Citrus Sinensis ID: 038338


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-
MEKNVYLSIKLSYDFLRSEEAKSMFRLCGLYSEGHAIPVPYLLRYGVGWGLFENVYTLEEARSRVHRLIDNLKSSCLLLDGDAEDEVKMHDIIHVVAVSVAAETRMFNIPNVADLEKKMEETIRKDPIAISLPQRNIQELPERLQCPNLQLFLLFRQGYGPVQISDLFFEGTEELKVLSLIGIHFSSLPSSLGRLINLQTLCLDWCQLEDVAAIGQLKKLEILNLADSNIEQLPLEIGQLTGLRLLDLTNCWSLQVIAPNVISKLSRLEELYMDNSFSGWEKVEGGSNASLVELKRLTKLTTLEIEVRDAEILLPDFVSVELQRYRIRIGDKLEYEIDQLLVKSEALRLMMLKGLEKVSILQENDGTKMLLQRTEDLWLVKLEGVQNVVHELDDGEGFPRLKHLHVESCYEIVHIVGSVRR
ccccHHHHHHHHHccccccHHHHHHHHHHcccccccccHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHcccccccccccEEEEcHHHHHHHHHHHccccEEEEccccccccccccEEEEcEEEEEccccccccccccccccccEEEEEEccccccccccHHHHcccccccEEEccccccccccccccccccccEEEcccccccccccccccccccEEEccccccccccHHHcccccccEEEccccccccccccccccccccccEEEccccccccEEEcccccccHHHHcccccccEEEEEEccccccccccccccccEEEEEEccccccHHHHHcccccccEEEEccccccccccccccccccccccccEEEEEEcccccccccccccccccccccEEEEEcccccccccccccc
ccccHHHHHHccHcccccHHHHHHEEEEEcccccccccHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHccccccccEEEEHHHHHHHHHHHHcccccEEEEccccccccccccccccEEEEEEEccccccccccccccccEEEEEEccccccccccHHHHHHccccEEEEccccccccccccHHHHHccEEEEccccccccccccccccccEEEEccccccHHccHHHHHHHccEEEEcccccccccccccHHHcHHHHHEEEEEEccccccccccccHHHHHHHHccccccEEEEEccccHHHHHHcccccccEEEEEEccccccccccccccccccccccccHHHcccccccccccccccccccEEEEEccccccccccccccccccccccEEEEcccHHHHHHHHHHcc
MEKNVYLSIKLSYDFLRSEEAKSMFRLcglyseghaipvpylLRYGVGWGLFENVYTLEEARSRVHRLIDNLKSscllldgdaedevkmhDIIHVVAVSVAAEtrmfnipnvaDLEKKMEETIrkdpiaislpqrniqelperlqcpnlqLFLLFRqgygpvqisdlffegtEELKVLSLIGIHFSSLPSSLGRLINLQTLCLDWCQLEDVAAIGQLKKLEILNLAdsnieqlpleigqltglrlldltncwslqviapnVISKLSRLEELYmdnsfsgwekveggsnasLVELKRLTKLTTLEIEVrdaeillpdfvsVELQRYRIRIGDKLEYEIDQLLVKSEALRLMMLKGLEKVSILQENDGTKMLLQRTEDLWLVKLEGVQNVvhelddgegfprlkhlhvESCYEIVHIVGSVRR
