Citrus Sinensis ID: 038182

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-----
MQSPSTVQMTIISLFLIFTLSLSRKAFLASAGKDPPPRFELIHRHSPQLSEHEATAYSPPKNLSERIRQLIDGDIARQEMISRRLEDRRRRGRIRKASEISHHRTFNGTSNIVKIPLRSGADRGLGQYFVSFRVGSPPQKFVLIADTGSDLTWMHCNHKGENCPKDGLTPPNRMFHADASSTFKTIPCSSRTCKVDLQDTFSLSMCPTPVTPCAYDYRFVYKYASGIIFFNILCIKKMISSLYLL
cccccHHHHHHHHHHHHHHHHHHHHHHHHccccccccEEEEEccccccccccccccccccccHHHHHHHHHHccHHHHHHHHHHHHHHHHcccccccccccccccccccccEEEEEcccccccccccEEEEEEEcccccEEEEEEEccccEEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEccccEEEEEEEEEEEEEcccccEEEc
cccHHHHHHHHHHHHHHHHHHHcHHHHHHccccccccEEEEEEcccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHcccccccccccccccccccccccccccEEEEEEEcccccccEEEEEEccccEEEEEEccccccccccccccccccccccccccccccccccHHHHHcccccccccccccccccEEEEEEEccccccccEEEEEEEEccccccEEEc
MQSPSTVQMTIISLFLIFTLSLSRKAFLasagkdppprfelihrhspqlseheataysppknlSERIRQLIDGDIARQEMISRRLEDRRRRGrirkaseishhrtfngtsnivkiplrsgadrglgQYFVsfrvgsppqkFVLIAdtgsdltwmhcnhkgencpkdgltppnrmfhadasstfktipcssrtckvdlqdtfslsmcptpvtpcaydyRFVYKYASGIIFFNILCIKKMISSLYLL
MQSPSTVQMTIISLFLIFTLSLSRKAFLASAGKDPPPRFELIHRhspqlseheataysppknlSERIRQLidgdiarqemisrrledrrrrgrirkaseishhrtfngtsnivkiPLRSGADRGLGQYFVSFRVGSPPQKFVLIADTGSDLTWMHCNHKGENCPKDGLTPPNRMFHADASStfktipcssrTCKVDLQDTFSLSMCPTPVTPCAYDYRFVYKYASGIIFFNILCIKKMISSLYLL
MQSPSTVQMtiislfliftlslsRKAFLASAGKDPPPRFELIHRHSPQLSEHEATAYSPPKNLSERIRQLIDGDIARQEMISrrledrrrrgrirKASEISHHRTFNGTSNIVKIPLRSGADRGLGQYFVSFRVGSPPQKFVLIADTGSDLTWMHCNHKGENCPKDGLTPPNRMFHADASSTFKTIPCSSRTCKVDLQDTFSLSMCPTPVTPCAYDYRFVYKYASGIIFFNILCIKKMISSLYLL
*******QMTIISLFLIFTLSLSRKAFLA******************************************************************************GTSNIVKIPLRSGADRGLGQYFVSFRVGSPPQKFVLIADTGSDLTWMHCNHKGENC*****************STFKTIPCSSRTCKVDLQDTFSLSMCPTPVTPCAYDYRFVYKYASGIIFFNILCIKKMISSLYL*
**********IISLFLIFTLSLSRK****************IHR***********************RQLIDGDIARQEMI*************************************SGADRGLGQYFVSFRVGSPPQKFVLIADTGSDLTWMHCNHKGENCP*********MFH***SS**KTIPCSSRTCKVD**************TPCAYDYRFVYKYASGIIFFNILCIKKMI**LYLL
********MTIISLFLIFTLSLSRKAFLASAGKDPPPRFELIHRHSPQLSEHEATAYSPPKNLSERIRQLIDGDIARQEMISRRLEDRRRRGRIRKASEISHHRTFNGTSNIVKIPLRSGADRGLGQYFVSFRVGSPPQKFVLIADTGSDLTWMHCNHKGENCPKDGLTPPNRMFHADASSTFKTIPCSSRTCKVDLQDTFSLSMCPTPVTPCAYDYRFVYKYASGIIFFNILCIKKMISSLYLL
**SPSTVQMTIISLFLIFTLSLSRKAFLASAGKDPPPRFELIHRHSPQLSEHEATA*SPPKNLSERIRQLIDGDIARQEMISRRLEDRRR****************************S*ADRGLGQYFVSFRVGSPPQKFVLIADTGSDLTWMHCNHKGENCPKDGLTPPNRMFHADASSTFKTIPCSSRTCKVDLQDTFSLSMCPTPVTPCAYDYRFVYKYASGIIFFNILCIKKMISSLYLL
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHiiiiiiiiii
iiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MQSPSTVQMTIISLFLIFTLSLSRKAFLASAGKDPPPRFELIHRHSPQLSEHEATAYSPPKNLSERIRQLIDGDIARQEMISRRLEDRRRRGRIRKASEISHHRTFNGTSNIVKIPLRSGADRGLGQYFVSFRVGSPPQKFVLIADTGSDLTWMHCNHKGENCPKDGLTPPNRMFHADASSTFKTIPCSSRTCKVDLQDTFSLSMCPTPVTPCAYDYRFVYKYASGIIFFNILCIKKMISSLYLL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query245 2.2.26 [Sep-21-2011]
Q3EBM5 447 Probable aspartic proteas no no 0.579 0.317 0.297 8e-12
Q9LS40 500 Protein ASPARTIC PROTEASE no no 0.306 0.15 0.375 6e-09
Q766C3 437 Aspartic proteinase nepen N/A no 0.669 0.375 0.254 7e-09
Q766C2 438 Aspartic proteinase nepen N/A no 0.571 0.319 0.272 9e-09
Q6XBF8 437 Aspartic proteinase CDR1 no no 0.632 0.354 0.284 5e-08
Q9LHE3 470 Protein ASPARTIC PROTEASE no no 0.481 0.251 0.291 1e-06
Q9S9K4 475 Aspartic proteinase-like no no 0.591 0.305 0.269 2e-06
A2ZC67 410 Aspartic proteinase Asp1 N/A no 0.395 0.236 0.275 7e-06
Q9LZL3 453 Aspartic proteinase PCS1 no no 0.228 0.123 0.365 4e-05
P00799 430 Mucorpepsin OS=Rhizomucor N/A no 0.404 0.230 0.307 0.0003
>sp|Q3EBM5|ASPR1_ARATH Probable aspartic protease At2g35615 OS=Arabidopsis thaliana GN=At2g35615 PE=3 SV=1 Back     alignment and function desciption
 Score = 70.9 bits (172), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 55/185 (29%), Positives = 86/185 (46%), Gaps = 43/185 (23%)

Query: 11  IISLFLIFTLSLSRKAFLASAGKDPPPRFELIHRHSPQLSEHEATAYSPPKNLSERIRQL 70
           ++  FL F+++LS      S+G       ELIHR SP      +  Y+P   +++R+   
Sbjct: 6   LLCFFLFFSVTLS------SSGHPKNFSVELIHRDSPL-----SPIYNPQITVTDRLNAA 54

Query: 71  IDGDIARQEMISRRLEDRRRRGRIRKASEISHHRTFNGTSNIVKIPLRSGADRGLGQYFV 130
               ++R    SRR                 +H+       + +  L+SG     G++F+
Sbjct: 55  FLRSVSR----SRRF----------------NHQ-------LSQTDLQSGLIGADGEFFM 87

Query: 131 SFRVGSPPQKFVLIADTGSDLTWMHCNHKGENCPKDGLTPPNRMFHADASSTFKTIPCSS 190
           S  +G+PP K   IADTGSDLTW+ C    + C K+       +F    SST+K+ PC S
Sbjct: 88  SITIGTPPIKVFAIADTGSDLTWVQC-KPCQQCYKEN----GPIFDKKKSSTYKSEPCDS 142

Query: 191 RTCKV 195
           R C+ 
Sbjct: 143 RNCQA 147

Arabidopsis thaliana (taxid: 3702)
EC: 3EC: .EC: 4EC: .EC: -EC: .EC: -
>sp|Q9LS40|ASPG1_ARATH Protein ASPARTIC PROTEASE IN GUARD CELL 1 OS=Arabidopsis thaliana GN=ASPG1 PE=1 SV=1 Back     alignment and function description
>sp|Q766C3|NEP1_NEPGR Aspartic proteinase nepenthesin-1 OS=Nepenthes gracilis GN=nep1 PE=1 SV=1 Back     alignment and function description
>sp|Q766C2|NEP2_NEPGR Aspartic proteinase nepenthesin-2 OS=Nepenthes gracilis GN=nep2 PE=1 SV=1 Back     alignment and function description
>sp|Q6XBF8|CDR1_ARATH Aspartic proteinase CDR1 OS=Arabidopsis thaliana GN=CDR1 PE=1 SV=1 Back     alignment and function description
>sp|Q9LHE3|ASPG2_ARATH Protein ASPARTIC PROTEASE IN GUARD CELL 2 OS=Arabidopsis thaliana GN=ASPG2 PE=2 SV=1 Back     alignment and function description
>sp|Q9S9K4|ASPL2_ARATH Aspartic proteinase-like protein 2 OS=Arabidopsis thaliana GN=At1g65240 PE=1 SV=2 Back     alignment and function description
>sp|A2ZC67|ASP1_ORYSI Aspartic proteinase Asp1 OS=Oryza sativa subsp. indica GN=ASP1 PE=2 SV=2 Back     alignment and function description
>sp|Q9LZL3|PCS1L_ARATH Aspartic proteinase PCS1 OS=Arabidopsis thaliana GN=PCS1 PE=2 SV=1 Back     alignment and function description
>sp|P00799|CARP_RHIMI Mucorpepsin OS=Rhizomucor miehei PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query245
147814824 449 hypothetical protein VITISV_015630 [Viti 0.697 0.380 0.473 2e-40
255554715 489 Aspartic proteinase Asp1 precursor, puta 0.677 0.339 0.486 2e-40
359494621 449 PREDICTED: aspartic proteinase nepenthes 0.697 0.380 0.468 2e-39
297829808 449 hypothetical protein ARALYDRAFT_478632 [ 0.669 0.365 0.383 2e-28
238479750263 aspartyl protease family protein [Arabid 0.746 0.695 0.350 7e-28
30682289 461 aspartyl protease family protein [Arabid 0.730 0.388 0.363 1e-27
17979392 439 unknown protein [Arabidopsis thaliana] 0.730 0.407 0.363 1e-27
297736090 378 unnamed protein product [Vitis vinifera] 0.404 0.261 0.572 1e-27
212722026 441 uncharacterized protein LOC100193034 pre 0.571 0.317 0.413 1e-25
242091325 466 hypothetical protein SORBIDRAFT_09g02805 0.489 0.257 0.446 1e-24
>gi|147814824|emb|CAN65806.1| hypothetical protein VITISV_015630 [Vitis vinifera] Back     alignment and taxonomy information
 Score =  171 bits (434), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 89/188 (47%), Positives = 122/188 (64%), Gaps = 17/188 (9%)

