~~~~~~~l~w~~~~~~~~~  708 (731)
                      .+......+|.+.++|++++++..+
T Consensus       859 ~~~~~~~~~~~~~v~~~~~~~~~~~  883 (889)
T KOG4658|consen  859 KLKEYPDGEWLEGVYWEDELTKLRF  883 (889)
T ss_pred             ceeecCCccceeeEEehhhhhhhhc
Confidence            2333345678999999999998776

>PLN03210 Resistant to P	Back alignment and domain information

>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton]	Back alignment and domain information

>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional	Back alignment and domain information

>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional	Back alignment and domain information

>PLN03210 Resistant to P	Back alignment and domain information

>PF00931 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is the NB-ARC domain, a novel signalling motif found in bacteria and eukaryotes, shared by plant resistance gene products and regulators of cell death in animals []	Back alignment and domain information

>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms]	Back alignment and domain information

>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton]	Back alignment and domain information

>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms]	Back alignment and domain information

>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms]	Back alignment and domain information

>KOG0472 consensus Leucine-rich repeat protein [Function unknown]	Back alignment and domain information

>KOG0472 consensus Leucine-rich repeat protein [Function unknown]	Back alignment and domain information

>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional	Back alignment and domain information

>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms]	Back alignment and domain information

>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional	Back alignment and domain information

>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional	Back alignment and domain information

>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional	Back alignment and domain information

>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms]	Back alignment and domain information

>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms]	Back alignment and domain information

>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms]	Back alignment and domain information

>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms]	Back alignment and domain information

>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms]	Back alignment and domain information

>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily	Back alignment and domain information

>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily	Back alignment and domain information

>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A	Back alignment and domain information

>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A	Back alignment and domain information

>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton]	Back alignment and domain information

>KOG4341 consensus F-box protein containing LRR [General function prediction only]	Back alignment and domain information

>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton]	Back alignment and domain information

>COG4886 Leucine-rich repeat (LRR) protein [Function unknown]	Back alignment and domain information

>COG4886 Leucine-rich repeat (LRR) protein [Function unknown]	Back alignment and domain information

>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton]	Back alignment and domain information

>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A	Back alignment and domain information

>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton]	Back alignment and domain information

>KOG4341 consensus F-box protein containing LRR [General function prediction only]	Back alignment and domain information

>PLN03150 hypothetical protein; Provisional	Back alignment and domain information

>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A	Back alignment and domain information

>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms]	Back alignment and domain information

>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK15386 type III secretion protein GogB; Provisional	Back alignment and domain information

>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms]	Back alignment and domain information

>PLN03150 hypothetical protein; Provisional	Back alignment and domain information

>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms]	Back alignment and domain information

>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B	Back alignment and domain information

>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B	Back alignment and domain information

>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only]	Back alignment and domain information

>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only]	Back alignment and domain information

>PRK15386 type III secretion protein GogB; Provisional	Back alignment and domain information

>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms]	Back alignment and domain information

>KOG2982 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification]	Back alignment and domain information

>KOG2982 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only]	Back alignment and domain information

>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only]	Back alignment and domain information

>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only]	Back alignment and domain information

>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only]	Back alignment and domain information

>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification]	Back alignment and domain information

>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only]	Back alignment and domain information

>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only]	Back alignment and domain information

>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only]	Back alignment and domain information

>KOG2123 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only]	Back alignment and domain information

>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification]	Back alignment and domain information

>KOG2123 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification]	Back alignment and domain information

>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape []	Back alignment and domain information

>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape []	Back alignment and domain information

>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A	Back alignment and domain information

>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A	Back alignment and domain information

>KOG3864 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D	Back alignment and domain information

>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D	Back alignment and domain information

>KOG3864 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG0473 consensus Leucine-rich repeat protein [Function unknown]	Back alignment and domain information

>KOG0473 consensus Leucine-rich repeat protein [Function unknown]	Back alignment and domain information

>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily	Back alignment and domain information

>smart00370 LRR Leucine-rich repeats, outliers	Back alignment and domain information

>PRK04841 transcriptional regulator MalT; Provisional	Back alignment and domain information

>smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily	Back alignment and domain information

>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily	Back alignment and domain information

>smart00370 LRR Leucine-rich repeats, outliers	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		731
1z6t_A		591	APAF-1, apoptotic protease activating factor 1; ca	6e-25
2a5y_B		549	CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis	2e-24
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	3e-23
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	2e-11
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	2e-10
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	1e-18
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	3e-15
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	4e-15
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	3e-13
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	8e-12
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	3e-11
1ozn_A		285	Reticulon 4 receptor; NOGO receptor, MAD, myelinat	2e-18
1ozn_A		285	Reticulon 4 receptor; NOGO receptor, MAD, myelinat	5e-17
1ozn_A		285	Reticulon 4 receptor; NOGO receptor, MAD, myelinat	1e-14
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	2e-18
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	4e-14
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	4e-12
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	2e-08
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	9e-08
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	4e-18
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	1e-16
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	1e-15
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	2e-15
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	3e-15
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	1e-14
3zyi_A		452	Leucine-rich repeat-containing protein 4; cell adh	9e-18
3zyi_A		452	Leucine-rich repeat-containing protein 4; cell adh	9e-15
2z66_A		306	Variable lymphocyte receptor B, TOLL-like recepto;	1e-17
2z66_A		306	Variable lymphocyte receptor B, TOLL-like recepto;	2e-14
2z66_A		306	Variable lymphocyte receptor B, TOLL-like recepto;	4e-05
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	1e-17
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	1e-15
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	1e-14
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	8e-12
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	2e-17
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	5e-15
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	7e-15
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	2e-11
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	2e-17
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	2e-17
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	5e-15
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	1e-14
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	2e-14
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	3e-14
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	2e-10
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	2e-10