MEKNVYLSIKLSYDFLRSEEAKSMFRLCGLYSEGHAIPVPYLLRYGVGWGLFENVYTLEEARSRVHRLIDNLKSSCLLLDGDAEDEVKMHDIIHVVAVSVAAETRMFNIPNVADLEKKMEETIrkdpiaislPQRNIQELPERLQCPNLQLFLLFRQGYGPVQISDLFFEGTEELKVLSLIGIHFSSLPSSLGRLINLQTLCLDWCQLEDVAAIGQLKKLEILNLADSNIEQLPLEIGQLTGLRLLDLTNCWSLQVIAPNVISKLSRLEELYMDNSFSGWekveggsnaslvelKRLTKLttleievrdaeillpdfvsveLQRYRIRIGDKLEYEIDQLLVKSEALRLMMLKGLEKVSILQENDGTKMLLQRTEDLWLVKLEGVQNVVHELDDGEGFPRLKHLHVESCYEIVHIVGSVRR
MEKNVYLSIKLSYDFLRSEEAKSMFRLCGLYSEGHAIPVPYLLRYGVGWGLFENVYTLEEARSRVHRLIDNLKSSCLLLDGDAEDEVKMHDIIHVVAVSVAAETRMFNIPNVADLEKKMEETIRKDPIAISLPQRNIQELPERLQCPNLQLFLLFRQGYGPVQISDLFFEGTEELKVLSLIGIHFSSLPSSLGRLINLQTLCLDWCQLEDVAAIGQLKKLEILNLADSNIEQLPLEIGQLTGLRLLDLTNCWSLQVIAPNVISKLSRLEELYMDNSFSGWEKVEGGSNASlvelkrltklttleieVRDAEILLPDFVSVELQRYRIRIGDKLEYEIDQLLVKSEALRLMMLKGLEKVSILQENDGTKMLLQRTEDLWLVKLEGVQNVVHELDDGEGFPRLKHLHVESCYEIVHIVGSVRR
****VYLSIKLSYDFLRSEEAKSMFRLCGLYSEGHAIPVPYLLRYGVGWGLFENVYTLEEARSRVHRLIDNLKSSCLLLDGDAEDEVKMHDIIHVVAVSVAAETRMFNIPNVADLEK****TIRKDPIAISLPQRNIQELPERLQCPNLQLFLLFRQGYGPVQISDLFFEGTEELKVLSLIGIHFSSLPSSLGRLINLQTLCLDWCQLEDVAAIGQLKKLEILNLADSNIEQLPLEIGQLTGLRLLDLTNCWSLQVIAPNVISKLSRLEELYMDNSFSGWEKVEGGSNASLVELKRLTKLTTLEIEVRDAEILLPDFVSVELQRYRIRIGDKLEYEIDQLLVKSEALRLMMLKGLEKVSILQENDGTKMLLQRTEDLWLVKLEGVQNVVHELDDGEGFPRLKHLHVESCYEIVHIVG****
MEKNVYLSIKLSYDFLRSEEAKSMFRLCGLYSEGHAIPVPYLLRYGVGWGLFENVYTLEEARSRVHRLIDNLKSSCLLLDGDAEDEVKMHDIIHVVAVSVAAETRMFNIPNVADLEKKMEETIRKDPIAISLPQRNIQELPERLQCPNLQLFLLFRQGYGPVQISDLFFEGTEELKVLSLIGIHFSSLPSSLGRLINLQTLCLDWCQLEDVAAIGQLKKLEILNLADSNIEQLPLEIGQLTGLRLLDLTNCWSLQVIAP*VISKLSRLEELYMDNSFSGWEKVEGGSNASLVELKRLTKLTTLEIEVRDAEILLPDFVSVELQRYRIRIGDKLEYEIDQLL*KSEALRLMMLKGLEKVSILQENDGTKMLLQRTEDLWLVKLEGVQNVVHELDDGEGFPRLKHLHVESCYEIVHIVGS***
MEKNVYLSIKLSYDFLRSEEAKSMFRLCGLYSEGHAIPVPYLLRYGVGWGLFENVYTLEEARSRVHRLIDNLKSSCLLLDGDAEDEVKMHDIIHVVAVSVAAETRMFNIPNVADLEKKMEETIRKDPIAISLPQRNIQELPERLQCPNLQLFLLFRQGYGPVQISDLFFEGTEELKVLSLIGIHFSSLPSSLGRLINLQTLCLDWCQLEDVAAIGQLKKLEILNLADSNIEQLPLEIGQLTGLRLLDLTNCWSLQVIAPNVISKLSRLEELYMDNSFSGWEKVEGGSNASLVELKRLTKLTTLEIEVRDAEILLPDFVSVELQRYRIRIGDKLEYEIDQLLVKSEALRLMMLKGLEKVSILQENDGTKMLLQRTEDLWLVKLEGVQNVVHELDDGEGFPRLKHLHVESCYEIVHIVGSVRR