Query: 38  RFELIHRHSPQLSEHEATAYSPPKNLSERIRQLIDGDIARQEMISRRLEDRRRRGRI--R 95
           R ELIHRHSPQ+          PK   +R+++L+  D  RQ MI  +L    R G+I  R
Sbjct: 2   RLELIHRHSPQV-------MGRPKTQLQRLKELVHSDSVRQLMILHKL----RGGQIPRR 50

Query: 96  KASEISHHRTFNGTSNIVKIPLRSGADRGLGQYFVSFRVGSPPQKFVLIADTGSDLTWMH 155
           KA E+    +  G+ + +++P+   AD G+GQYFV+F+VG+P QKF+L+ADTGSDLTWM 
Sbjct: 51  KAKEVLSSSSGRGSDDAIEVPMHPAADYGIGQYFVAFKVGTPSQKFMLVADTGSDLTWMS 110

Query: 156 CNH--KGENCP--KDGLTPPNRMFHADASSTFKTIPCSSRTCKVDLQDTFSLSMCPTPVT 211
           C +  +  NC   K       R+FHA+ SS+FKTIPC +  CK++L D FSL+ CPTP+T
Sbjct: 111 CKYHCRSRNCSNRKARRIRHKRVFHANLSSSFKTIPCLTDMCKIELMDLFSLTNCPTPLT 170

Query: 212 PCAYDYRF 219
           PC YDYR+
Sbjct: 171 PCGYDYRY 178

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|255554715|ref|XP_002518395.1| Aspartic proteinase Asp1 precursor, putative [Ricinus communis] gi|223542240|gb|EEF43782.1| Aspartic proteinase Asp1 precursor, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|359494621|ref|XP_002265771.2| PREDICTED: aspartic proteinase nepenthesin-2-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|297829808|ref|XP_002882786.1| hypothetical protein ARALYDRAFT_478632 [Arabidopsis lyrata subsp. lyrata] gi|297328626|gb|EFH59045.1| hypothetical protein ARALYDRAFT_478632 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|238479750|ref|NP_001154610.1| aspartyl protease family protein [Arabidopsis thaliana] gi|332641716|gb|AEE75237.1| aspartyl protease family protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|30682289|ref|NP_187876.2| aspartyl protease family protein [Arabidopsis thaliana] gi|11994412|dbj|BAB02414.1| chloroplast nucleoid DNA binding protein-like [Arabidopsis thaliana] gi|332641715|gb|AEE75236.1| aspartyl protease family protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|17979392|gb|AAL49921.1| unknown protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297736090|emb|CBI24128.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|212722026|ref|NP_001131674.1| uncharacterized protein LOC100193034 precursor [Zea mays] gi|194692214|gb|ACF80191.1| unknown [Zea mays] gi|413946454|gb|AFW79103.1| hypothetical protein ZEAMMB73_752316 [Zea mays] Back     alignment and taxonomy information
>gi|242091325|ref|XP_002441495.1| hypothetical protein SORBIDRAFT_09g028050 [Sorghum bicolor] gi|241946780|gb|EES19925.1| hypothetical protein SORBIDRAFT_09g028050 [Sorghum bicolor] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query245
TAIR|locus:2087790 461 NANA "NANA" [Arabidopsis thali 0.502 0.266 0.477 4e-29
TAIR|locus:504955954 447 AT2G35615 [Arabidopsis thalian 0.448 0.246 0.366 1.3e-14
TAIR|locus:2206184 445 AT1G31450 [Arabidopsis thalian 0.4 0.220 0.386 1.3e-14
TAIR|locus:2102335 452 AT3G25700 [Arabidopsis thalian 0.420 0.227 0.398 3.9e-13
TAIR|locus:2010786 431 AT1G64830 [Arabidopsis thalian 0.326 0.185 0.377 3.5e-10
TAIR|locus:2145954 437 CDR1 "CONSTITUTIVE DISEASE RES 0.412 0.231 0.333 4.3e-10
TAIR|locus:2183617 482 AT5G36260 [Arabidopsis thalian 0.457 0.232 0.311 6.9e-10
TAIR|locus:2172661 493 AT5G22850 [Arabidopsis thalian 0.481 0.239 0.300 5.4e-09
TAIR|locus:2205861 405 AT1G44130 [Arabidopsis thalian 0.448 0.271 0.362 1.2e-08
TAIR|locus:2095042 500 ASPG1 "ASPARTIC PROTEASE IN GU 0.306 0.15 0.375 1.7e-08
TAIR|locus:2087790 NANA "NANA" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 303 (111.7 bits), Expect = 4.0e-29, Sum P(2) = 4.0e-29
 Identities = 63/132 (47%), Positives = 84/132 (63%)

Query:    98 SEISHHRTFNGTSNIVKIPLRSGADRGLGQYFVSFRVGSPPQKFVLIADTGSDLTWMHCN 157
             S IS  R  N T   VK+ L SG D G  QYF   RVG+P +KF ++ DTGS+LTW++C 
Sbjct:    79 SLISRKR--NSTVG-VKMDLGSGIDYGTAQYFTEIRVGTPAKKFRVVVDTGSELTWVNCR 135

Query:   158 HKGENCPKDGLTPPNRMFHADASSTFKTIPCSSRTCKVDLQDTFSLSMCPTPVTPCAYDY 217
             ++     KD      R+F AD S +FKT+ C ++TCKVDL + FSL+ CPTP TPC+YDY
Sbjct:   136 YRARG--KDN----RRVFRADESKSFKTVGCLTQTCKVDLMNLFSLTTCPTPSTPCSYDY 189

Query:   218 RFVYKYASGIIF 229
             R+    A+  +F
Sbjct:   190 RYADGSAAQGVF 201
GO:0005576 "extracellular region" evidence=ISM
GO:0005634 "nucleus" evidence=ISM
GO:0006508 "proteolysis" evidence=ISS
GO:0004190 "aspartic-type endopeptidase activity" evidence=IDA
GO:0005975 "carbohydrate metabolic process" evidence=IMP
GO:0009507 "chloroplast" evidence=IDA
GO:0010019 "chloroplast-nucleus signaling pathway" evidence=IMP
TAIR|locus:504955954 AT2G35615 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2206184 AT1G31450 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2102335 AT3G25700 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2010786 AT1G64830 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2145954 CDR1 "CONSTITUTIVE DISEASE RESISTANCE 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2183617 AT5G36260 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2172661 AT5G22850 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2205861 AT1G44130 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2095042 ASPG1 "ASPARTIC PROTEASE IN GUARD CELL 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00002125001
SubName- Full=Chromosome chr19 scaffold_126, whole genome shotgun sequence; (479 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query245
PLN03146 431 PLN03146, PLN03146, aspartyl protease family prote 2e-18
cd05476 265 cd05476, pepsin_A_like_plant, Chroloplast Nucleoid 5e-11
cd05471 283 cd05471, pepsin_like, Pepsin-like aspartic proteas 1e-10
cd05475 273 cd05475, nucellin_like, Nucellins, plant aspartic 4e-09
PTZ00165 482 PTZ00165, PTZ00165, aspartyl protease; Provisional 4e-08
cd05470109 cd05470, pepsin_retropepsin_like, Cellular and ret 8e-08
cd05472 299 cd05472, cnd41_like, Chloroplast Nucleoids DNA-bin 9e-06
pfam00026 316 pfam00026, Asp, Eukaryotic aspartyl protease 2e-05
cd06096 326 cd06096, Plasmepsin_5, Plasmepsins are a class of 5e-05
cd06098 317 cd06098, phytepsin, Phytepsin, a plant homolog of 5e-04
cd05488 320 cd05488, Proteinase_A_fungi, Fungal Proteinase A , 8e-04
cd05474 295 cd05474, SAP_like, SAPs, pepsin-like proteinases s 0.001
cd05478 317 cd05478, pepsin_A, Pepsin A, aspartic protease pro 0.003
cd06097 278 cd06097, Aspergillopepsin_like, Aspergillopepsin_l 0.003
cd05490 325 cd05490, Cathepsin_D2, Cathepsin_D2, pepsin family 0.004
>gnl|CDD|178691 PLN03146, PLN03146, aspartyl protease family protein; Provisional Back     alignment and domain information 
 Score = 82.8 bits (205), Expect = 2e-18
 Identities = 52/186 (27%), Positives = 80/186 (43%), Gaps = 45/186 (24%)