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	7e-08
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	2e-17
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	8e-16
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	8e-15
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	2e-14
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	2e-05
2id5_A		477	Lingo-1, leucine rich repeat neuronal 6A; CNS-spec	2e-17
2id5_A		477	Lingo-1, leucine rich repeat neuronal 6A; CNS-spec	3e-17
2id5_A		477	Lingo-1, leucine rich repeat neuronal 6A; CNS-spec	6e-16
2id5_A		477	Lingo-1, leucine rich repeat neuronal 6A; CNS-spec	2e-15
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	5e-17
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	1e-16
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	1e-12
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	2e-12
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	1e-11
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	1e-08
2z80_A		353	TOLL-like receptor 2, variable lymphocyte recepto;	8e-17
3zyj_A		440	Leucine-rich repeat-containing protein 4C; cell ad	3e-16
3zyj_A		440	Leucine-rich repeat-containing protein 4C; cell ad	9e-15
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	4e-16
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	8e-16
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	2e-13
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	5e-16
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	1e-15
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	2e-14
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	2e-13
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	4e-13
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	8e-12
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	9e-07
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	9e-05
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	6e-16
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	1e-15
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	7e-15
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	6e-14
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	3e-12
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	2e-10
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	3e-09
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	4e-07
1o6v_A		466	Internalin A; bacterial infection, extracellular r	7e-16
1o6v_A		466	Internalin A; bacterial infection, extracellular r	4e-15
1o6v_A		466	Internalin A; bacterial infection, extracellular r	1e-14
1o6v_A		466	Internalin A; bacterial infection, extracellular r	6e-14
1o6v_A		466	Internalin A; bacterial infection, extracellular r	1e-13
1o6v_A		466	Internalin A; bacterial infection, extracellular r	2e-13
1o6v_A		466	Internalin A; bacterial infection, extracellular r	3e-13
1o6v_A		466	Internalin A; bacterial infection, extracellular r	4e-13
1o6v_A		466	Internalin A; bacterial infection, extracellular r	1e-12
1o6v_A		466	Internalin A; bacterial infection, extracellular r	6e-11
1o6v_A		466	Internalin A; bacterial infection, extracellular r	5e-06
1o6v_A		466	Internalin A; bacterial infection, extracellular r	5e-06
3fxi_A		605	TLR4, htoll, TOLL-like receptor 4; leucine rich re	8e-16
3fxi_A		605	TLR4, htoll, TOLL-like receptor 4; leucine rich re	2e-15
3fxi_A		605	TLR4, htoll, TOLL-like receptor 4; leucine rich re	4e-14
3fxi_A		605	TLR4, htoll, TOLL-like receptor 4; leucine rich re	4e-14
3fxi_A		605	TLR4, htoll, TOLL-like receptor 4; leucine rich re	1e-13
3fxi_A		605	TLR4, htoll, TOLL-like receptor 4; leucine rich re	2e-13
3fxi_A		605	TLR4, htoll, TOLL-like receptor 4; leucine rich re	2e-13
3fxi_A		605	TLR4, htoll, TOLL-like receptor 4; leucine rich re	1e-12
3fxi_A		605	TLR4, htoll, TOLL-like receptor 4; leucine rich re	4e-07
3fxi_A		605	TLR4, htoll, TOLL-like receptor 4; leucine rich re	2e-06
3jqh_A		167	C-type lectin domain family 4 member M; DC-signr,	9e-16
3jqh_A		167	C-type lectin domain family 4 member M; DC-signr,	4e-15
3jqh_A		167	C-type lectin domain family 4 member M; DC-signr,	4e-14
3jqh_A		167	C-type lectin domain family 4 member M; DC-signr,	4e-11
3jqh_A		167	C-type lectin domain family 4 member M; DC-signr,	3e-05
1xku_A		330	Decorin; proteoglycan, leucine-rich repeat, struct	7e-15
1xku_A		330	Decorin; proteoglycan, leucine-rich repeat, struct	5e-14
1xku_A		330	Decorin; proteoglycan, leucine-rich repeat, struct	1e-13
1xku_A		330	Decorin; proteoglycan, leucine-rich repeat, struct	2e-08
2xot_A		361	Amphoterin-induced protein 1; cell adhesion, neuro	8e-15
2xot_A		361	Amphoterin-induced protein 1; cell adhesion, neuro	4e-14
3o53_A		317	Protein LRIM1, AGAP006348-PA; leucine-rich repeat,	9e-15
3o53_A		317	Protein LRIM1, AGAP006348-PA; leucine-rich repeat,	3e-13
3o53_A		317	Protein LRIM1, AGAP006348-PA; leucine-rich repeat,	1e-12
4ezg_A		197	Putative uncharacterized protein; internalin-A, le	1e-14
4ezg_A		197	Putative uncharacterized protein; internalin-A, le	2e-12
4ezg_A		197	Putative uncharacterized protein; internalin-A, le	1e-09
4ezg_A		197	Putative uncharacterized protein; internalin-A, le	4e-08
4ezg_A		197	Putative uncharacterized protein; internalin-A, le	2e-04
2xwt_C		239	Thyrotropin receptor; signaling protein-immune sys	2e-14
2xwt_C		239	Thyrotropin receptor; signaling protein-immune sys	3e-10
2xwt_C		239	Thyrotropin receptor; signaling protein-immune sys	5e-09
2ft3_A		332	Biglycan; proteoglycan, dimer interface, structura	2e-14
2ft3_A		332	Biglycan; proteoglycan, dimer interface, structura	4e-14
2ft3_A		332	Biglycan; proteoglycan, dimer interface, structura	2e-13
2ft3_A		332	Biglycan; proteoglycan, dimer interface, structura	8e-13
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	7e-14
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	3e-13
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	7e-12
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	7e-12
3bz5_A		457	Internalin-J, INLJ; leucine rich repeat (LRR), cys	7e-14
3bz5_A		457	Internalin-J, INLJ; leucine rich repeat (LRR), cys	1e-11
3bz5_A		457	Internalin-J, INLJ; leucine rich repeat (LRR), cys	2e-11
3bz5_A		457	Internalin-J, INLJ; leucine rich repeat (LRR), cys	1e-06
3v47_A		455	TOLL-like receptor 5B and variable lymphocyte REC	1e-13
3v47_A		455	TOLL-like receptor 5B and variable lymphocyte REC	1e-12
3v47_A		455	TOLL-like receptor 5B and variable lymphocyte REC	8e-12
3v47_A		455	TOLL-like receptor 5B and variable lymphocyte REC	2e-04
1m9s_A		605	Internalin B; cell invasion, GW domains, SH3 domai	2e-13
1m9s_A		605	Internalin B; cell invasion, GW domains, SH3 domai	7e-12
1m9s_A		605	Internalin B; cell invasion, GW domains, SH3 domai	3e-11
1m9s_A		605	Internalin B; cell invasion, GW domains, SH3 domai	3e-10
1m9s_A		605	Internalin B; cell invasion, GW domains, SH3 domai	1e-05
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	2e-13
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	6e-10
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	5e-09
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	2e-07
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	6e-05
4ay9_X		350	Follicle-stimulating hormone receptor; hormone-rec	3e-13
4ay9_X		350	Follicle-stimulating hormone receptor; hormone-rec	2e-11
4ay9_X		350	Follicle-stimulating hormone receptor; hormone-rec	2e-07
4ay9_X		350	Follicle-stimulating hormone receptor; hormone-rec	1e-04
2z62_A		276	TOLL-like receptor 4, variable lymphocyte recepto;	4e-13
2z62_A		276	TOLL-like receptor 4, variable lymphocyte recepto;	6e-12
2v9t_B		220	SLIT homolog 2 protein N-product; structural prote	4e-13
2v9t_B		220	SLIT homolog 2 protein N-product; structural prote	1e-12
2v70_A		220	SLIT-2, SLIT homolog 2 protein N-product; neurogen	5e-13
1h6u_A		308	Internalin H; cell adhesion, leucine rich repeat,	7e-13
1h6u_A		308	Internalin H; cell adhesion, leucine rich repeat,	1e-12
1h6u_A		308	Internalin H; cell adhesion, leucine rich repeat,	6e-12
1h6u_A		308	Internalin H; cell adhesion, leucine rich repeat,	2e-11
1h6u_A		308	Internalin H; cell adhesion, leucine rich repeat,	1e-09
1h6t_A		291	Internalin B; cell adhesion, leucine rich repeat,	7e-13
1h6t_A		291	Internalin B; cell adhesion, leucine rich repeat,	1e-12
1h6t_A		291	Internalin B; cell adhesion, leucine rich repeat,	3e-11
1h6t_A		291	Internalin B; cell adhesion, leucine rich repeat,	3e-10
1h6t_A		291	Internalin B; cell adhesion, leucine rich repeat,	2e-09
1h6t_A		291	Internalin B; cell adhesion, leucine rich repeat,	1e-05
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	1e-12
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	2e-12
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	3e-12
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	7e-12
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	3e-07
1p9a_G		290	Platelet glycoprotein IB alpha chain precursor; pl	2e-12
1p9a_G		290	Platelet glycoprotein IB alpha chain precursor; pl	1e-11
1p9a_G		290	Platelet glycoprotein IB alpha chain precursor; pl	3e-04
2o6q_A		270	Variable lymphocyte receptor A; leucine-rich repea	5e-12
2o6q_A		270	Variable lymphocyte receptor A; leucine-rich repea	1e-10
2o6q_A		270	Variable lymphocyte receptor A; leucine-rich repea	2e-09
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	7e-12
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	8e-11
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	3e-10
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	4e-10
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	4e-10
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	1e-09
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	1e-09
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	1e-08
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	2e-07
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	2e-07
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	3e-07
1dce_A		567	Protein (RAB geranylgeranyltransferase alpha subun	1e-11
1dce_A		567	Protein (RAB geranylgeranyltransferase alpha subun	2e-06
3cvr_A		571	Invasion plasmid antigen; leucine rich repeat and	1e-11
3cvr_A		571	Invasion plasmid antigen; leucine rich repeat and	3e-10
1xeu_A		263	Internalin C; cellular invasion, leucine-rich repe	9e-11
1xeu_A		263	Internalin C; cellular invasion, leucine-rich repe	2e-10
1xeu_A		263	Internalin C; cellular invasion, leucine-rich repe	5e-10
1xeu_A		263	Internalin C; cellular invasion, leucine-rich repe	2e-04
2z7x_B		520	TOLL-like receptor 1, variable lymphocyte recepto;	1e-10
2z7x_B		520	TOLL-like receptor 1, variable lymphocyte recepto;	1e-09
2z7x_B		520	TOLL-like receptor 1, variable lymphocyte recepto;	1e-07
2z7x_B		520	TOLL-like receptor 1, variable lymphocyte recepto;	3e-06