**KNVYLSIKLSYDFLRSEEAKSMFRLCGLYSEGHAIPVPYLLRYGVGWGLFENVYTLEEARSRVHRLIDNLKSSCLLLDGDAEDEVKMHDIIHVVAVSVAAETRMFNIPNVADLEKKMEETIRKDPIAISLPQRNIQELPERLQCPNLQLFLLFRQGYGPVQISDLFFEGTEELKVLSLIGIHFSSLPSSLGRLINLQTLCLDWCQLEDVAAIGQLKKLEILNLADSNIEQLPLEIGQLTGLRLLDLTNCWSLQVIAPNVISKLSRLEELYMDNSFSGWEKVEGGSNASLVELKRLTKLTTLEIEVRDAEILLPDFVSVELQRYRIRIGDKLEYEIDQLLVKSEALRLMMLKGLEKVSILQENDGTKMLLQRTEDLWLVKLEGVQNVVHELDDGEGFPRLKHLHVESCYEIVHIVGSVR*
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEKNVYLSIKLSYDFLRSEEAKSMFRLCGLYSEGHAIPVPYLLRYGVGWGLFENVYTLEEARSRVHRLIDNLKSSCLLLDGDAEDEVKMHDIIHVVAVSVAAETRMFNIPNVADLEKKMEETIRKDPIAISLPQRNIQELPERLQCPNLQLFLLFRQGYGPVQISDLFFEGTEELKVLSLIGIHFSSLPSSLGRLINLQTLCLDWCQLEDVAAIGQLKKLEILNLADSNIEQLPLEIGQLTGLRLLDLTNCWSLQVIAPNVISKLSRLEELYMDNSFSGWEKVEGGSNASLVELKRLTKLTTLEIEVRDAEILLPDFVSVELQRYRIRIGDKLEYEIDQLLVKSEALRLMMLKGLEKVSILQENDGTKMLLQRTEDLWLVKLEGVQNVVHELDDGEGFPRLKHLHVESCYEIVHIVGSVRR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query421 2.2.26 [Sep-21-2011]
Q9T048 985 Disease resistance protei yes no 0.933 0.398 0.286 1e-30
O81825 919 Probable disease resistan no no 0.712 0.326 0.311 2e-28
Q42484 909 Disease resistance protei no no 0.674 0.312 0.311 2e-27
Q9LVT4843 Probable disease resistan no no 0.577 0.288 0.28 4e-15
O82484 892 Putative disease resistan no no 0.574 0.271 0.281 2e-13
Q8RXS5888 Probable disease resistan no no 0.577 0.273 0.303 2e-13
P60838894 Probable disease resistan no no 0.489 0.230 0.282 6e-11
Q8L3R3885 Disease resistance protei no no 0.565 0.268 0.283 1e-10
Q9SH22884 Probable disease resistan no no 0.605 0.288 0.270 2e-10
O64973889 Disease resistance protei no no 0.567 0.268 0.285 4e-10
>sp|Q9T048|DRL27_ARATH Disease resistance protein At4g27190 OS=Arabidopsis thaliana GN=At4g27190 PE=2 SV=1 Back     alignment and function desciption
 Score =  134 bits (338), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 121/422 (28%), Positives = 221/422 (52%), Gaps = 29/422 (6%)