Query: 10  TIISLFLIFTLSLSRKAFLASAGKDPPPRF--ELIHRHSPQLSEHEATAYSPPKNLSERI 67
            +++L L     LS     A A   P   F  +LIHR SP+     +  Y+P +  S+R+
Sbjct: 3   VLLALCLFSFSELS----AAEA---PKGGFTVDLIHRDSPK-----SPFYNPSETPSQRL 50

Query: 68  RQLIDGDIARQEMISRRLEDRRRRGRIRKASEISHHRTFNGTSNIVKIPLRSGADRGLGQ 127
           R                          R  S ++H R  + + N  +  L S      G+
Sbjct: 51  RNAFR----------------------RSISRVNHFRPTDASPNDPQSDLISNG----GE 84

Query: 128 YFVSFRVGSPPQKFVLIADTGSDLTWMHCNHKGENCPKDGLTPPNRMFHADASSTFKTIP 187
           Y ++  +G+PP   + IADTGSDL W  C    ++C K  ++P   +F    SST+K + 
Sbjct: 85  YLMNISIGTPPVPILAIADTGSDLIWTQCK-PCDDCYKQ-VSP---LFDPKKSSTYKDVS 139

Query: 188 CSSRTC 193
           C S  C
Sbjct: 140 CDSSQC 145

Length = 431
>gnl|CDD|133143 cd05476, pepsin_A_like_plant, Chroloplast Nucleoids DNA-binding Protease and Nucellin, pepsin-like aspartic proteases from plants Back     alignment and domain information
>gnl|CDD|133138 cd05471, pepsin_like, Pepsin-like aspartic proteases, bilobal enzymes that cleave bonds in peptides at acidic pH Back     alignment and domain information
>gnl|CDD|133142 cd05475, nucellin_like, Nucellins, plant aspartic proteases specifically expressed in nucellar cells during degradation Back     alignment and domain information
>gnl|CDD|240300 PTZ00165, PTZ00165, aspartyl protease; Provisional Back     alignment and domain information
>gnl|CDD|133137 cd05470, pepsin_retropepsin_like, Cellular and retroviral pepsin-like aspartate proteases Back     alignment and domain information
>gnl|CDD|133139 cd05472, cnd41_like, Chloroplast Nucleoids DNA-binding Protease, catalyzes the degradation of ribulose-1,5-bisphosphate carboxylase/oxygenase Back     alignment and domain information
>gnl|CDD|215663 pfam00026, Asp, Eukaryotic aspartyl protease Back     alignment and domain information
>gnl|CDD|133160 cd06096, Plasmepsin_5, Plasmepsins are a class of aspartic proteinases produced by the plasmodium parasite Back     alignment and domain information
>gnl|CDD|133162 cd06098, phytepsin, Phytepsin, a plant homolog of mammalian lysosomal pepsins Back     alignment and domain information
>gnl|CDD|133155 cd05488, Proteinase_A_fungi, Fungal Proteinase A , aspartic proteinase superfamily Back     alignment and domain information
>gnl|CDD|133141 cd05474, SAP_like, SAPs, pepsin-like proteinases secreted from pathogens to degrade host proteins Back     alignment and domain information
>gnl|CDD|133145 cd05478, pepsin_A, Pepsin A, aspartic protease produced in gastric mucosa of mammals Back     alignment and domain information
>gnl|CDD|133161 cd06097, Aspergillopepsin_like, Aspergillopepsin_like, aspartic proteases of fungal origin Back     alignment and domain information
>gnl|CDD|133157 cd05490, Cathepsin_D2, Cathepsin_D2, pepsin family of proteinases Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 245
PLN03146 431 aspartyl protease family protein; Provisional 100.0
KOG1339 398 consensus Aspartyl protease [Posttranslational mod 99.88
cd06096 326 Plasmepsin_5 Plasmepsins are a class of aspartic p 99.86
PF14543164 TAXi_N: Xylanase inhibitor N-terminal; PDB: 3HD8_A 99.85
cd05490 325 Cathepsin_D2 Cathepsin_D2, pepsin family of protei 99.76
cd05470109 pepsin_retropepsin_like Cellular and retroviral pe 99.76
PTZ00165 482 aspartyl protease; Provisional 99.75
cd05478 317 pepsin_A Pepsin A, aspartic protease produced in g 99.75
PTZ00147 453 plasmepsin-1; Provisional 99.75
cd05477 318 gastricsin Gastricsins, asparate proteases produce 99.74
cd05486 316 Cathespin_E Cathepsin E, non-lysosomal aspartic pr 99.73
PTZ00013 450 plasmepsin 4 (PM4); Provisional 99.73
cd06098 317 phytepsin Phytepsin, a plant homolog of mammalian 99.72
cd05487 326 renin_like Renin stimulates production of angioten 99.72
cd05488 320 Proteinase_A_fungi Fungal Proteinase A , aspartic 99.71
cd05473 364 beta_secretase_like Beta-secretase, aspartic-acid 99.71
cd06097 278 Aspergillopepsin_like Aspergillopepsin_like, aspar 99.7
cd05485 329 Cathepsin_D_like Cathepsin_D_like, pepsin family o 99.7
cd05475 273 nucellin_like Nucellins, plant aspartic proteases 99.53
cd05471 283 pepsin_like Pepsin-like aspartic proteases, biloba 99.52
cd05472 299 cnd41_like Chloroplast Nucleoids DNA-binding Prote 99.48
PF00026 317 Asp: Eukaryotic aspartyl protease The Prosite entr 99.48
cd05489 362 xylanase_inhibitor_I_like TAXI-I inhibits degradat 99.41
cd05476 265 pepsin_A_like_plant Chroloplast Nucleoids DNA-bind 99.3
cd05474 295 SAP_like SAPs, pepsin-like proteinases secreted fr 99.02
cd0548396 retropepsin_like_bacteria Bacterial aspartate prot 95.49
cd0548491 retropepsin_like_LTR_2 Retropepsins_like_LTR, peps 88.18
TIGR02281121 clan_AA_DTGA clan AA aspartic protease, TIGR02281 85.96
>PLN03146 aspartyl protease family protein; Provisional Back     alignment and domain information 
Probab=100.00  E-value=1.2e-34  Score=273.69  Aligned_cols=164  Identities=29%  Similarity=0.528  Sum_probs=133.1

Q ss_pred             CCCCCeEEEEeccCCCcccccccCCCCCCChHHHHHHHHhhcHHHHHHHHHhhhhhhhcccccccccccccccccCCCce
Q 038182           33 KDPPPRFELIHRHSPQLSEHEATAYSPPKNLSERIRQLIDGDIARQEMISRRLEDRRRRGRIRKASEISHHRTFNGTSNI  112 (245)
Q Consensus        33 ~~~~~~~~L~Hr~sp~sp~~~~~~~~p~~~~~~~~~~~~~~D~~R~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  112 (245)
                      ++++++++|+||+++|+|.     +.++.++.++++++++||.+|+++|.++.           +           ....
T Consensus        21 ~~~~~~~~l~h~~~~~sp~-----~~~~~~~~~~~~~~~~~~~~r~~~~~~~~-----------~-----------~~~~   73 (431)
T PLN03146         21 PKGGFTVDLIHRDSPKSPF-----YNPSETPSQRLRNAFRRSISRVNHFRPTD-----------A-----------SPND   73 (431)
T ss_pred             cCCceEEEEEeCCCCCCCC-----CCCCCChhHHHHHHHHHHHHHHHHHhhcc-----------c-----------cCCc
Confidence            4588999999999999984     34556778999999999999999885431           0           0112


Q ss_pred             eeeeeeeCCCCCceeEEEEEEeCCCCceEEEEEeCCCCceeeecC-CCCCCCCCCCCCCCCCCCCCCCCCcceeccCCCc
Q 038182          113 VKIPLRSGADRGLGQYFVSFRVGSPPQKFVLIADTGSDLTWMHCN-HKGENCPKDGLTPPNRMFHADASSTFKTIPCSSR  191 (245)
Q Consensus       113 ~~~Pl~~g~~~~~~~Y~v~i~iGTPpq~~~vilDTGSdl~Wv~C~-C~~~~C~~~~~~~~~~~fdps~SsT~~~v~C~s~  191 (245)
                      +..++.    .+.++|+++|.||||||++.|++||||+++||||. |..  |+.|.    ++.|||++|+||+.++|+++
T Consensus        74 ~~~~~~----~~~~~Y~v~i~iGTPpq~~~vi~DTGS~l~Wv~C~~C~~--C~~~~----~~~fdps~SST~~~~~C~s~  143 (431)
T PLN03146         74 PQSDLI----SNGGEYLMNISIGTPPVPILAIADTGSDLIWTQCKPCDD--CYKQV----SPLFDPKKSSTYKDVSCDSS  143 (431)
T ss_pred             cccCcc----cCCccEEEEEEcCCCCceEEEEECCCCCcceEcCCCCcc--cccCC----CCcccCCCCCCCcccCCCCc
Confidence            233333    34589999999999999999999999999999999 965  98765    36899999999999999999


Q ss_pred             ccccccccccCCCCCCCCCCCCcEEEEecCCce-EEEEEEEEEEECcc
Q 038182          192 TCKVDLQDTFSLSMCPTPVTPCAYDYRFVYKYA-SGIIFFNILCIKKM  238 (245)
Q Consensus       192 ~C~~~~~~~~~~~~C~~~~~~C~y~~~Ygdgs~-~G~l~~D~v~l~~~  238 (245)
                      .|+....    ...|..+ +.|.|.+.||||+. .|++++|+|+|++.
T Consensus       144 ~C~~~~~----~~~c~~~-~~c~y~i~Ygdgs~~~G~l~~Dtltlg~~  186 (431)
T PLN03146        144 QCQALGN----QASCSDE-NTCTYSYSYGDGSFTKGNLAVETLTIGST  186 (431)
T ss_pred             ccccCCC----CCCCCCC-CCCeeEEEeCCCCceeeEEEEEEEEeccC
Confidence            9986432    2347543 46999999999998 99999999999863