2z7x_B		520	TOLL-like receptor 1, variable lymphocyte recepto;	4e-04
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	3e-10
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	7e-10
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	2e-06
1ds9_A		198	Outer arm dynein; leucine-rich repeat, beta-BETA-a	1e-09
1ds9_A		198	Outer arm dynein; leucine-rich repeat, beta-BETA-a	4e-05
1wwl_A		312	Monocyte differentiation antigen CD14; LPS, immune	2e-09
1wwl_A		312	Monocyte differentiation antigen CD14; LPS, immune	3e-09
1wwl_A		312	Monocyte differentiation antigen CD14; LPS, immune	2e-06
1a9n_A		176	U2A', U2A'; complex (nuclear protein/RNA), RNA, sn	3e-09
1a9n_A		176	U2A', U2A'; complex (nuclear protein/RNA), RNA, sn	1e-08
3a79_B		562	TLR6, VLRB.59, TOLL-like receptor 6, variable lymp	3e-09
3a79_B		562	TLR6, VLRB.59, TOLL-like receptor 6, variable lymp	5e-09
3a79_B		562	TLR6, VLRB.59, TOLL-like receptor 6, variable lymp	3e-05
3a79_B		562	TLR6, VLRB.59, TOLL-like receptor 6, variable lymp	4e-04
2ifg_A		347	High affinity nerve growth factor receptor; TRK, T	3e-09
2ifg_A		347	High affinity nerve growth factor receptor; TRK, T	2e-06
2ifg_A		347	High affinity nerve growth factor receptor; TRK, T	9e-05
1ogq_A		313	PGIP-2, polygalacturonase inhibiting protein; inhi	4e-09
1ogq_A		313	PGIP-2, polygalacturonase inhibiting protein; inhi	3e-04
1ogq_A		313	PGIP-2, polygalacturonase inhibiting protein; inhi	7e-04
2je0_A		149	Acidic leucine-rich nuclear phosphoprotein 32 FAM	2e-08
2je0_A		149	Acidic leucine-rich nuclear phosphoprotein 32 FAM	6e-07
2ell_A		168	Acidic leucine-rich nuclear phosphoprotein 32 FAM	2e-08
2ell_A		168	Acidic leucine-rich nuclear phosphoprotein 32 FAM	4e-07
3ogk_B		592	Coronatine-insensitive protein 1; leucine rich rep	3e-08
3ogk_B		592	Coronatine-insensitive protein 1; leucine rich rep	2e-06
3m19_A		251	Variable lymphocyte receptor A diversity region; a	8e-08
3m19_A		251	Variable lymphocyte receptor A diversity region; a	1e-07
2p1m_B		594	Transport inhibitor response 1 protein; F-BOX, leu	2e-07
2p1m_B		594	Transport inhibitor response 1 protein; F-BOX, leu	2e-06
3rfs_A		272	Internalin B, repeat modules, variable lymphocyte	6e-07
3e6j_A		229	Variable lymphocyte receptor diversity region; var	7e-07
3e6j_A		229	Variable lymphocyte receptor diversity region; var	1e-06
2o6r_A		177	Variable lymphocyte receptor B; leucine-rich repea	1e-06
2ast_B		336	S-phase kinase-associated protein 2; SCF-substrate	1e-05
2o6s_A		208	Variable lymphocyte receptor B; leucine-rich repea	2e-05
1w8a_A		192	SLIT protein; signaling protein, secreted protein,	2e-05
3sfz_A		1249	APAF-1, apoptotic peptidase activating factor 1; a	3e-05
2wfh_A		193	SLIT homolog 2 protein C-product; developmental pr	5e-05
1z7x_W		461	Ribonuclease inhibitor; leucine-rich repeat, enzym	8e-04

>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Length = 591	Back alignment and structure

 Score =  108 bits (272), Expect = 6e-25
 Identities = 22/148 (14%), Positives = 52/148 (35%), Gaps = 12/148 (8%)

Query: 167 LAETLARECGGLPLALKTVGRAMKSQRK-VGDWKRAIHKMTTSASKFSGM--KEEVFSRL 223
            A ++ +EC G PL +  +G  ++        + + +        + S     E +   +
Sbjct: 309 QAHSIIKECKGSPLVVSLIGALLRDFPNRWEYYLKQLQNKQFKRIRKSSSYDYEALDEAM 368

Query: 224 KFSYDSLSTDELRSCLLYCCLYPEDYEIPRRELIDYWISEGFVYDFDDGCDFIDDLLQAC 283
             S + L   +++       +  +D ++P + L   W  E          D + + +   
Sbjct: 369 SISVEMLRE-DIKDYYTDLSILQKDVKVPTKVLCILWDMETEE-----VEDILQEFVNKS 422

Query: 284 LLEEEGDDHV---KMHDMIREMSLWIAC 308
           LL  + +       +HD+  +      C
Sbjct: 423 LLFCDRNGKSFRYYLHDLQVDFLTEKNC 450

PyMOL of 1z6t

>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Length = 549	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390	Back alignment and structure

>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285	Back alignment and structure

>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285	Back alignment and structure

>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606	Back alignment and structure

>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452	Back alignment and structure

>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452	Back alignment and structure

>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306	Back alignment and structure

>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306	Back alignment and structure

>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680	Back alignment and structure

>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477	Back alignment and structure

>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477	Back alignment and structure

>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477	Back alignment and structure

>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549	Back alignment and structure

>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353	Back alignment and structure

>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440	Back alignment and structure

>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466	Back alignment and structure

>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605	Back alignment and structure

>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605	Back alignment and structure

>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605	Back alignment and structure

>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605	Back alignment and structure

>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605	Back alignment and structure

>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605	Back alignment and structure

>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605	Back alignment and structure

>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605	Back alignment and structure

>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605	Back alignment and structure

>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605	Back alignment and structure

>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330	Back alignment and structure

>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330	Back alignment and structure

>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330	Back alignment and structure

>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330	Back alignment and structure

>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361	Back alignment and structure

>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361	Back alignment and structure

>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317	Back alignment and structure

>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317	Back alignment and structure

>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317	Back alignment and structure

>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197	Back alignment and structure

>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197	Back alignment and structure

>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197	Back alignment and structure

>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197	Back alignment and structure

>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197	Back alignment and structure

>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239	Back alignment and structure

>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239	Back alignment and structure

>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239	Back alignment and structure

>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332	Back alignment and structure

>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332	Back alignment and structure

>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332	Back alignment and structure

>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487	Back alignment and structure

>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457	Back alignment and structure

>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457	Back alignment and structure

>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457	Back alignment and structure

>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457	Back alignment and structure

>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455	Back alignment and structure

>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455	Back alignment and structure

>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455	Back alignment and structure

>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455	Back alignment and structure

>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605	Back alignment and structure

>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605	Back alignment and structure

>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605	Back alignment and structure

>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605	Back alignment and structure

>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454	Back alignment and structure

>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350	Back alignment and structure

>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350	Back alignment and structure

>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350	Back alignment and structure

>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350	Back alignment and structure

>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276	Back alignment and structure

>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276	Back alignment and structure

>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220	Back alignment and structure

>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220	Back alignment and structure

>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220	Back alignment and structure

>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308	Back alignment and structure

>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308	Back alignment and structure

>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308	Back alignment and structure

>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308	Back alignment and structure

>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308	Back alignment and structure

>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291	Back alignment and structure

>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291	Back alignment and structure

>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291	Back alignment and structure

>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291	Back alignment and structure

>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291	Back alignment and structure