Query: 1   MEKNVYLSIKLSYDFLRSEEAKSMFRLCGLYSEGHAIPVPYLLRYGVGWGLFENVYTLEE 60
           +E+ ++  +KLSYDFL  ++AK  F LC L+ E ++I V  ++RY +  G  E + + E+
Sbjct: 375 IEEKIFQPLKLSYDFL-EDKAKFCFLLCALFPEDYSIEVTEVVRYWMAEGFMEELGSQED 433

Query: 61  ARSRVHRLIDNLKSSCLLLDGDAEDEVKMHDIIHVVAVSVAAETRMFNIPNVADLEKKME 120
           + +     +++LK  CLL DGD  D VKMHD++   A+ + + ++  +  +   +     
Sbjct: 434 SMNEGITTVESLKDYCLLEDGDRRDTVKMHDVVRDFAIWIMSSSQ--DDSHSLVMSGTGL 491

Query: 121 ETIRKDPIA-----ISLPQRNIQELPERLQCPNLQLFLLFRQG-YGPVQISDLFFEGTEE 174
           + IR+D +A     +SL    ++ LP+ ++   ++  +L  QG +   ++   F +    
Sbjct: 492 QDIRQDKLAPSLRRVSLMNNKLESLPDLVEEFCVKTSVLLLQGNFLLKEVPIGFLQAFPT 551

Query: 175 LKVLSLIGIHFSSLPS-SLGRLINLQTLCLDWC-QLEDVAAIGQLKKLEILNLADSNIEQ 232
           L++L+L G    S PS SL RL +L +L L  C +L  + ++  L KLE+L+L  ++I +
Sbjct: 552 LRILNLSGTRIKSFPSCSLLRLFSLHSLFLRDCFKLVKLPSLETLAKLELLDLCGTHILE 611

Query: 233 LPLEIGQLTGLRLLDLTNCWSLQVIAPNVISKLSRLEELYMDNSFSGWEKVEGGS---NA 289
            P  + +L   R LDL+    L+ I   V+S+LS LE L M +S   W  V+G +    A
Sbjct: 612 FPRGLEELKRFRHLDLSRTLHLESIPARVVSRLSSLETLDMTSSHYRWS-VQGETQKGQA 670

Query: 290 SLVELKRLTKLTTLEIEVRDAEILLPDFVS--VELQRYRIRIGDKLEYEIDQLLVKSEAL 347
           ++ E+  L +L  L I +  +  LL    +    L+++++ +G +       L  + +  
Sbjct: 671 TVEEIGCLQRLQVLSIRLHSSPFLLNKRNTWIKRLKKFQLVVGSRY-----ILRTRHDKR 725

Query: 348 RLMMLKGLEKVSILQENDGTKMLLQRTEDLWLVKLEGVQNVVHEL-DDGEGFPRLKHLHV 406
           RL     +  +++ Q + G   LL  T  L L   +G++ ++ +L  D +GF  LK L +
Sbjct: 726 RLT----ISHLNVSQVSIG--WLLAYTTSLALNHCQGIEAMMKKLVSDNKGFKNLKSLTI 779