>KOG1339 consensus Aspartyl protease [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd06096 Plasmepsin_5 Plasmepsins are a class of aspartic proteinases produced by the plasmodium parasite Back     alignment and domain information
>PF14543 TAXi_N: Xylanase inhibitor N-terminal; PDB: 3HD8_A 3VLB_A 3VLA_A 3AUP_D 1T6G_A 1T6E_X 2B42_A Back     alignment and domain information
>cd05490 Cathepsin_D2 Cathepsin_D2, pepsin family of proteinases Back     alignment and domain information
>cd05470 pepsin_retropepsin_like Cellular and retroviral pepsin-like aspartate proteases Back     alignment and domain information
>PTZ00165 aspartyl protease; Provisional Back     alignment and domain information
>cd05478 pepsin_A Pepsin A, aspartic protease produced in gastric mucosa of mammals Back     alignment and domain information
>PTZ00147 plasmepsin-1; Provisional Back     alignment and domain information
>cd05477 gastricsin Gastricsins, asparate proteases produced in gastric mucosa Back     alignment and domain information
>cd05486 Cathespin_E Cathepsin E, non-lysosomal aspartic protease Back     alignment and domain information
>PTZ00013 plasmepsin 4 (PM4); Provisional Back     alignment and domain information
>cd06098 phytepsin Phytepsin, a plant homolog of mammalian lysosomal pepsins Back     alignment and domain information
>cd05487 renin_like Renin stimulates production of angiotensin and thus affects blood pressure Back     alignment and domain information
>cd05488 Proteinase_A_fungi Fungal Proteinase A , aspartic proteinase superfamily Back     alignment and domain information
>cd05473 beta_secretase_like Beta-secretase, aspartic-acid protease important in the pathogenesis of Alzheimer's disease Back     alignment and domain information
>cd06097 Aspergillopepsin_like Aspergillopepsin_like, aspartic proteases of fungal origin Back     alignment and domain information
>cd05485 Cathepsin_D_like Cathepsin_D_like, pepsin family of proteinases Back     alignment and domain information
>cd05475 nucellin_like Nucellins, plant aspartic proteases specifically expressed in nucellar cells during degradation Back     alignment and domain information
>cd05471 pepsin_like Pepsin-like aspartic proteases, bilobal enzymes that cleave bonds in peptides at acidic pH Back     alignment and domain information
>cd05472 cnd41_like Chloroplast Nucleoids DNA-binding Protease, catalyzes the degradation of ribulose-1,5-bisphosphate carboxylase/oxygenase Back     alignment and domain information
>PF00026 Asp: Eukaryotic aspartyl protease The Prosite entry also includes Pfam:PF00077 Back     alignment and domain information
>cd05489 xylanase_inhibitor_I_like TAXI-I inhibits degradation of xylan in the cell wall Back     alignment and domain information
>cd05476 pepsin_A_like_plant Chroloplast Nucleoids DNA-binding Protease and Nucellin, pepsin-like aspartic proteases from plants Back     alignment and domain information
>cd05474 SAP_like SAPs, pepsin-like proteinases secreted from pathogens to degrade host proteins Back     alignment and domain information
>cd05483 retropepsin_like_bacteria Bacterial aspartate proteases, retropepsin-like protease family Back     alignment and domain information
>cd05484 retropepsin_like_LTR_2 Retropepsins_like_LTR, pepsin-like aspartate proteases Back     alignment and domain information
>TIGR02281 clan_AA_DTGA clan AA aspartic protease, TIGR02281 family Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query245
2rmp_A 361 Rmp-Pepstatin A Complex Length = 361 7e-05
>pdb|2RMP|A Chain A, Rmp-Pepstatin A Complex Length = 361 Back     alignment and structure 
Iteration: 1

 Score = 43.9 bits (102), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 27/63 (42%), Positives = 35/63 (55%), Gaps = 4/63 (6%)
Query: 122 DRGLGQYFVSFRVGSPPQKFVLIADTGSDLTWMHCNHKGENCPKDGLTPPNRMFHADASS 181
           D  L +Y +   +G+P Q F+L+ DTGS  TW+   HKG  C K      +R F   ASS
Sbjct: 14  DFDLEEYAIPVSIGTPGQDFLLLFDTGSSDTWVP--HKG--CTKSEGCVGSRFFDPSASS 69
Query: 182 TFK 184
           TFK
Sbjct: 70  TFK 72

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query245
3aup_A 403 SBG7S, BG, basic 7S globulin; pepsin-like fold, pl 1e-16
1t6e_X 381 Xylanase inhibitor; two beta-barrel domain structu 1e-13
3vla_A 413 EDGP; extracellular, inhibitor, plant protein; HET 1e-12
2x0b_A 383 Renin; hydrolase-hormone complex, hydrolase hormon 5e-10
3lpj_A 455 Beta-secretase 1; alzheimer'S, aspartyl protease, 6e-09
1lya_A97 Cathepsin D; lysosomal aspartic protease; HET: NAG 9e-09
3qvc_A 451 Histo-aspartic protease; HAP, plasmepsin, zymogen, 1e-08
3k1w_A 341 Renin; protease, alternative splicing, aspartyl pr 3e-08
1miq_A 375 Plasmepsin; aspartic proteinase zymogen, domain op 5e-08
1qdm_A 478 Prophytepsin; aspartic proteinases, saposin-like d 7e-08
1mpp_A 361 Pepsin; hydrolase(acid proteinase); 2.00A {Rhizomu 9e-08
1j71_A 334 Candidapepsin, aspartic proteinase; candida tropic 1e-07
2qp8_A 395 Beta-secretase 1; BACE1, protease, alternative spl 2e-07
2bju_A 453 Plasmepsin II; aspartic proteinase, drug design, m 2e-07
3pvk_A 342 Candidapepsin-2; hydrolase; 1.27A {Candida albican 3e-07
2qzx_A 342 Candidapepsin-5; aspartic proteinase, aspartyl pro 4e-07
3fv3_A 339 SAPP1P-secreted aspartic protease 1; secreted aspa 4e-07
1b5f_A 239 Protein (cardosin A); hydrolase, aspartic proteina 6e-07
3cms_A 323 Chymosin B; hydrolase, acid proteinase; 2.00A {Bos 9e-07
1tzs_A 351 Cathepsin E; hydrolase, aspartic protease, activat 1e-06
1dpj_A 329 Proteinase A; proteinase A, hydrolase-hydrolase in 2e-06
3c9x_A 329 Trichoderma reesei aspartic protease; aspartic pro 2e-06
1htr_B 329 Gastricsin; aspartyl protease; 1.62A {Homo sapiens 2e-06
1am5_A 324 Pepsin, acid proteinase; aspartyl protease, hydrol 2e-06
3psg_A 370 Pepsinogen; hydrolase(acid proteinase zymogen); 1. 2e-06
2ewy_A 383 Beta-secretase 2; BACE2, aspartic protease, hydrol 3e-06
1oew_A 329 Endothiapepsin; hydrolase, aspartic proteinase mec 5e-06
2apr_A 325 Rhizopuspepsin; hydrolase (aspartic proteinase); 1 1e-05
1wkr_A 340 Polyporopepsin; hydrolase, hydrolase-hydrolase inh 1e-04
>3aup_A SBG7S, BG, basic 7S globulin; pepsin-like fold, plant protein; 1.91A {Glycine max} Length = 403 Back     alignment and structure
 Score = 77.5 bits (190), Expect = 1e-16
 Identities = 17/119 (14%), Positives = 37/119 (31%), Gaps = 14/119 (11%)

Query: 110 SNIVKIPLRSGADRGLGQYFVSFRVGSPPQKFVLIADTGSDLTWMHCNHKGENCPKDGLT 169
            N+V +P+++      G ++ + +  +P  +  ++ D   +  W++C     +      T
Sbjct: 7   INLVVLPVQNDG--STGLHWANLQKRTPLMQVPVLVDLNGNHLWVNCEQ-QYSSK----T 59