>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290	Back alignment and structure

>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290	Back alignment and structure

>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290	Back alignment and structure

>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270	Back alignment and structure

>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270	Back alignment and structure

>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567	Back alignment and structure

>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567	Back alignment and structure

>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571	Back alignment and structure

>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571	Back alignment and structure

>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263	Back alignment and structure

>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263	Back alignment and structure

>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263	Back alignment and structure

>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263	Back alignment and structure

>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520	Back alignment and structure

>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520	Back alignment and structure

>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520	Back alignment and structure

>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520	Back alignment and structure

>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622	Back alignment and structure

>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198	Back alignment and structure

>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198	Back alignment and structure

>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312	Back alignment and structure

>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312	Back alignment and structure

>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312	Back alignment and structure

>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176	Back alignment and structure

>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176	Back alignment and structure

>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562	Back alignment and structure

>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562	Back alignment and structure

>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562	Back alignment and structure

>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562	Back alignment and structure

>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347	Back alignment and structure

>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347	Back alignment and structure

>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347	Back alignment and structure

>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313	Back alignment and structure

>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313	Back alignment and structure

>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313	Back alignment and structure

>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149	Back alignment and structure

>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149	Back alignment and structure

>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168	Back alignment and structure

>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168	Back alignment and structure

>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592	Back alignment and structure

>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592	Back alignment and structure

>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251	Back alignment and structure

>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251	Back alignment and structure

>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594	Back alignment and structure

>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594	Back alignment and structure

>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272	Back alignment and structure

>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229	Back alignment and structure

>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229	Back alignment and structure

>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177	Back alignment and structure

>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336	Back alignment and structure

>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208	Back alignment and structure

>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192	Back alignment and structure

>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Length = 1249	Back alignment and structure

>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193	Back alignment and structure

>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		731
2a5y_B		549	CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis	99.94
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	99.94
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	99.92
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	99.91
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	99.91
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	99.91
1o6v_A		466	Internalin A; bacterial infection, extracellular r	99.91
3v47_A		455	TOLL-like receptor 5B and variable lymphocyte REC	99.91
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	99.91
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	99.91
1o6v_A		466	Internalin A; bacterial infection, extracellular r	99.91
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	99.91
2id5_A		477	Lingo-1, leucine rich repeat neuronal 6A; CNS-spec	99.91
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	99.91
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	99.9
2id5_A		477	Lingo-1, leucine rich repeat neuronal 6A; CNS-spec	99.9
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	99.9
2z7x_B		520	TOLL-like receptor 1, variable lymphocyte recepto;	99.9
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	99.9
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	99.9
2z7x_B		520	TOLL-like receptor 1, variable lymphocyte recepto;	99.9
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	99.9
3a79_B		562	TLR6, VLRB.59, TOLL-like receptor 6, variable lymp	99.9
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	99.9
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	99.89
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	99.89
3v47_A		455	TOLL-like receptor 5B and variable lymphocyte REC	99.89
3bz5_A		457	Internalin-J, INLJ; leucine rich repeat (LRR), cys	99.89
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	99.89
2ft3_A		332	Biglycan; proteoglycan, dimer interface, structura	99.89
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	99.89
3a79_B		562	TLR6, VLRB.59, TOLL-like receptor 6, variable lymp	99.89
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	99.89
1xku_A		330	Decorin; proteoglycan, leucine-rich repeat, struct	99.89
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	99.89
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	99.88
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	99.88
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	99.87
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	99.87
3bz5_A		457	Internalin-J, INLJ; leucine rich repeat (LRR), cys	99.87
1ogq_A		313	PGIP-2, polygalacturonase inhibiting protein; inhi	99.87
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	99.86
3sfz_A		1249	APAF-1, apoptotic peptidase activating factor 1; a	99.86
2ft3_A		332	Biglycan; proteoglycan, dimer interface, structura	99.85
1xku_A		330	Decorin; proteoglycan, leucine-rich repeat, struct	99.85
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	99.84
2z80_A		353	TOLL-like receptor 2, variable lymphocyte recepto;	99.84
2z66_A		306	Variable lymphocyte receptor B, TOLL-like recepto;	99.84
2z80_A		353	TOLL-like receptor 2, variable lymphocyte recepto;	99.84
1ogq_A		313	PGIP-2, polygalacturonase inhibiting protein; inhi	99.82
3zyi_A		452	Leucine-rich repeat-containing protein 4; cell adh	99.82
3zyj_A		440	Leucine-rich repeat-containing protein 4C; cell ad	99.82
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	99.82
2z66_A		306	Variable lymphocyte receptor B, TOLL-like recepto;	99.82
4g8a_A		635	TOLL-like receptor 4; leucine rich repeat MD-2 rel	99.82
3zyi_A		452	Leucine-rich repeat-containing protein 4; cell adh	99.82
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	99.81
3zyj_A		440	Leucine-rich repeat-containing protein 4C; cell ad	99.81
4g8a_A		635	TOLL-like receptor 4; leucine rich repeat MD-2 rel	99.81
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	99.81
3o53_A		317	Protein LRIM1, AGAP006348-PA; leucine-rich repeat,	99.8
1ozn_A		285	Reticulon 4 receptor; NOGO receptor, MAD, myelinat	99.8
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	99.79
3o53_A		317	Protein LRIM1, AGAP006348-PA; leucine-rich repeat,	99.79
1ozn_A		285	Reticulon 4 receptor; NOGO receptor, MAD, myelinat	99.78
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	99.78
1z6t_A		591	APAF-1, apoptotic protease activating factor 1; ca	99.77
1p9a_G		290	Platelet glycoprotein IB alpha chain precursor; pl	99.76
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	99.75
1h6u_A		308	Internalin H; cell adhesion, leucine rich repeat,	99.75
2o6q_A		270	Variable lymphocyte receptor A; leucine-rich repea	99.74
3rfs_A		272	Internalin B, repeat modules, variable lymphocyte	99.73
3rfs_A		272	Internalin B, repeat modules, variable lymphocyte	99.73
2xwt_C		239	Thyrotropin receptor; signaling protein-immune sys	99.72
2z62_A		276	TOLL-like receptor 4, variable lymphocyte recepto;	99.72
2z62_A		276	TOLL-like receptor 4, variable lymphocyte recepto;	99.72
1h6u_A		308	Internalin H; cell adhesion, leucine rich repeat,	99.72
2o6q_A		270	Variable lymphocyte receptor A; leucine-rich repea	99.71
2xwt_C		239	Thyrotropin receptor; signaling protein-immune sys	99.71
1wwl_A		312	Monocyte differentiation antigen CD14; LPS, immune	99.71
1p9a_G		290	Platelet glycoprotein IB alpha chain precursor; pl	99.69
1z7x_W		461	Ribonuclease inhibitor; leucine-rich repeat, enzym	99.68
3ogk_B		592	Coronatine-insensitive protein 1; leucine rich rep	99.67
1wwl_A		312	Monocyte differentiation antigen CD14; LPS, immune	99.66
4ay9_X		350	Follicle-stimulating hormone receptor; hormone-rec	99.66
4ay9_X		350	Follicle-stimulating hormone receptor; hormone-rec	99.64
1h6t_A		291	Internalin B; cell adhesion, leucine rich repeat,	99.64
3m19_A		251	Variable lymphocyte receptor A diversity region; a	99.63
1z7x_W		461	Ribonuclease inhibitor; leucine-rich repeat, enzym	99.63