Query: 407 ES 408
           E+
Sbjct: 780 EN 781




Disease resistance protein.
Arabidopsis thaliana (taxid: 3702)
>sp|O81825|DRL28_ARATH Probable disease resistance protein At4g27220 OS=Arabidopsis thaliana GN=At4g27220 PE=2 SV=1 Back     alignment and function description
>sp|Q42484|RPS2_ARATH Disease resistance protein RPS2 OS=Arabidopsis thaliana GN=RPS2 PE=1 SV=1 Back     alignment and function description
>sp|Q9LVT4|DRL37_ARATH Probable disease resistance protein At5g47250 OS=Arabidopsis thaliana GN=At5g47250 PE=2 SV=1 Back     alignment and function description
>sp|O82484|DRL23_ARATH Putative disease resistance protein At4g10780 OS=Arabidopsis thaliana GN=At4g10780 PE=2 SV=1 Back     alignment and function description
>sp|Q8RXS5|DRL40_ARATH Probable disease resistance protein At5g63020 OS=Arabidopsis thaliana GN=At5g63020 PE=2 SV=2 Back     alignment and function description
>sp|P60838|DRL1_ARATH Probable disease resistance protein At1g12280 OS=Arabidopsis thaliana GN=At1g12280 PE=3 SV=1 Back     alignment and function description
>sp|Q8L3R3|RFL1_ARATH Disease resistance protein RFL1 OS=Arabidopsis thaliana GN=RFL1 PE=3 SV=2 Back     alignment and function description
>sp|Q9SH22|DRL20_ARATH Probable disease resistance protein At1g63360 OS=Arabidopsis thaliana GN=At1g63360 PE=2 SV=1 Back     alignment and function description
>sp|O64973|RPS5_ARATH Disease resistance protein RPS5 OS=Arabidopsis thaliana GN=RPS5 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query421
224111296 1315 cc-nbs-lrr resistance protein [Populus t 0.964 0.308 0.456 1e-88
255563252 1603 Disease resistance protein RPS5, putativ 0.976 0.256 0.452 2e-86
255542484 2460 phosphoprotein phosphatase, putative [Ri 0.945 0.161 0.467 3e-86
224125154 949 cc-nbs-lrr resistance protein [Populus t 0.961 0.426 0.459 5e-86
224111284 1340 cc-nbs-lrr resistance protein [Populus t 0.964 0.302 0.459 2e-83
359488103 1530 PREDICTED: disease resistance protein At 0.964 0.265 0.462 3e-81
359488095 1347 PREDICTED: probable disease resistance p 0.964 0.301 0.457 3e-81
147865073 1694 hypothetical protein VITISV_021876 [Viti 0.964 0.239 0.460 3e-81
296087872 1152 unnamed protein product [Vitis vinifera] 0.964 0.352 0.456 2e-80
359488027 1520 PREDICTED: disease resistance protein At 0.964 0.267 0.456 2e-80
>gi|224111296|ref|XP_002332952.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|222834264|gb|EEE72741.1| cc-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  333 bits (854), Expect = 1e-88,   Method: Compositional matrix adjust.
 Identities = 195/427 (45%), Positives = 279/427 (65%), Gaps = 21/427 (4%)

Query: 1   MEKNVYLSIKLSYDFLRSEEAKSMFRLCGLYSEGHAIPVPYLLRYGVGWGLFENVYTLEE 60
           ++  VYL ++LSY  LR +E KS+F LCG     + I +  LLRYG+G  LF+   TLEE
Sbjct: 373 IDDQVYLGLELSYKSLRGDEIKSLFLLCGQLRSNN-ILISDLLRYGIGLDLFKGCSTLEE 431

Query: 61  ARSRVHRLIDNLKSSCLLLDGDAEDEVKMHDIIHVVAVSVAAETRMFNIPNVADLEKKME 120
            R+ +  L+D LK+SCLLL+GD +  VKMHD++H  A+SVA   R  ++  VAD  K+  
Sbjct: 432 TRNSLLTLVDELKASCLLLEGDKDGSVKMHDVVHSFAISVA--LRDHHVLTVADEFKEWP 489

Query: 121 ET-IRKDPIAISLPQRNIQELPERLQCPNLQLFLLFRQGYGPVQISDLFFEGTEELKVLS 179
              + +   AISLP R I +LP  L+CPNL  FLL  +    +QI D FF   +ELK+L 
Sbjct: 490 ANDVLQQYTAISLPFRKIPDLPAILECPNLNSFLLLNKDPS-LQIPDSFFREMKELKILD 548

Query: 180 LIGIHFSSLPSSLGRLINLQTLCLDWCQLEDVAAIGQLKKLEILNLADSNIEQLPLEIGQ 239
           L  ++ S LPSSL  L NLQTLCLD C LED++ IG+L KL++L+L  SNI +LP EIG+
Sbjct: 549 LTEVNLSPLPSSLQFLENLQTLCLDHCVLEDISIIGELNKLKVLSLMSSNIVRLPREIGK 608