Query: 170 PPNRMFHADASSTFKTIPCSSRTCKVDLQDTFSLSMCPTPVTPCAYDYRFVYKYASGII 228
                 H+   S   T  C S           S   C               +   G +
Sbjct: 60  YQAPFCHSTQCSRANTHQCLSCPAA-------SRPGCHKNTCGLMSTNPITQQTGLGEL 111
>1t6e_X Xylanase inhibitor; two beta-barrel domain structure, hydrolase inhibitor; 1.70A {Triticum aestivum} SCOP: b.50.1.2 PDB: 1t6g_A 2b42_A 3hd8_A Length = 381 Back     alignment and structure
>3vla_A EDGP; extracellular, inhibitor, plant protein; HET: NAG; 0.95A {Daucus carota} PDB: 3vlb_A Length = 413 Back     alignment and structure
>2x0b_A Renin; hydrolase-hormone complex, hydrolase hormone complex, vasoconstrictor, glycoprotein, hypertension, serpins; 4.33A {Homo sapiens} Length = 383 Back     alignment and structure
>3lpj_A Beta-secretase 1; alzheimer'S, aspartyl protease, hydrolase; HET: TLA Z75; 1.79A {Homo sapiens} PDB: 3lpi_A* 3lpk_A* 3ohf_A* 3ohh_A* 3r2f_A* 3skf_A* 3skg_A* 2hiz_A* 2p83_A* 2va7_A* 2va5_A* 2va6_A* Length = 455 Back     alignment and structure
>1lya_A Cathepsin D; lysosomal aspartic protease; HET: NAG BMA MAN; 2.50A {Homo sapiens} SCOP: b.50.1.2 PDB: 1lyb_A* 1lyw_A* Length = 97 Back     alignment and structure
>3qvc_A Histo-aspartic protease; HAP, plasmepsin, zymogen, hydrolase; 2.10A {Plasmodium falciparum} PDB: 3qvi_A* 3fns_A 3fnt_A* 3fnu_A* Length = 451 Back     alignment and structure
>3k1w_A Renin; protease, alternative splicing, aspartyl protease, cleavage on PAIR of basic residues, disease mutation, disulfide bond, glycoprotein; HET: BFX NDG HSQ; 1.50A {Homo sapiens} PDB: 3d91_A* 3g70_A* 3g6z_A* 3own_A* 2iko_A* 1bbs_A* 1rne_A* 2bkt_A* 2bks_A* 2iku_A* 2il2_A* 2ren_A* 2v0z_C* 2v10_C* 2v11_C* 2v12_C* 2v13_A* 2v16_C* 3g72_A* 3oot_A* ... Length = 341 Back     alignment and structure
>1miq_A Plasmepsin; aspartic proteinase zymogen, domain opening, hydrolase; 2.50A {Plasmodium vivax} SCOP: b.50.1.2 PDB: 1ls5_A* Length = 375 Back     alignment and structure
>1qdm_A Prophytepsin; aspartic proteinases, saposin-like domain, zymogen structure, hydrolase; 2.30A {Hordeum vulgare} SCOP: a.64.1.2 b.50.1.2 Length = 478 Back     alignment and structure
>1mpp_A Pepsin; hydrolase(acid proteinase); 2.00A {Rhizomucor pusillus} SCOP: b.50.1.2 PDB: 2asi_A* 2rmp_A* Length = 361 Back     alignment and structure
>1j71_A Candidapepsin, aspartic proteinase; candida tropicalis aspartic protease, SAPT1, hydrolase; 1.80A {Candida tropicalis} SCOP: b.50.1.2 Length = 334 Back     alignment and structure
>2qp8_A Beta-secretase 1; BACE1, protease, alternative splicing, aspartyl protease, glycoprotein, hydrolase, membrane, transmembrane, zymogen; HET: TAR SC7; 1.50A {Homo sapiens} SCOP: b.50.1.2 PDB: 2qk5_A* 2qmf_A* 2qmg_A* 2qmd_A* 4djx_A* 3l59_A* 3l5b_A* 3l5c_A* 3l58_A* 3l5d_A* 3l5f_A* 4dju_A* 4djv_A* 4djw_A* 3l5e_A* 4djy_A* 2zhv_A 2zhs_A 2zhr_A 2zhu_A ... Length = 395 Back     alignment and structure
>2bju_A Plasmepsin II; aspartic proteinase, drug design, malaria, aspartyl protease, glycoprotein, hydrolase, signal, zymogen; HET: IH4; 1.56A {Plasmodium falciparum} SCOP: b.50.1.2 PDB: 1pfz_A 1xdh_A* 1lf3_A 1w6h_A* 1w6i_A* 1lf4_A* 1lf2_A* 1lee_A* 1m43_A* 2igx_A* 1sme_A* 1me6_A* 1xe6_A* 1xe5_A* 2igy_A* 2r9b_A 3f9q_A 3qrv_A 3qs1_A* 2anl_A* ... Length = 453 Back     alignment and structure
>3pvk_A Candidapepsin-2; hydrolase; 1.27A {Candida albicans} PDB: 1eag_A 3q70_A* 1zap_A* 2qzw_A 2h6t_A* 2h6s_A* Length = 342 Back     alignment and structure
>2qzx_A Candidapepsin-5; aspartic proteinase, aspartyl protease, CL PAIR of basic residues, glycoprotein, protease, secreted; HET: STA; 2.50A {Candida albicans} Length = 342 Back     alignment and structure
>3fv3_A SAPP1P-secreted aspartic protease 1; secreted aspartic protease, virulence factor, H; HET: STA; 1.85A {Candida parapsilosis} PDB: 3tne_A* Length = 339 Back     alignment and structure
>1b5f_A Protein (cardosin A); hydrolase, aspartic proteinase; HET: NAG FUC BMA MAN; 1.72A {Cynara cardunculus} SCOP: b.50.1.2 Length = 239 Back     alignment and structure
>3cms_A Chymosin B; hydrolase, acid proteinase; 2.00A {Bos taurus} SCOP: b.50.1.2 PDB: 4cms_A 1czi_E* 1cms_A Length = 323 Back     alignment and structure
>1tzs_A Cathepsin E; hydrolase, aspartic protease, activation intermediate; 2.35A {Homo sapiens} Length = 351 Back     alignment and structure
>1dpj_A Proteinase A; proteinase A, hydrolase-hydrolase inhibitor COM; HET: BMA MAN NAG; 1.80A {Saccharomyces cerevisiae} SCOP: b.50.1.2 PDB: 1dp5_A* 1fmu_A* 1fmx_A* 1fq5_A* 1fq4_A* 1fq6_A* 1fq7_A* 1fq8_A* 2jxr_A* 1g0v_A* Length = 329 Back     alignment and structure
>3c9x_A Trichoderma reesei aspartic protease; aspartic proteinase, aspartyl protease, hydrolase; 1.70A {Trichoderma reesei} PDB: 3c9y_A* 3emy_A* Length = 329 Back     alignment and structure
>1htr_B Gastricsin; aspartyl protease; 1.62A {Homo sapiens} SCOP: b.50.1.2 PDB: 1avf_A Length = 329 Back     alignment and structure
>1am5_A Pepsin, acid proteinase; aspartyl protease, hydrolase; 2.16A {Gadus morhua} SCOP: b.50.1.2 Length = 324 Back     alignment and structure
>3psg_A Pepsinogen; hydrolase(acid proteinase zymogen); 1.65A {Sus scrofa} SCOP: b.50.1.2 PDB: 2psg_A 4pep_A* 3pep_A* 1f34_A* 1psa_A* 1yx9_A 5pep_A 1flh_A 1qrp_E* 1psn_A* 1pso_E* 3utl_A Length = 370 Back     alignment and structure
>2ewy_A Beta-secretase 2; BACE2, aspartic protease, hydrolase; HET: DBO; 3.10A {Homo sapiens} Length = 383 Back     alignment and structure
>1oew_A Endothiapepsin; hydrolase, aspartic proteinase mechanism, atomic resolution, succinimide, anisotropic refinement; HET: SUI; 0.9A {Cryphonectria parasitica} SCOP: b.50.1.2 PDB: 1gkt_A* 1gvt_A* 1gvv_A* 1gvw_A* 1gvx_A* 1gvu_A* 1oex_A* 2jji_A* 2jjj_A* 2vs2_A* 3uri_A* 3urj_A* 3url_A* 3pww_A* 1e80_E* 1e81_E* 1e82_E* 1e5o_E* 1eed_P* 1epl_E* ... Length = 329 Back     alignment and structure
>2apr_A Rhizopuspepsin; hydrolase (aspartic proteinase); 1.80A {Rhizopus microsporus var} SCOP: b.50.1.2 PDB: 3apr_E* 4apr_E* 5apr_E* 6apr_E* 1uh9_A 1uh8_A 1uh7_A Length = 325 Back     alignment and structure
>1wkr_A Polyporopepsin; hydrolase, hydrolase-hydrolase inhibitor complex; HET: STA; 1.30A {Irpex lacteus} SCOP: b.50.1.2 Length = 340 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query245
1lya_A97 Cathepsin D; lysosomal aspartic protease; HET: NAG 99.9
3vla_A 413 EDGP; extracellular, inhibitor, plant protein; HET 99.81
2bju_A 453 Plasmepsin II; aspartic proteinase, drug design, m 99.81
3psg_A 370 Pepsinogen; hydrolase(acid proteinase zymogen); 1. 99.79
1b5f_A 239 Protein (cardosin A); hydrolase, aspartic proteina 99.79
1mpp_A 361 Pepsin; hydrolase(acid proteinase); 2.00A {Rhizomu 99.78
3cms_A 323 Chymosin B; hydrolase, acid proteinase; 2.00A {Bos 99.78
2x0b_A 383 Renin; hydrolase-hormone complex, hydrolase hormon 99.78
1am5_A 324 Pepsin, acid proteinase; aspartyl protease, hydrol 99.78
4aa9_A 320 Chymosin; hydrolase, aspartic peptidase, rennet; H 99.77
1tzs_A 351 Cathepsin E; hydrolase, aspartic protease, activat 99.77
3k1w_A 341 Renin; protease, alternative splicing, aspartyl pr 99.77
1dpj_A 329 Proteinase A; proteinase A, hydrolase-hydrolase in 99.77
2apr_A 325 Rhizopuspepsin; hydrolase (aspartic proteinase); 1 99.77
3c9x_A 329 Trichoderma reesei aspartic protease; aspartic pro 99.76
1htr_B 329 Gastricsin; aspartyl protease; 1.62A {Homo sapiens 99.76
3fv3_A 339 SAPP1P-secreted aspartic protease 1; secreted aspa 99.76
1oew_A 329 Endothiapepsin; hydrolase, aspartic proteinase mec 99.76
1miq_A 375 Plasmepsin; aspartic proteinase zymogen, domain op 99.76
3aup_A 403 SBG7S, BG, basic 7S globulin; pepsin-like fold, pl 99.75
1j71_A 334 Candidapepsin, aspartic proteinase; candida tropic 99.75
2qzx_A 342 Candidapepsin-5; aspartic proteinase, aspartyl pro 99.74
3qvc_A 451 Histo-aspartic protease; HAP, plasmepsin, zymogen, 99.73
3pvk_A 342 Candidapepsin-2; hydrolase; 1.27A {Candida albican 99.73
2ewy_A 383 Beta-secretase 2; BACE2, aspartic protease, hydrol 99.73
1qdm_A 478 Prophytepsin; aspartic proteinases, saposin-like d 99.72
2qp8_A 395 Beta-secretase 1; BACE1, protease, alternative spl 99.71
3vf3_A 402 Beta-secretase 1; structure-based drug design, hyd 99.7
3lpj_A 455 Beta-secretase 1; alzheimer'S, aspartyl protease, 99.69
1wkr_A 340 Polyporopepsin; hydrolase, hydrolase-hydrolase inh 99.65
1yg9_A 330 Aspartic protease BLA G 2; allegren, hydrolase, al 99.64
1ibq_A 325 Aspergillopepsin; aspartic proteinase, hydrolase; 99.6
1izd_A 323 Aspartic proteinase; sugar binding, acid protease, 99.6
1bxo_A 323 Protein (penicillopepsin); hydrolase, phosphonate 99.58
1t6e_X 381 Xylanase inhibitor; two beta-barrel domain structu 99.57
>1lya_A Cathepsin D; lysosomal aspartic protease; HET: NAG BMA MAN; 2.50A {Homo sapiens} SCOP: b.50.1.2 PDB: 1lyb_A* 1lyw_A* Back     alignment and structure
Probab=99.90  E-value=9.7e-24  Score=159.90  Aligned_cols=90  Identities=24%  Similarity=0.353  Sum_probs=77.9