3ogk_B		592	Coronatine-insensitive protein 1; leucine rich rep	99.63
1h6t_A		291	Internalin B; cell adhesion, leucine rich repeat,	99.61
2ast_B		336	S-phase kinase-associated protein 2; SCF-substrate	99.61
1m9s_A		605	Internalin B; cell invasion, GW domains, SH3 domai	99.59
3m19_A		251	Variable lymphocyte receptor A diversity region; a	99.58
4glp_A		310	Monocyte differentiation antigen CD14; alpha beta	99.58
2ca6_A		386	RAN GTPase-activating protein 1; GAP, GTPase activ	99.58
1m9s_A		605	Internalin B; cell invasion, GW domains, SH3 domai	99.57
2ast_B		336	S-phase kinase-associated protein 2; SCF-substrate	99.57
2o6s_A		208	Variable lymphocyte receptor B; leucine-rich repea	99.55
2ca6_A		386	RAN GTPase-activating protein 1; GAP, GTPase activ	99.55
2p1m_B		594	Transport inhibitor response 1 protein; F-BOX, leu	99.55
3goz_A		362	Leucine-rich repeat-containing protein; LEGL7, NES	99.52
3cvr_A		571	Invasion plasmid antigen; leucine rich repeat and	99.52
3e6j_A		229	Variable lymphocyte receptor diversity region; var	99.52
4glp_A		310	Monocyte differentiation antigen CD14; alpha beta	99.52
4ezg_A		197	Putative uncharacterized protein; internalin-A, le	99.51
2v9t_B		220	SLIT homolog 2 protein N-product; structural prote	99.5
2o6s_A		208	Variable lymphocyte receptor B; leucine-rich repea	99.49
2v9t_B		220	SLIT homolog 2 protein N-product; structural prote	99.48
4ezg_A		197	Putative uncharacterized protein; internalin-A, le	99.48
1xeu_A		263	Internalin C; cellular invasion, leucine-rich repe	99.48
3cvr_A		571	Invasion plasmid antigen; leucine rich repeat and	99.47
2v70_A		220	SLIT-2, SLIT homolog 2 protein N-product; neurogen	99.47
1xeu_A		263	Internalin C; cellular invasion, leucine-rich repe	99.46
3goz_A		362	Leucine-rich repeat-containing protein; LEGL7, NES	99.46
3e6j_A		229	Variable lymphocyte receptor diversity region; var	99.46
2v70_A		220	SLIT-2, SLIT homolog 2 protein N-product; neurogen	99.44
2p1m_B		594	Transport inhibitor response 1 protein; F-BOX, leu	99.44
2xot_A		361	Amphoterin-induced protein 1; cell adhesion, neuro	99.43
2xot_A		361	Amphoterin-induced protein 1; cell adhesion, neuro	99.41
2ell_A		168	Acidic leucine-rich nuclear phosphoprotein 32 FAM	99.39
1a9n_A		176	U2A', U2A'; complex (nuclear protein/RNA), RNA, sn	99.37
2je0_A		149	Acidic leucine-rich nuclear phosphoprotein 32 FAM	99.36
2o6r_A		177	Variable lymphocyte receptor B; leucine-rich repea	99.34
1w8a_A		192	SLIT protein; signaling protein, secreted protein,	99.32
2wfh_A		193	SLIT homolog 2 protein C-product; developmental pr	99.31
2je0_A		149	Acidic leucine-rich nuclear phosphoprotein 32 FAM	99.28
2ell_A		168	Acidic leucine-rich nuclear phosphoprotein 32 FAM	99.28
4b8c_D		727	Glucose-repressible alcohol dehydrogenase transcr	99.28
4b8c_D		727	Glucose-repressible alcohol dehydrogenase transcr	99.25
1a9n_A		176	U2A', U2A'; complex (nuclear protein/RNA), RNA, sn	99.24
2wfh_A		193	SLIT homolog 2 protein C-product; developmental pr	99.23
1dce_A		567	Protein (RAB geranylgeranyltransferase alpha subun	99.22
1w8a_A		192	SLIT protein; signaling protein, secreted protein,	99.22
1dce_A		567	Protein (RAB geranylgeranyltransferase alpha subun	99.22
2r9u_A		174	Variable lymphocyte receptor; adaptive immunity, V	99.11
1ds9_A		198	Outer arm dynein; leucine-rich repeat, beta-BETA-a	99.11
3g39_A		170	Variable lymphocyte receptor VLRB.2D; antibody, X-	99.1
2o6r_A		177	Variable lymphocyte receptor B; leucine-rich repea	99.09
2r9u_A		174	Variable lymphocyte receptor; adaptive immunity, V	99.05
3sb4_A		329	Hypothetical leucine rich repeat protein; LRR, rig	99.04
3g39_A		170	Variable lymphocyte receptor VLRB.2D; antibody, X-	99.0
1ds9_A		198	Outer arm dynein; leucine-rich repeat, beta-BETA-a	99.0
3sb4_A		329	Hypothetical leucine rich repeat protein; LRR, rig	98.98
4fdw_A		401	Leucine rich hypothetical protein; putative cell s	98.87
2ifg_A		347	High affinity nerve growth factor receptor; TRK, T	98.74
2ifg_A		347	High affinity nerve growth factor receptor; TRK, T	98.69
4fdw_A		401	Leucine rich hypothetical protein; putative cell s	98.68
3un9_A		372	NLR family member X1; leucine rich repeat (LRR), a	98.44
3un9_A		372	NLR family member X1; leucine rich repeat (LRR), a	98.32
4fs7_A		394	Uncharacterized protein; leucine-rich repeats, pro	98.16
3e4g_A		176	ATP synthase subunit S, mitochondrial; leucine-ric	98.13
2ra8_A		362	Uncharacterized protein Q64V53_bacfr; WGR domain,	98.11
2ra8_A		362	Uncharacterized protein Q64V53_bacfr; WGR domain,	98.07
3e4g_A		176	ATP synthase subunit S, mitochondrial; leucine-ric	97.97
4fs7_A		394	Uncharacterized protein; leucine-rich repeats, pro	97.82
4gt6_A		394	Cell surface protein; leucine rich repeats, putati	97.81
3rw6_A		267	Nuclear RNA export factor 1; retroviral constituti	97.76
1io0_A		185	Tropomodulin; LRR protein, right-handed super-heli	97.67
3rw6_A		267	Nuclear RNA export factor 1; retroviral constituti	97.53
4gt6_A		394	Cell surface protein; leucine rich repeats, putati	97.46
1io0_A		185	Tropomodulin; LRR protein, right-handed super-heli	97.45
4h09_A		379	Hypothetical leucine rich repeat protein; two LRR_	97.26
4h09_A		379	Hypothetical leucine rich repeat protein; two LRR_	95.6
3rfe_A		130	Platelet glycoprotein IB beta chain; platelet surf	95.04
3rfe_A		130	Platelet glycoprotein IB beta chain; platelet surf	94.72
3qfl_A		115	MLA10; coiled-coil, (CC) domain, NLRS, nucleotide-	90.81
1pgv_A		197	TMD-1, tropomodulin TMD-1; structural genomics, PS	89.14
1pgv_A		197	TMD-1, tropomodulin TMD-1; structural genomics, PS	88.08
2qen_A		350	Walker-type ATPase; unknown function; HET: ADP; 2.	85.49
2fna_A		357	Conserved hypothetical protein; structural genomic	83.17

>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A*	Back alignment and structure

Probab=99.94  E-value=1.1e-29  Score=282.69  Aligned_cols=181  Identities=12%  Similarity=0.111  Sum_probs=139.3

Q ss_pred             hHHHHHHHHHHHHHhhCC-CcceEeeecCCccccccccccccccccc--ccHHHHHHHHHHHcCCchHHHHHHHHHhcCC
Q 038165          116 GRKVVMLTDRVINLRKDG-EKIEVVVEKAPDGAAIELPLAQTIVGQE--LLVDRLAETLARECGGLPLALKTVGRAMKSQ  192 (731)
Q Consensus       116 gsrv~~~~~~~~~l~~~~-~~~~~~~~~~~~~~~~~l~~~~~~~~~~--~~~~~l~~~iv~~c~GlPLal~~~g~~L~~~  192 (731)
                      |++|++|||+..+....+ ....+...++..+++.++|...+ |+..  ..+.+++++|+++|+|+||||+++|+.|+.+
T Consensus       265 gs~ilvTTR~~~v~~~~~~~~~~~~l~~L~~~ea~~Lf~~~a-~~~~~~~~~~~~~~~I~~~c~GlPLAl~~~g~~l~~~  343 (549)
T 2a5y_B          265 RLRCLVTTRDVEISNAASQTCEFIEVTSLEIDECYDFLEAYG-MPMPVGEKEEDVLNKTIELSSGNPATLMMFFKSCEPK  343 (549)
T ss_dssp             TCEEEEEESBGGGGGGCCSCEEEEECCCCCHHHHHHHHHHTS-CCCC--CHHHHHHHHHHHHHTTCHHHHHHHHTTCCSS
T ss_pred             CCEEEEEcCCHHHHHHcCCCCeEEECCCCCHHHHHHHHHHHh-cCCCCchhHHHHHHHHHHHhCCChHHHHHHHHHhccc
Confidence            455555555555554443 22456777888999999999998 7765  4488999999999999999999999999773


Q ss_pred             CChhHHHHHHHHhhcccCCCCCChHHHHhhhhhhccCCChhhHHHHHh-----------HhcccCCCcccChhhHHHHHH
Q 038165          193 RKVGDWKRAIHKMTTSASKFSGMKEEVFSRLKFSYDSLSTDELRSCLL-----------YCCLYPEDYEIPRRELIDYWI  261 (731)
Q Consensus       193 ~~~~~W~~~l~~l~~~~~~~~~~~~~i~~~L~~sy~~L~~~~~k~cfl-----------~~a~fp~~~~~~~~~li~~w~  261 (731)
                       +   |+.+ +.+....+...  ..+|..+|++||++||. ++|.||+           |||+||+++.|+    ++.|+
T Consensus       344 -~---w~~~-~~l~~~l~~~~--~~~i~~~l~~Sy~~L~~-~lk~~f~~Ls~~er~l~~~ls~fp~~~~i~----i~~w~  411 (549)
T 2a5y_B          344 -T---FEKM-AQLNNKLESRG--LVGVECITPYSYKSLAM-ALQRCVEVLSDEDRSALAFAVVMPPGVDIP----VKLWS  411 (549)
T ss_dssp             -S---HHHH-HHHHHHHHHHC--SSTTCCCSSSSSSSHHH-HHHHHHHTSCHHHHHHTTGGGSSCTTCCEE----HHHHH
T ss_pred             -h---HHHH-HHhHHHhhccc--HHHHHHHHhcccccccH-HHHHHHhccchhhhhHhhheeeeCCCCeee----eeeee
Confidence             3   5543 44444322211  12688999999999999 9999999           999999999998    89999


Q ss_pred             Hc--Cccccc-------hhhhhHHHHHHHhhccccc---CCCccchhhHHHHHHHHHhhcc
Q 038165          262 SE--GFVYDF-------DDGCDFIDDLLQACLLEEE---GDDHVKMHDMIREMSLWIACTV  310 (731)
Q Consensus       262 a~--g~~~~~-------~~g~~~~~~L~~~sli~~~---~~~~~~mhdli~dl~~~i~~~~  310 (731)
                      |+  ||+...       +.++ ||++|+++||++..   ...+|+|||++|++|+++++++
T Consensus       412 a~~~G~i~~~~~~~~~~~~~~-~l~~L~~rsLl~~~~~~~~~~~~mHdlv~~~a~~~~~~~  471 (549)
T 2a5y_B          412 CVIPVDICSNEEEQLDDEVAD-RLKRLSKRGALLSGKRMPVLTFKIDHIIHMFLKHVVDAQ  471 (549)
T ss_dssp             HHSCC-------CCCTHHHHH-HHHHTTTBSSCSEEECSSSCEEECCHHHHHHHHTTSCTH
T ss_pred             eeccceeccCCCCCCHHHHHH-HHHHHHHcCCeeEecCCCceEEEeChHHHHHHHHHHHHH
Confidence            99  988642       4555 99999999999986   2457999999999999998764

PyMOL of 2a5y

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B}	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B}	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae}	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A*	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron}	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A	Back alignment and structure

>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A*	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens}	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A*	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A*	Back alignment and structure

>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens}	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697}	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A*	Back alignment and structure

>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens}	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens}	Back alignment and structure

>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens}	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A*	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae}	Back alignment and structure

>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens}	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae}	Back alignment and structure

>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus}	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697}	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A*	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron}	Back alignment and structure

>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A*	Back alignment and structure

>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes}	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae}	Back alignment and structure

>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus}	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A*	Back alignment and structure

>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus}	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A*	Back alignment and structure