Query: 240 LTGLRLLDLTNCWSLQVIAPNVISKLSRLEELYMDNSFSGWEKVEGGS----NASLVELK 295
           +T L+LLDL+NC  L+VI+PN +S L+RLE+LYM NSF  WE  EG S    NA L ELK
Sbjct: 609 VTRLQLLDLSNCERLEVISPNALSSLTRLEDLYMGNSFVKWE-TEGSSSQRNNACLSELK 667

Query: 296 RLTKLTTLEIEVRDAEILLPDFVSV--ELQRYRIRIGDKLEYEIDQLLVKSEALRLMMLK 353
            L+ L+TL +++ DA+ +  D  S    L+R+RI IGD  ++ +     ++  L+L    
Sbjct: 668 HLSNLSTLHMQITDADNMPKDLFSSFQNLERFRIFIGDGWDWSVKDATSRTLKLKLN--- 724

Query: 354 GLEKVSILQENDGTKMLLQRTEDLWLVKLEGVQNVVHELDDGEGFPRLKHLHVESCYEIV 413
                +++Q  +G   LL+ TE+L L +L GV++++++L DGEGFP+L+HLHV++C  + 
Sbjct: 725 -----TVIQLEEGVNTLLKITEELHLQELNGVKSILNDL-DGEGFPQLRHLHVQNCPGVQ 778

Query: 414 HIVGSVR 420
           +I+ S+R
Sbjct: 779 YIINSIR 785




Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|255563252|ref|XP_002522629.1| Disease resistance protein RPS5, putative [Ricinus communis] gi|223538105|gb|EEF39716.1| Disease resistance protein RPS5, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|255542484|ref|XP_002512305.1| phosphoprotein phosphatase, putative [Ricinus communis] gi|223548266|gb|EEF49757.1| phosphoprotein phosphatase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224125154|ref|XP_002319513.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|222857889|gb|EEE95436.1| cc-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224111284|ref|XP_002332949.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|222834261|gb|EEE72738.1| cc-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|359488103|ref|XP_002263579.2| PREDICTED: disease resistance protein At4g27190-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|359488095|ref|XP_002270726.2| PREDICTED: probable disease resistance protein At4g27220-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|147865073|emb|CAN83232.1| hypothetical protein VITISV_021876 [Vitis vinifera] Back     alignment and taxonomy information
>gi|296087872|emb|CBI35155.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|359488027|ref|XP_002269288.2| PREDICTED: disease resistance protein At4g27190-like [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query421
TAIR|locus:2131689 919 AT4G27220 [Arabidopsis thalian 0.657 0.301 0.313 9.8e-32
TAIR|locus:2136447 985 AT4G27190 [Arabidopsis thalian 0.928 0.396 0.283 1.5e-30
TAIR|locus:2005517909 RPS2 "RESISTANT TO P. SYRINGAE 0.636 0.294 0.294 1.1e-21
TAIR|locus:2166320888 AT5G63020 [Arabidopsis thalian 0.627 0.297 0.296 1e-16
TAIR|locus:2171579843 AT5G47250 [Arabidopsis thalian 0.572 0.285 0.301 7.5e-16
TAIR|locus:2132741892 AT4G10780 [Arabidopsis thalian 0.638 0.301 0.286 3.1e-15
TAIR|locus:2036214851 AT1G15890 [Arabidopsis thalian 0.612 0.303 0.310 3e-14
TAIR|locus:2034770894 SUMM2 "AT1G12280" [Arabidopsis 0.624 0.294 0.276 9.6e-14
TAIR|locus:2201986885 RFL1 "AT1G12210" [Arabidopsis 0.631 0.300 0.285 1.5e-13
TAIR|locus:2201996889 RPS5 "AT1G12220" [Arabidopsis 0.622 0.294 0.286 1.9e-13
TAIR|locus:2131689 AT4G27220 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 341 (125.1 bits), Expect = 9.8e-32, Sum P(2) = 9.8e-32
 Identities = 89/284 (31%), Positives = 153/284 (53%)