Q ss_pred             eeeeeeCCCCCceeEEEEEEeCCCCceEEEEEeCCCCceeeecC-CCC--CCCCCCCCCCCCCCCCCCCCCcceeccCCC
Q 038182          114 KIPLRSGADRGLGQYFVSFRVGSPPQKFVLIADTGSDLTWMHCN-HKG--ENCPKDGLTPPNRMFHADASSTFKTIPCSS  190 (245)
Q Consensus       114 ~~Pl~~g~~~~~~~Y~v~i~iGTPpq~~~vilDTGSdl~Wv~C~-C~~--~~C~~~~~~~~~~~fdps~SsT~~~v~C~s  190 (245)
                      .+||.+.   .+.+|+++|.||||||++.|+|||||+++||+|. |..  ..|..+      +.|||++|+||+..    
T Consensus         4 ~~~l~n~---~~~~Y~~~i~iGTP~Q~~~v~~DTGSs~lWv~~~~C~~~~~~C~~~------~~y~p~~SsT~~~~----   70 (97)
T 1lya_A            4 PEVLKNY---MDAQYYGEIGIGTPPQCFTVVFDTGSSNLWVPSIHCKLLDIACWIH------HKYNSDKSSTYVKN----   70 (97)
T ss_dssp             EEEEEEE---TTTEEEEEEEETTTTEEEEEEEETTCCCEEEEBTTCCTTCHHHHTS------CCBCGGGCTTCEEE----
T ss_pred             eEeeEEC---CCCeEEEEEEECCCCeEEEEEEeCCCCceEEeEcCccCcccccCCC------CCCCchhCCCceeC----
Confidence            4788753   3489999999999999999999999999999999 862  247653      58999999999875    