>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A*	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens}	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV}	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV}	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A*	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A*	Back alignment and structure

>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes}	Back alignment and structure

>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens}	Back alignment and structure

>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A*	Back alignment and structure

>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus}	Back alignment and structure

>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A*	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A*	Back alignment and structure

>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens}	Back alignment and structure

>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri}	Back alignment and structure

>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens}	Back alignment and structure

>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8	Back alignment and structure

>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A	Back alignment and structure

>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens}	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium}	Back alignment and structure

>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri}	Back alignment and structure

>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A*	Back alignment and structure

>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A	Back alignment and structure

>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens}	Back alignment and structure

>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A*	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A	Back alignment and structure

>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae}	Back alignment and structure

>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A*	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium}	Back alignment and structure

>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae}	Back alignment and structure

>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A*	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae}	Back alignment and structure

>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens}	Back alignment and structure

>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae}	Back alignment and structure

>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1	Back alignment and structure

>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri}	Back alignment and structure

>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A	Back alignment and structure

>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A	Back alignment and structure

>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C*	Back alignment and structure

>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A*	Back alignment and structure

>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A*	Back alignment and structure

>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1	Back alignment and structure

>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri}	Back alignment and structure

>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C*	Back alignment and structure

>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus}	Back alignment and structure

>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A	Back alignment and structure

>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I	Back alignment and structure

>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B*	Back alignment and structure

>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus}	Back alignment and structure

>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C*	Back alignment and structure

>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C*	Back alignment and structure

>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A	Back alignment and structure

>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A	Back alignment and structure

>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I	Back alignment and structure

>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B*	Back alignment and structure

>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A	Back alignment and structure

>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A	Back alignment and structure

>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A	Back alignment and structure

>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A	Back alignment and structure

>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens}	Back alignment and structure

>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A	Back alignment and structure

>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A	Back alignment and structure

>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A	Back alignment and structure

>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri}	Back alignment and structure

>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A	Back alignment and structure

>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B*	Back alignment and structure

>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp}	Back alignment and structure

>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A}	Back alignment and structure

>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus}	Back alignment and structure

>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens}	Back alignment and structure

>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes}	Back alignment and structure

>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A	Back alignment and structure

>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri}	Back alignment and structure

>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A	Back alignment and structure

>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes}	Back alignment and structure

>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes}	Back alignment and structure

>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A}	Back alignment and structure

>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens}	Back alignment and structure

>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes}	Back alignment and structure

>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp}	Back alignment and structure

>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus}	Back alignment and structure

>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens}	Back alignment and structure

>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B*	Back alignment and structure

>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus}	Back alignment and structure

>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus}	Back alignment and structure

>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A	Back alignment and structure

>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4	Back alignment and structure

>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A	Back alignment and structure

>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri}	Back alignment and structure

>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7	Back alignment and structure

>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens}	Back alignment and structure

>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A	Back alignment and structure

>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A	Back alignment and structure

>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C}	Back alignment and structure

>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C}	Back alignment and structure

>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4	Back alignment and structure

>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens}	Back alignment and structure

>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A*	Back alignment and structure

>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7	Back alignment and structure

>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A*	Back alignment and structure

>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus}	Back alignment and structure

>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A	Back alignment and structure

>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D	Back alignment and structure

>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri}	Back alignment and structure

>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus}	Back alignment and structure

>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron}	Back alignment and structure

>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D	Back alignment and structure

>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A	Back alignment and structure

>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron}	Back alignment and structure

>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A	Back alignment and structure

>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7	Back alignment and structure

>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7	Back alignment and structure

>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A	Back alignment and structure

>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens}	Back alignment and structure

>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens}	Back alignment and structure

>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus}	Back alignment and structure

>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A	Back alignment and structure

>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis}	Back alignment and structure

>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis}	Back alignment and structure

>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A	Back alignment and structure

>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus}	Back alignment and structure

>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165}	Back alignment and structure

>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A	Back alignment and structure

>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1	Back alignment and structure

>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A	Back alignment and structure

>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165}	Back alignment and structure