Query:     2 EKNVYLSIKLSYDFLRSEEAKSMFRLCGLYSEGHAIPVPYLLRYGVGWGLFENVYTLEEA 61
             E+ ++ ++KLSYDFL+ +  KS F  C L+ E ++I V  L+ Y V  GL +  +  E+ 
Sbjct:   345 EEKIFGTLKLSYDFLQ-DNMKSCFLFCALFPEDYSIKVSELIMYWVAEGLLDGQHHYEDM 403

Query:    62 RSRVHRLIDNLKSSCLLLDGDAEDEVKMHDIIHVVAV-SVAAETRMFNIPNVAD--LEKK 118
              +    L++ LK SCLL DGD+ D VKMHD++   A+  ++++   F+   +A   L + 
Sbjct:   404 MNEGVTLVERLKDSCLLEDGDSCDTVKMHDVVRDFAIWFMSSQGEGFHSLVMAGRGLIEF 463

Query:   119 MEETIRKDPIAISLPQRNIQELPERLQCPNLQLFLLFRQGYGPV-QISDLFFEGTEELKV 177
              ++        +SL    ++ LP  +    ++  +L  QG   V ++ + F +    L++
Sbjct:   464 PQDKFVSSVQRVSLMANKLERLPNNV-IEGVETLVLLLQGNSHVKEVPNGFLQAFPNLRI 522

Query:   178 LSLIGIHFSSLPSSLGRLINLQTLCLDWCQ-LEDVAAIGQLKKLEILNLADSNIEQLPLE 236
             L L G+   +LP S   L +L++L L  C+ L ++ ++  L KL+ L+L +S I +LP  
Sbjct:   523 LDLSGVRIRTLPDSFSNLHSLRSLVLRNCKKLRNLPSLESLVKLQFLDLHESAIRELPRG 582

Query:   237 IGQLTGLRLLDLTNCWSLQVIAPNVISKLSRLEELYMDNSFSGW 280
             +  L+ LR + ++N + LQ I    I +LS LE L M  S   W
Sbjct:   583 LEALSSLRYICVSNTYQLQSIPAGTILQLSSLEVLDMAGSAYSW 626


GO:0005634 "nucleus" evidence=ISM
GO:0006952 "defense response" evidence=IEA;ISS
GO:0043531 "ADP binding" evidence=IEA
TAIR|locus:2136447 AT4G27190 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2005517 RPS2 "RESISTANT TO P. SYRINGAE 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2166320 AT5G63020 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2171579 AT5G47250 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2132741 AT4G10780 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2036214 AT1G15890 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2034770 SUMM2 "AT1G12280" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2201986 RFL1 "AT1G12210" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2201996 RPS5 "AT1G12220" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query421
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 7e-09
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 2e-05
pfam1279943 pfam12799, LRR_4, Leucine Rich repeats (2 copies) 9e-05
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 1e-04
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 3e-04
PLN03210 1153 PLN03210, PLN03210, Resistant to P 0.002
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
 Score = 56.9 bits (137), Expect = 7e-09
 Identities = 38/114 (33%), Positives = 52/114 (45%), Gaps = 3/114 (2%)

Query: 163 QISDLFFEGTEELKVLSLIGIHFSSLPSSLGRLINLQTLCLDWCQLEDVAA-IGQLKKLE 221
            I  L       LK L L      SLPS L  L NL+ L L +  L D+   +  L  L 
Sbjct: 130 DIPPLIGLLKSNLKELDLSDNKIESLPSPLRNLPNLKNLDLSFNDLSDLPKLLSNLSNLN 189

Query: 222 ILNLADSNIEQLPLEIGQLTGLRLLDLTNCWSLQVIAPNVISKLSRLEELYMDN 275
            L+L+ + I  LP EI  L+ L  LDL+N  +  +   + +S L  L  L + N
Sbjct: 190 NLDLSGNKISDLPPEIELLSALEELDLSN--NSIIELLSSLSNLKNLSGLELSN 241