Q ss_pred             cccccccccccCCCCCCCCCCCCcEEEEecCCceEEEEEEEEEEECc
Q 038182          191 RTCKVDLQDTFSLSMCPTPVTPCAYDYRFVYKYASGIIFFNILCIKK  237 (245)
Q Consensus       191 ~~C~~~~~~~~~~~~C~~~~~~C~y~~~Ygdgs~~G~l~~D~v~l~~  237 (245)
                                           .|.|.+.||||+..|.+++|+|.|++
T Consensus        71 ---------------------~~~~~i~Yg~Gs~~G~~~~Dtv~i~g   96 (97)
T 1lya_A           71 ---------------------GTSFDIHYGSGSLSGYLSQDTVSVPC   96 (97)
T ss_dssp             ---------------------EEEEEEECSSCEEEEEEEEEEEEESC
T ss_pred             ---------------------CCcEEEEECCcEEEEEEEEEEEEECC
Confidence                                 28999999999999999999999975
>3vla_A EDGP; extracellular, inhibitor, plant protein; HET: NAG; 0.95A {Daucus carota} PDB: 3vlb_A Back     alignment and structure
>2bju_A Plasmepsin II; aspartic proteinase, drug design, malaria, aspartyl protease, glycoprotein, hydrolase, signal, zymogen; HET: IH4; 1.56A {Plasmodium falciparum} SCOP: b.50.1.2 PDB: 1pfz_A 1xdh_A* 1lf3_A 1w6h_A* 1w6i_A* 1lf4_A* 1lf2_A* 1lee_A* 1m43_A* 2igx_A* 1sme_A* 1me6_A* 1xe6_A* 1xe5_A* 2igy_A* 2r9b_A 3f9q_A 3qrv_A 3qs1_A* 2anl_A* ... Back     alignment and structure
>3psg_A Pepsinogen; hydrolase(acid proteinase zymogen); 1.65A {Sus scrofa} SCOP: b.50.1.2 PDB: 2psg_A 4pep_A* 3pep_A* 1f34_A* 1psa_A* 1yx9_A 5pep_A 1flh_A 1qrp_E* 1psn_A* 1pso_E* 3utl_A Back     alignment and structure
>1b5f_A Protein (cardosin A); hydrolase, aspartic proteinase; HET: NAG FUC BMA MAN; 1.72A {Cynara cardunculus} SCOP: b.50.1.2 Back     alignment and structure
>1mpp_A Pepsin; hydrolase(acid proteinase); 2.00A {Rhizomucor pusillus} SCOP: b.50.1.2 PDB: 2asi_A* 2rmp_A* Back     alignment and structure
>3cms_A Chymosin B; hydrolase, acid proteinase; 2.00A {Bos taurus} SCOP: b.50.1.2 PDB: 4cms_A 1czi_E* 1cms_A Back     alignment and structure
>2x0b_A Renin; hydrolase-hormone complex, hydrolase hormone complex, vasoconstrictor, glycoprotein, hypertension, serpins; 4.33A {Homo sapiens} Back     alignment and structure
>1am5_A Pepsin, acid proteinase; aspartyl protease, hydrolase; 2.16A {Gadus morhua} SCOP: b.50.1.2 Back     alignment and structure
>4aa9_A Chymosin; hydrolase, aspartic peptidase, rennet; HET: NAG; 1.60A {Camelus dromedarius} PDB: 4aa8_A 1czi_E* 1cms_A 4cms_A 3cms_A Back     alignment and structure
>1tzs_A Cathepsin E; hydrolase, aspartic protease, activation intermediate; 2.35A {Homo sapiens} Back     alignment and structure
>3k1w_A Renin; protease, alternative splicing, aspartyl protease, cleavage on PAIR of basic residues, disease mutation, disulfide bond, glycoprotein; HET: BFX NDG HSQ; 1.50A {Homo sapiens} SCOP: b.50.1.2 PDB: 3d91_A* 3g70_A* 3g6z_A* 3own_A* 2iko_A* 1bbs_A* 1rne_A* 2bkt_A* 2bks_A* 2iku_A* 2il2_A* 2ren_A* 2v0z_C* 2v10_C* 2v11_C* 2v12_C* 2v13_A* 2v16_C* 3g72_A* 3oot_A* ... Back     alignment and structure
>1dpj_A Proteinase A; proteinase A, hydrolase-hydrolase inhibitor COM; HET: BMA MAN NAG; 1.80A {Saccharomyces cerevisiae} SCOP: b.50.1.2 PDB: 1dp5_A* 1fmu_A* 1fmx_A* 1fq5_A* 1fq4_A* 1fq6_A* 1fq7_A* 1fq8_A* 2jxr_A* 1g0v_A* Back     alignment and structure
>2apr_A Rhizopuspepsin; hydrolase (aspartic proteinase); 1.80A {Rhizopus microsporus var} SCOP: b.50.1.2 PDB: 3apr_E* 4apr_E* 5apr_E* 6apr_E* 1uh9_A 1uh8_A 1uh7_A Back     alignment and structure
>3c9x_A Trichoderma reesei aspartic protease; aspartic proteinase, aspartyl protease, hydrolase; 1.70A {Trichoderma reesei} PDB: 3c9y_A* 3emy_A* Back     alignment and structure
>1htr_B Gastricsin; aspartyl protease; 1.62A {Homo sapiens} SCOP: b.50.1.2 PDB: 1avf_A Back     alignment and structure
>3fv3_A SAPP1P-secreted aspartic protease 1; secreted aspartic protease, virulence factor, H; HET: STA; 1.85A {Candida parapsilosis} SCOP: b.50.1.0 PDB: 3tne_A* Back     alignment and structure
>1oew_A Endothiapepsin; hydrolase, aspartic proteinase mechanism, atomic resolution, succinimide, anisotropic refinement; HET: SUI; 0.9A {Cryphonectria parasitica} SCOP: b.50.1.2 PDB: 1gkt_A* 1gvt_A* 1gvv_A* 1gvw_A* 1gvx_A* 1gvu_A* 1oex_A* 2jji_A* 2jjj_A* 2vs2_A* 3uri_A* 3urj_A* 3url_A* 3pww_A* 1e80_E* 1e81_E* 1e82_E* 1e5o_E* 1eed_P* 1epl_E* ... Back     alignment and structure
>1miq_A Plasmepsin; aspartic proteinase zymogen, domain opening, hydrolase; 2.50A {Plasmodium vivax} SCOP: b.50.1.2 PDB: 1ls5_A* Back     alignment and structure
>3aup_A SBG7S, BG, basic 7S globulin; pepsin-like fold, plant protein; 1.91A {Glycine max} Back     alignment and structure
>1j71_A Candidapepsin, aspartic proteinase; candida tropicalis aspartic protease, SAPT1, hydrolase; 1.80A {Candida tropicalis} SCOP: b.50.1.2 Back     alignment and structure
>2qzx_A Candidapepsin-5; aspartic proteinase, aspartyl protease, CL PAIR of basic residues, glycoprotein, protease, secreted; HET: STA; 2.50A {Candida albicans} Back     alignment and structure
>3qvc_A Histo-aspartic protease; HAP, plasmepsin, zymogen, hydrolase; 2.10A {Plasmodium falciparum} PDB: 3qvi_A* 3fns_A 3fnt_A* 3fnu_A* Back     alignment and structure
>3pvk_A Candidapepsin-2; hydrolase; 1.27A {Candida albicans} SCOP: b.50.1.2 PDB: 1eag_A 3q70_A* 1zap_A* 2qzw_A 2h6t_A* 2h6s_A* Back     alignment and structure
>2ewy_A Beta-secretase 2; BACE2, aspartic protease, hydrolase; HET: DBO; 3.10A {Homo sapiens} Back     alignment and structure
>1qdm_A Prophytepsin; aspartic proteinases, saposin-like domain, zymogen structure, hydrolase; 2.30A {Hordeum vulgare} SCOP: a.64.1.2 b.50.1.2 Back     alignment and structure
>2qp8_A Beta-secretase 1; BACE1, protease, alternative splicing, aspartyl protease, glycoprotein, hydrolase, membrane, transmembrane, zymogen; HET: TAR SC7; 1.50A {Homo sapiens} SCOP: b.50.1.2 PDB: 2qk5_A* 2qmf_A* 2qmg_A* 2qmd_A* 4djx_A* 3l59_A* 3l5b_A* 3l5c_A* 3l58_A* 3l5d_A* 3l5f_A* 4dju_A* 4djv_A* 4djw_A* 3l5e_A* 4djy_A* 2zhv_A 2zhs_A 2zhr_A 2zhu_A ... Back     alignment and structure
>3vf3_A Beta-secretase 1; structure-based drug design, hydrolase-hydrolase inhibitor C; HET: 0GS; 1.48A {Homo sapiens} PDB: 2f3e_A* 2f3f_A* 1ym2_A* 3dv1_A* 3dv5_A* 3k5c_A* 3k5f_A* 3k5g_A* 3pi5_A* 3qbh_A* 3duy_A* 3veu_A* 3vg1_A* 4d83_A* 4d88_A* 4d89_A* 4d8c_A* 3msk_A* 3k5d_A* 1ym4_A* ... Back     alignment and structure
>3lpj_A Beta-secretase 1; alzheimer'S, aspartyl protease, hydrolase; HET: TLA Z75; 1.79A {Homo sapiens} PDB: 3lpi_A* 3lpk_A* 3ohf_A* 3ohh_A* 3r2f_A* 3skf_A* 3skg_A* 4fse_A* 2hiz_A* 2p83_A* 2va7_A* 2va5_A* 2va6_A* Back     alignment and structure
>1wkr_A Polyporopepsin; hydrolase, hydrolase-hydrolase inhibitor complex; HET: STA; 1.30A {Irpex lacteus} SCOP: b.50.1.2 Back     alignment and structure
>1yg9_A Aspartic protease BLA G 2; allegren, hydrolase, allergen; HET: NAG; 1.30A {Blattella germanica} PDB: 2nr6_A* 3liz_A* Back     alignment and structure
>1ibq_A Aspergillopepsin; aspartic proteinase, hydrolase; HET: MAN; 2.14A {Aspergillus phoenicis} SCOP: b.50.1.2 Back     alignment and structure
>1izd_A Aspartic proteinase; sugar binding, acid protease, hydrolase; HET: MAN; 1.90A {Aspergillus oryzae} SCOP: b.50.1.2 PDB: 1ize_A* Back     alignment and structure
>1bxo_A Protein (penicillopepsin); hydrolase, phosphonate inhibitors, macrocycle; HET: MAN PP7; 0.95A {Penicillium janthinellum} SCOP: b.50.1.2 PDB: 1apu_E* 1apv_E* 1apw_E* 1apt_E* 1bxq_A* 1ppk_E* 1ppl_E* 1ppm_E* 2wea_A* 2web_A* 2wec_A* 2wed_A* 3app_A Back     alignment and structure
>1t6e_X Xylanase inhibitor; two beta-barrel domain structure, hydrolase inhibitor; 1.70A {Triticum aestivum} SCOP: b.50.1.2 PDB: 1t6g_A 2b42_A 3hd8_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 245
d1qdma2 337 b.50.1.2 (A:2-247,A:248-338) Plant acid proteinase 2e-13
d1mppa_ 357 b.50.1.2 (A:) Pepsin {Mucor pusillus [TaxId: 4840] 7e-13
d1dpja_ 329 b.50.1.2 (A:) Acid protease {Baker's yeast (Saccha 7e-13
g1b5f.1 326 b.50.1.2 (A:,B:) Plant acid proteinase, phytepsin 1e-12
d2bjua1 329 b.50.1.2 (A:1-329) Plasmepsin (a hemoglobin-degrad 2e-12
d3cmsa_ 323 b.50.1.2 (A:) Chymosin (synonym: renin) {Cow (Bos 3e-12
d1am5a_ 324 b.50.1.2 (A:) Pepsin(ogen) {Atlantic cod (Gadus mo 6e-12
d1miqa_ 373 b.50.1.2 (A:) Plasmepsin (a hemoglobin-degrading e 7e-12
g1lya.1 338 b.50.1.2 (A:,B:) Cathepsin D {Human (Homo sapiens) 8e-12
d2qp8a1 387 b.50.1.2 (A:60-446) beta-secretase (memapsin) {Hum 1e-11
d1hrna_ 337 b.50.1.2 (A:) Chymosin (synonym: renin) {Human (Ho 1e-11
g1htr.1 372 b.50.1.2 (P:,B:) Pepsin(ogen) {Human (Homo sapiens 3e-11
d1j71a_ 334 b.50.1.2 (A:) Acid protease {Yeast (Candida tropic 4e-11
d1eaga_ 342 b.50.1.2 (A:) Acid protease {Yeast (Candida albica 4e-11
d2apra_ 325 b.50.1.2 (A:) Acid protease {Bread mold (Rhizopus 1e-10
d1smra_ 335 b.50.1.2 (A:) Chymosin (synonym: renin) {Mouse (Mu 2e-10
d1oewa_ 330 b.50.1.2 (A:) Endothiapepsin {Chestnut blight fung 4e-10
d1t6ex_ 381 b.50.1.2 (X:) Xylanase inhibitor TAXI-I {Wheat (Tr 6e-09
d1wkra_ 340 b.50.1.2 (A:) Acid protease {Irpex lacteus (Polypo 1e-08
d3psga_ 370 b.50.1.2 (A:) Pepsin(ogen) {Pig (Sus scrofa) [TaxI 2e-07
d1bxoa_ 323 b.50.1.2 (A:) Acid protease {Fungus (Penicillium j 4e-06
d1izea_ 323 b.50.1.2 (A:) Acid protease {Fungus (Aspergillus o 4e-06
>d1qdma2 b.50.1.2 (A:2-247,A:248-338) Plant acid proteinase, phytepsin {Barley (Hordeum vulgare) [TaxId: 4513]} Length = 337 Back     information, alignment and structure

class: All beta proteins
fold: Acid proteases
superfamily: Acid proteases
family: Pepsin-like
domain: Plant acid proteinase, phytepsin
species: Barley (Hordeum vulgare) [TaxId: 4513]

 Score = 66.6 bits (161), Expect = 2e-13
 Identities = 24/79 (30%), Positives = 35/79 (44%), Gaps = 7/79 (8%)

Query: 115 IPLRSGADRGLGQYFVSFRVGSPPQKFVLIADTGSDLTWMHCNHKGENCPKDGLTPPNRM 174
           + L++  +    QYF    VG+PPQKF +I DTGS   W+        C        +  
Sbjct: 7   VALKNYMN---AQYFGEIGVGTPPQKFTVIFDTGSSNLWVPS----AKCYFSIACYLHSR 59