>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1	Back alignment and structure

>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum}	Back alignment and structure

>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum}	Back alignment and structure

>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A*	Back alignment and structure

>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A*	Back alignment and structure

>3qfl_A MLA10; coiled-coil, (CC) domain, NLRS, nucleotide-binding domain, L rich repeat containing receptors, protein binding; 2.00A {Hordeum vulgare}	Back alignment and structure

>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1	Back alignment and structure

>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1	Back alignment and structure

>2qen_A Walker-type ATPase; unknown function; HET: ADP; 2.25A {Pyrococcus abyssi}	Back alignment and structure

>2fna_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE ADP; 2.00A {Sulfolobus solfataricus} SCOP: a.4.5.11 c.37.1.20	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	E-value
Query		731
d2omza2		384	c.10.2.1 (A:33-416) Internalin A {Listeria monocyt	2e-09
d2omza2		384	c.10.2.1 (A:33-416) Internalin A {Listeria monocyt	2e-05
d2omza2		384	c.10.2.1 (A:33-416) Internalin A {Listeria monocyt	5e-05
d2omza2		384	c.10.2.1 (A:33-416) Internalin A {Listeria monocyt	3e-04
d1xkua_		305	c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99	2e-07
d1jl5a_		353	c.10.2.6 (A:) Leucine rich effector protein YopM {	2e-07
d1jl5a_		353	c.10.2.6 (A:) Leucine rich effector protein YopM {	4e-07
d1jl5a_		353	c.10.2.6 (A:) Leucine rich effector protein YopM {	6e-04
d2a5yb3		277	c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenor	2e-06
d1ogqa_		313	c.10.2.8 (A:) Polygalacturonase inhibiting protein	3e-06
d1dcea3		124	c.10.2.2 (A:444-567) Rab geranylgeranyltransferase	2e-05
d1dcea3		124	c.10.2.2 (A:444-567) Rab geranylgeranyltransferase	7e-04
d1a9na_		162	c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom	2e-04
d1h6ua2		227	c.10.2.1 (A:36-262) Internalin H {Listeria monocyt	3e-04
d1h6ua2		227	c.10.2.1 (A:36-262) Internalin H {Listeria monocyt	0.002
d2astb2		284	c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1	4e-04
d1h6ta2		210	c.10.2.1 (A:31-240) Internalin B {Listeria monocyt	6e-04
d1xwdc1		242	c.10.2.7 (C:18-259) Follicle-stimulating hormone r	7e-04
d1xwdc1		242	c.10.2.7 (C:18-259) Follicle-stimulating hormone r	0.002
d1xwdc1		242	c.10.2.7 (C:18-259) Follicle-stimulating hormone r	0.003
d1p9ag_		266	c.10.2.7 (G:) von Willebrand factor binding domain	0.001
d1p9ag_		266	c.10.2.7 (G:) von Willebrand factor binding domain	0.003
d1z7xw1		460	c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (	0.002
d1z7xw1		460	c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (	0.002

>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384	Back information, alignment and structure


class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]

 Score = 57.7 bits (138), Expect = 2e-09
 Identities = 26/159 (16%), Positives = 58/159 (36%), Gaps = 26/159 (16%)

Query: 324 KLTEAPKIEEWEGAKRVSLMGNGIESLSEIPTCPRLVTLLVDENPIVEITD--------- 374
           +L +   +        + L  N I +L+ +    +L  L +  N I  I+          
Sbjct: 230 QLKDIGTLASLTNLTDLDLANNQISNLAPLSGLTKLTELKLGANQISNISPLAGLTALTN 289

Query: 375 -----------GFFQSMSSLRVLSLSENFHLSTLPSGISSLVSLHHLDLSSADITGLPQE 423
                          ++ +L  L+L  N ++S +   +SSL  L  L  ++  ++ +   
Sbjct: 290 LELNENQLEDISPISNLKNLTYLTLYFN-NISDISP-VSSLTKLQRLFFANNKVSDVS-S 346

Query: 424 LKALEKLRYLNLEYAFNLSIIPHQLISGFSNLEVLRLRG 462
           L  L  + +L+  +     + P   ++  + +  L L  
Sbjct: 347 LANLTNINWLSAGHNQISDLTP---LANLTRITQLGLND 382

PyMOL of d2omza2

>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384	Back information, alignment and structure

>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384	Back information, alignment and structure

>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384	Back information, alignment and structure

>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305	Back information, alignment and structure

>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353	Back information, alignment and structure

>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353	Back information, alignment and structure

>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353	Back information, alignment and structure

>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Length = 277	Back information, alignment and structure

>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313	Back information, alignment and structure

>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124	Back information, alignment and structure

>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124	Back information, alignment and structure

>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162	Back information, alignment and structure

>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227	Back information, alignment and structure

>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227	Back information, alignment and structure

>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284	Back information, alignment and structure

>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210	Back information, alignment and structure

>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242	Back information, alignment and structure

>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242	Back information, alignment and structure

>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242	Back information, alignment and structure

>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266	Back information, alignment and structure

>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266	Back information, alignment and structure

>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460	Back information, alignment and structure

>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460	Back information, alignment and structure

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		731
d2omza2		384	Internalin A {Listeria monocytogenes [TaxId: 1639]	99.82
d1xkua_		305	Decorin {Cow (Bos taurus) [TaxId: 9913]}	99.8
d2a5yb3		277	CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI	99.8
d2omza2		384	Internalin A {Listeria monocytogenes [TaxId: 1639]	99.77
d1xkua_		305	Decorin {Cow (Bos taurus) [TaxId: 9913]}	99.74
d1ogqa_		313	Polygalacturonase inhibiting protein PGIP {Kidney	99.74
d1p9ag_		266	von Willebrand factor binding domain of glycoprote	99.72
d1ogqa_		313	Polygalacturonase inhibiting protein PGIP {Kidney	99.7
d1p9ag_		266	von Willebrand factor binding domain of glycoprote	99.66
d1jl5a_		353	Leucine rich effector protein YopM {Yersinia pesti	99.65
d1ozna_		284	Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma	99.63
d1ozna_		284	Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma	99.61
d1h6ua2		227	Internalin H {Listeria monocytogenes [TaxId: 1639]	99.6
d1h6ua2		227	Internalin H {Listeria monocytogenes [TaxId: 1639]	99.59
d1h6ta2		210	Internalin B {Listeria monocytogenes [TaxId: 1639]	99.56
d2omxa2		199	Internalin B {Listeria monocytogenes [TaxId: 1639]	99.56
d1xwdc1		242	Follicle-stimulating hormone receptor {Human (Homo	99.5
d1jl5a_		353	Leucine rich effector protein YopM {Yersinia pesti	99.49
d1h6ta2		210	Internalin B {Listeria monocytogenes [TaxId: 1639]	99.47
d2omxa2		199	Internalin B {Listeria monocytogenes [TaxId: 1639]	99.46
d2astb2		284	Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa	99.41
d1dcea3		124	Rab geranylgeranyltransferase alpha-subunit, C-ter	99.39
d1dcea3		124	Rab geranylgeranyltransferase alpha-subunit, C-ter	99.38
d1a9na_		162	Splicesomal U2A' protein {Human (Homo sapiens) [Ta	99.33
d1xwdc1		242	Follicle-stimulating hormone receptor {Human (Homo	99.33
d2astb2		284	Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa	99.31
d1a9na_		162	Splicesomal U2A' protein {Human (Homo sapiens) [Ta	99.31
d1w8aa_		192	Slit {Fruit fly (Drosophila melanogaster) [TaxId:	99.28
d1w8aa_		192	Slit {Fruit fly (Drosophila melanogaster) [TaxId:	99.11
d1m9la_		198	Outer arm dynein light chain 1 {Green algae (Chlam	98.99
d1m9la_		198	Outer arm dynein light chain 1 {Green algae (Chlam	98.97
d2ifga3		156	High affinity nerve growth factor receptor, N-term	98.85
d1z7xw1		460	Ribonuclease inhibitor {Human (Homo sapiens) [TaxI	98.84
d2ifga3		156	High affinity nerve growth factor receptor, N-term	98.77
d2ca6a1		344	Rna1p (RanGAP1), N-terminal domain {Fission yeast	98.65
d1z7xw1		460	Ribonuclease inhibitor {Human (Homo sapiens) [TaxI	98.52
d2ca6a1		344	Rna1p (RanGAP1), N-terminal domain {Fission yeast	98.46
d1koha1		162	mRNA export factor tap {Human (Homo sapiens) [TaxI	97.68
d1koha1		162	mRNA export factor tap {Human (Homo sapiens) [TaxI	97.36
d1pgva_		167	Tropomodulin C-terminal domain {nematode (Caenorha	96.1
d1pgva_		167	Tropomodulin C-terminal domain {nematode (Caenorha	95.87
d1io0a_		166	Tropomodulin C-terminal domain {Chicken (Gallus ga	94.64
d1io0a_		166	Tropomodulin C-terminal domain {Chicken (Gallus ga	94.45

>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]

Probab=99.82  E-value=2.8e-19  Score=188.34  Aligned_cols=300  Identities=16%  Similarity=0.195  Sum_probs=205.6

Q ss_pred             cccccceEEEeecCCcccCCCCCCCCCeeEEEcccCCccccChhhhcCCCCccEEEcCCCCCCCcccccccCCcCCCEEe
Q 038165          332 EEWEGAKRVSLMGNGIESLSEIPTCPRLVTLLVDENPIVEITDGFFQSMSSLRVLSLSENFHLSTLPSGISSLVSLHHLD  411 (731)
Q Consensus       332 ~~~~~l~~l~l~~~~~~~l~~~~~~~~L~~L~l~~~~l~~~~~~~~~~l~~L~~L~L~~~~~~~~lP~~i~~l~~L~~L~  411 (731)
                      ....+++.+.+.++.+.+++.+..+++|++|++++|.++.+++  ++++++|++|++++| .+..++ .++.+++|++|+
T Consensus        41 ~~l~~l~~L~l~~~~I~~l~gl~~L~nL~~L~Ls~N~l~~l~~--l~~L~~L~~L~L~~n-~i~~i~-~l~~l~~L~~L~  116 (384)
T d2omza2          41 TDLDQVTTLQADRLGIKSIDGVEYLNNLTQINFSNNQLTDITP--LKNLTKLVDILMNNN-QIADIT-PLANLTNLTGLT  116 (384)
T ss_dssp             HHHTTCCEEECCSSCCCCCTTGGGCTTCCEEECCSSCCCCCGG--GTTCTTCCEEECCSS-CCCCCG-GGTTCTTCCEEE
T ss_pred             HHhCCCCEEECCCCCCCCccccccCCCCCEEeCcCCcCCCCcc--ccCCccccccccccc-cccccc-cccccccccccc
Confidence            4456899999999999998888899999999999999988876  889999999999999 787777 488999999999


Q ss_pred             ccCCCCCCcchHHhcCCcCcEeeccccc-----------------------------------------ccccccccccC
Q 038165          412 LSSADITGLPQELKALEKLRYLNLEYAF-----------------------------------------NLSIIPHQLIS  450 (731)
Q Consensus       412 L~~~~l~~lp~~i~~L~~L~~L~L~~~~-----------------------------------------~l~~lp~~~i~  450 (731)
                      +.++.++.++... ....+..+....+.                                         .....+.. ..
T Consensus       117 ~~~~~~~~~~~~~-~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~  194 (384)
T d2omza2         117 LFNNQITDIDPLK-NLTNLNRLELSSNTISDISALSGLTSLQQLSFGNQVTDLKPLANLTTLERLDISSNKVSDISV-LA  194 (384)
T ss_dssp             CCSSCCCCCGGGT-TCTTCSEEEEEEEEECCCGGGTTCTTCSEEEEEESCCCCGGGTTCTTCCEEECCSSCCCCCGG-GG
T ss_pred             ccccccccccccc-ccccccccccccccccccccccccccccccccccccchhhhhccccccccccccccccccccc-cc
Confidence            9988877765322 22222222221110                                         00011111 55


Q ss_pred             CCCCCcEEEeeCcccCCCchhhhhhhhcCCcccchhhhccCCCCcEEEEEeechhHHHhhhCCchhhccceEEEEeecCC
Q 038165          451 GFSNLEVLRLRGCGCCSVTEEEEANVLCADAEPLMKELLGLKRLNVLSWTFRSSLAVQKFLKYPKLVSITQSVWVYQCES  530 (731)
Q Consensus       451 ~l~~L~~L~l~~~~~~~~~~~~~~~~~~~~~~~~i~~l~~L~~L~~l~~~~~~~~~~~~l~~~~~~~~~L~~L~l~~~~~  530 (731)
                      .+++++.+.+++|.+.+.                 ........|+.+++..+.......+    ...+.|+.|.+.+|..
T Consensus       195 ~l~~~~~l~l~~n~i~~~-----------------~~~~~~~~L~~L~l~~n~l~~~~~l----~~l~~L~~L~l~~n~l  253 (384)
T d2omza2         195 KLTNLESLIATNNQISDI-----------------TPLGILTNLDELSLNGNQLKDIGTL----ASLTNLTDLDLANNQI  253 (384)
T ss_dssp             GCTTCSEEECCSSCCCCC-----------------GGGGGCTTCCEEECCSSCCCCCGGG----GGCTTCSEEECCSSCC
T ss_pred             cccccceeeccCCccCCC-----------------CcccccCCCCEEECCCCCCCCcchh----hcccccchhccccCcc
Confidence            677888888888766532                 1123344555555544332222221    2235788888888764


Q ss_pred             CCcccccccccCCccEEeccCCCccceeecCccccccccccccCCccEEEEeccCCCCCchhhccCCccEEeeecccccc
Q 038165          531 APFNVLHLAYMENLQELDLEYCNLEEMKIDCPEEVKKLFRNGFRSLNTVVLRSCRGKDLTWLVFVQNLKVLYIGFCGDME  610 (731)
Q Consensus       531 ~~~~~~~l~~l~~L~~L~l~~~~~~~~~~~~~~~~~~~~~~~l~~L~~L~L~~c~~~~~~~l~~l~~L~~L~L~~~~~l~  610 (731)
                      .+..  .+..+++|+.|+++++.+..++.          ...++.++.+.+..|....+..+..+++++.|+++++ .++
T Consensus       254 ~~~~--~~~~~~~L~~L~l~~~~l~~~~~----------~~~~~~l~~l~~~~n~l~~~~~~~~~~~l~~L~ls~n-~l~  320 (384)
T d2omza2         254 SNLA--PLSGLTKLTELKLGANQISNISP----------LAGLTALTNLELNENQLEDISPISNLKNLTYLTLYFN-NIS  320 (384)
T ss_dssp             CCCG--GGTTCTTCSEEECCSSCCCCCGG----------GTTCTTCSEEECCSSCCSCCGGGGGCTTCSEEECCSS-CCS
T ss_pred             CCCC--cccccccCCEeeccCcccCCCCc----------cccccccccccccccccccccccchhcccCeEECCCC-CCC
Confidence            4332  47778899999999888766422          1236788888888887766677888889999998877 444


Q ss_pred             cccccccccccccccCCCCccCcCccEeeccccccccccCCCCcCCCCccEEeeccccCCCCCCCCCCCCC-CcceEEec
Q 038165          611 EIVSVDKLRDISGIIGSERNFFAQLESLSVWRGINLKSVYPNPLPFPKLKKIEVRECRQLKKLPLNSSSAK-ERRVVIEG  689 (731)
Q Consensus       611 ~l~~~~~~~~~~~~~~~~~~~~~~L~~L~L~~~~~L~~l~~~~~~lp~L~~L~l~~C~~L~~lP~~~~~~~-L~~l~i~~  689 (731)
                      .+.              .+..+++|++|++++| .++.++ ....+|+|++|++++| +++.+|.. ...+ |+.+.|++
T Consensus       321 ~l~--------------~l~~l~~L~~L~L~~n-~l~~l~-~l~~l~~L~~L~l~~N-~l~~l~~l-~~l~~L~~L~L~~  382 (384)
T d2omza2         321 DIS--------------PVSSLTKLQRLFFANN-KVSDVS-SLANLTNINWLSAGHN-QISDLTPL-ANLTRITQLGLND  382 (384)
T ss_dssp             CCG--------------GGGGCTTCCEEECCSS-CCCCCG-GGGGCTTCCEEECCSS-CCCBCGGG-TTCTTCSEEECCC
T ss_pred             CCc--------------ccccCCCCCEEECCCC-CCCCCh-hHcCCCCCCEEECCCC-cCCCChhh-ccCCCCCEeeCCC
Confidence            431              2567889999999887 677766 3566889999999776 67777642 3333 77777654

PyMOL of d2omza2

>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]}	Back information, alignment and structure

>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]}	Back information, alignment and structure

>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]}	Back information, alignment and structure

>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]}	Back information, alignment and structure

>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]}	Back information, alignment and structure

>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}	Back information, alignment and structure

>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}	Back information, alignment and structure

>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]}	Back information, alignment and structure

>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]}	Back information, alignment and structure

>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}	Back information, alignment and structure

>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}	Back information, alignment and structure

>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]}	Back information, alignment and structure

>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]}	Back information, alignment and structure

>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]}	Back information, alignment and structure

>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]}	Back information, alignment and structure