Query: 175 FHADASSTFKTIPCSSRTC 193
           + A ASST+K     +   
Sbjct: 60  YKAGASSTYKKNGKPAAIQ 78
>d1mppa_ b.50.1.2 (A:) Pepsin {Mucor pusillus [TaxId: 4840]} Length = 357 Back     information, alignment and structure
>d1dpja_ b.50.1.2 (A:) Acid protease {Baker's yeast (Saccharomyces cerevisiae), proteinase A [TaxId: 4932]} Length = 329 Back     information, alignment and structure
>d2bjua1 b.50.1.2 (A:1-329) Plasmepsin (a hemoglobin-degrading enzyme) {Plasmodium falciparum, plasmepsin II [TaxId: 5833]} Length = 329 Back     information, alignment and structure
>d3cmsa_ b.50.1.2 (A:) Chymosin (synonym: renin) {Cow (Bos taurus) [TaxId: 9913]} Length = 323 Back     information, alignment and structure
>d1am5a_ b.50.1.2 (A:) Pepsin(ogen) {Atlantic cod (Gadus morhua) [TaxId: 8049]} Length = 324 Back     information, alignment and structure
>d1miqa_ b.50.1.2 (A:) Plasmepsin (a hemoglobin-degrading enzyme) {Plasmodium vivax [TaxId: 5855]} Length = 373 Back     information, alignment and structure
>d2qp8a1 b.50.1.2 (A:60-446) beta-secretase (memapsin) {Human (Homo sapiens) [TaxId: 9606]} Length = 387 Back     information, alignment and structure
>d1hrna_ b.50.1.2 (A:) Chymosin (synonym: renin) {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1j71a_ b.50.1.2 (A:) Acid protease {Yeast (Candida tropicalis) [TaxId: 5482]} Length = 334 Back     information, alignment and structure
>d1eaga_ b.50.1.2 (A:) Acid protease {Yeast (Candida albicans) [TaxId: 5476]} Length = 342 Back     information, alignment and structure
>d2apra_ b.50.1.2 (A:) Acid protease {Bread mold (Rhizopus chinensis) [TaxId: 4843]} Length = 325 Back     information, alignment and structure
>d1smra_ b.50.1.2 (A:) Chymosin (synonym: renin) {Mouse (Mus musculus) [TaxId: 10090]} Length = 335 Back     information, alignment and structure
>d1t6ex_ b.50.1.2 (X:) Xylanase inhibitor TAXI-I {Wheat (Triticum aestivum) [TaxId: 4565]} Length = 381 Back     information, alignment and structure
>d1wkra_ b.50.1.2 (A:) Acid protease {Irpex lacteus (Polyporus tulipiferae), Polyporopepsin [TaxId: 5319]} Length = 340 Back     information, alignment and structure
>d3psga_ b.50.1.2 (A:) Pepsin(ogen) {Pig (Sus scrofa) [TaxId: 9823]} Length = 370 Back     information, alignment and structure
>d1bxoa_ b.50.1.2 (A:) Acid protease {Fungus (Penicillium janthinellum), penicillopepsin [TaxId: 5079]} Length = 323 Back     information, alignment and structure
>d1izea_ b.50.1.2 (A:) Acid protease {Fungus (Aspergillus oryzae) [TaxId: 5062]} Length = 323 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query245
d3psga_ 370 Pepsin(ogen) {Pig (Sus scrofa) [TaxId: 9823]} 99.83
d1qdma2 337 Plant acid proteinase, phytepsin {Barley (Hordeum 99.78
g1htr.1 372 Pepsin(ogen) {Human (Homo sapiens), progastricsin 99.77
d1dpja_ 329 Acid protease {Baker's yeast (Saccharomyces cerevi 99.77
d3cmsa_ 323 Chymosin (synonym: renin) {Cow (Bos taurus) [TaxId 99.77
d2apra_ 325 Acid protease {Bread mold (Rhizopus chinensis) [Ta 99.76
d1miqa_ 373 Plasmepsin (a hemoglobin-degrading enzyme) {Plasmo 99.76
d1smra_ 335 Chymosin (synonym: renin) {Mouse (Mus musculus) [T 99.76
d1am5a_ 324 Pepsin(ogen) {Atlantic cod (Gadus morhua) [TaxId: 99.75
d2bjua1 329 Plasmepsin (a hemoglobin-degrading enzyme) {Plasmo 99.75
g1lya.1 338 Cathepsin D {Human (Homo sapiens) [TaxId: 9606]} 99.75
d1oewa_ 330 Endothiapepsin {Chestnut blight fungus (Endothia p 99.73
d1eaga_ 342 Acid protease {Yeast (Candida albicans) [TaxId: 54 99.71
d1hrna_ 337 Chymosin (synonym: renin) {Human (Homo sapiens) [T 99.7
d1j71a_ 334 Acid protease {Yeast (Candida tropicalis) [TaxId: 99.7
d1mppa_ 357 Pepsin {Mucor pusillus [TaxId: 4840]} 99.69
g1b5f.1 326 Plant acid proteinase, phytepsin {Cynara carduncul 99.69
d2qp8a1 387 beta-secretase (memapsin) {Human (Homo sapiens) [T 99.65
d1bxoa_ 323 Acid protease {Fungus (Penicillium janthinellum), 99.58
d1wkra_ 340 Acid protease {Irpex lacteus (Polyporus tulipifera 99.58
d1t6ex_ 381 Xylanase inhibitor TAXI-I {Wheat (Triticum aestivu 99.54
d1izea_ 323 Acid protease {Fungus (Aspergillus oryzae) [TaxId: 99.54
>d3psga_ b.50.1.2 (A:) Pepsin(ogen) {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
class: All beta proteins
fold: Acid proteases
superfamily: Acid proteases
family: Pepsin-like
domain: Pepsin(ogen)
species: Pig (Sus scrofa) [TaxId: 9823]

Probab=99.83  E-value=5.5e-21  Score=172.34  Aligned_cols=94  Identities=24%  Similarity=0.387  Sum_probs=79.9

Q ss_pred             eeeeeeeeCCCCCceeEEEEEEeCCCCceEEEEEeCCCCceeeecC-CCCCCCCCCCCCCCCCCCCCCCCCcceeccCCC
Q 038182          112 IVKIPLRSGADRGLGQYFVSFRVGSPPQKFVLIADTGSDLTWMHCN-HKGENCPKDGLTPPNRMFHADASSTFKTIPCSS  190 (245)
Q Consensus       112 ~~~~Pl~~g~~~~~~~Y~v~i~iGTPpq~~~vilDTGSdl~Wv~C~-C~~~~C~~~~~~~~~~~fdps~SsT~~~v~C~s  190 (245)
                      ....||.+..   +.+|+++|.||||||++.|++||||+++||+|. |..  |..+.    ++.|||++|+||+..    
T Consensus        45 ~~~~~l~n~~---d~~Y~~~i~iGtP~Q~~~vi~DTGSs~~Wv~~~~C~~--~~~~~----~~~yd~~~Sst~~~~----  111 (370)
T d3psga_          45 IGDEPLENYL---DTEYFGTIGIGTPAQDFTVIFDTGSSNLWVPSVYCSS--LACSD----HNQFNPDDSSTFEAT----  111 (370)
T ss_dssp             SCCCTTGGGT---TCCEEEEEEETTTTEEEEEEEETTCCCEEEEBTTCCS--GGGTT----SCCBCGGGCTTCEEE----
T ss_pred             cccccccccc---CCEEEEEEEEcCCCeEEEEEEeCCCCCeEEECccCCC--ccccc----ccccCCCcccccccC----
Confidence            3456887653   479999999999999999999999999999999 976  65443    368999999998764    


Q ss_pred             cccccccccccCCCCCCCCCCCCcEEEEecCCceEEEEEEEEEEECccc
Q 038182          191 RTCKVDLQDTFSLSMCPTPVTPCAYDYRFVYKYASGIIFFNILCIKKMI  239 (245)
Q Consensus       191 ~~C~~~~~~~~~~~~C~~~~~~C~y~~~Ygdgs~~G~l~~D~v~l~~~~  239 (245)
                                           .|.|.+.||+|+..|+++.|++.++...
T Consensus       112 ---------------------~~~~~~~Yg~Gs~~G~~~~d~~~~~~~~  139 (370)
T d3psga_         112 ---------------------SQELSITYGTGSMTGILGYDTVQVGGIS  139 (370)
T ss_dssp             ---------------------EEEEEEESSSCEEEEEEEEEEEEETTEE
T ss_pred             ---------------------CCcEEEEeCCceEEEEEEEEEEeeecee
Confidence                                 3889999999988999999999997643
>d1qdma2 b.50.1.2 (A:2-247,A:248-338) Plant acid proteinase, phytepsin {Barley (Hordeum vulgare) [TaxId: 4513]} Back     information, alignment and structure
>d1dpja_ b.50.1.2 (A:) Acid protease {Baker's yeast (Saccharomyces cerevisiae), proteinase A [TaxId: 4932]} Back     information, alignment and structure
>d3cmsa_ b.50.1.2 (A:) Chymosin (synonym: renin) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2apra_ b.50.1.2 (A:) Acid protease {Bread mold (Rhizopus chinensis) [TaxId: 4843]} Back     information, alignment and structure
>d1miqa_ b.50.1.2 (A:) Plasmepsin (a hemoglobin-degrading enzyme) {Plasmodium vivax [TaxId: 5855]} Back     information, alignment and structure
>d1smra_ b.50.1.2 (A:) Chymosin (synonym: renin) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1am5a_ b.50.1.2 (A:) Pepsin(ogen) {Atlantic cod (Gadus morhua) [TaxId: 8049]} Back     information, alignment and structure
>d2bjua1 b.50.1.2 (A:1-329) Plasmepsin (a hemoglobin-degrading enzyme) {Plasmodium falciparum, plasmepsin II [TaxId: 5833]} Back     information, alignment and structure
>d1eaga_ b.50.1.2 (A:) Acid protease {Yeast (Candida albicans) [TaxId: 5476]} Back     information, alignment and structure
>d1hrna_ b.50.1.2 (A:) Chymosin (synonym: renin) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j71a_ b.50.1.2 (A:) Acid protease {Yeast (Candida tropicalis) [TaxId: 5482]} Back     information, alignment and structure
>d1mppa_ b.50.1.2 (A:) Pepsin {Mucor pusillus [TaxId: 4840]} Back     information, alignment and structure
>d2qp8a1 b.50.1.2 (A:60-446) beta-secretase (memapsin) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bxoa_ b.50.1.2 (A:) Acid protease {Fungus (Penicillium janthinellum), penicillopepsin [TaxId: 5079]} Back     information, alignment and structure
>d1wkra_ b.50.1.2 (A:) Acid protease {Irpex lacteus (Polyporus tulipiferae), Polyporopepsin [TaxId: 5319]} Back     information, alignment and structure
>d1t6ex_ b.50.1.2 (X:) Xylanase inhibitor TAXI-I {Wheat (Triticum aestivum) [TaxId: 4565]} Back     information, alignment and structure
>d1izea_ b.50.1.2 (A:) Acid protease {Fungus (Aspergillus oryzae) [TaxId: 5062]} Back     information, alignment and structure