Length = 394

>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|205079 pfam12799, LRR_4, Leucine Rich repeats (2 copies) Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 421
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 100.0
PLN03210 1153 Resistant to P. syringae 6; Provisional 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.92
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.92
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.88
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.86
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.84
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.84
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.83
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.79
KOG0472 565 consensus Leucine-rich repeat protein [Function un 99.78
KOG0617264 consensus Ras suppressor protein (contains leucine 99.71
KOG0617264 consensus Ras suppressor protein (contains leucine 99.67
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.66
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.62
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.61
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.59
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.52
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.51
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.51
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.49
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 99.37
KOG4237 498 consensus Extracellular matrix protein slit, conta 99.37
KOG4237 498 consensus Extracellular matrix protein slit, conta 99.28
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.15
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.12
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.12
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 99.12
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.1
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.08
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 99.05
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.91
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.9
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.87
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.81
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.78
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.77
PLN03150623 hypothetical protein; Provisional 98.66
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.62
KOG4341483 consensus F-box protein containing LRR [General fu 98.61
PLN03150623 hypothetical protein; Provisional 98.61
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.54
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.52
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 98.48
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.48
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.41
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.4
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.36
KOG4341483 consensus F-box protein containing LRR [General fu 98.24
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.18
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 98.13
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.11
KOG2982 418 consensus Uncharacterized conserved protein [Funct 98.04
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.02
PRK15386 426 type III secretion protein GogB; Provisional 97.99
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.97
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.88
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.69
PRK15386426 type III secretion protein GogB; Provisional 97.67
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.57
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 97.45
KOG2123 388 consensus Uncharacterized conserved protein [Funct 97.45
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 97.23
KOG1947482 consensus Leucine rich repeat proteins, some prote 97.16
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.93
KOG2123 388 consensus Uncharacterized conserved protein [Funct 96.91
KOG1947482 consensus Leucine rich repeat proteins, some prote 96.65
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.54
KOG3864221 consensus Uncharacterized conserved protein [Funct 96.08
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 96.06
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 95.87
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 95.77
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.69
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 94.83
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 94.28
KOG3864221 consensus Uncharacterized conserved protein [Funct 93.33
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 91.95
smart0037026 LRR Leucine-rich repeats, outliers. 91.95
KOG0473326 consensus Leucine-rich repeat protein [Function un 89.49
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 88.87
smart0037026 LRR Leucine-rich repeats, outliers. 88.87
KOG0473326 consensus Leucine-rich repeat protein [Function un 86.26
smart0036726 LRR_CC Leucine-rich repeat - CC (cysteine-containi 85.56
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
Probab=100.00  E-value=9.8e-43  Score=351.24  Aligned_cols=373  Identities=26%  Similarity=0.335  Sum_probs=271.0

Q ss_pred             CchhhhhHHHhhhhccCchHHHHHHHHhccCCCCCccChHHHHHHHhhhccccccccHHHHHHHHHHHHHHHHhcccccc
Q 038338            1 MEKNVYLSIKLSYDFLRSEEAKSMFRLCGLYSEGHAIPVPYLLRYGVGWGLFENVYTLEEARSRVHRLIDNLKSSCLLLD   80 (421)
Q Consensus         1 ~~~~i~~~l~lSY~~L~~~~lk~cfl~~~~fp~~~~~~~~~li~~wia~g~~~~~~~~~~~~~~~~~~~~~L~~~~~~~~   80 (421)
                      +++.|+++|++|||+||+ ++|.||+|||+|||||+|++++|+..|+||||+++....+.+++.+.+++.+|+.+++++.
T Consensus       393 ~~~~i~~iLklSyd~L~~-~lK~CFLycalFPED~~I~~e~Li~yWiaEGfi~~~~~~~~~~d~G~~~i~~LV~~~Ll~~  471 (889)
T KOG4658|consen  393 MEESILPILKLSYDNLPE-ELKSCFLYCALFPEDYEIKKEKLIEYWIAEGFIDPLDGGETAEDVGYDYIEELVRASLLIE  471 (889)
T ss_pred             hhhhhHHhhhccHhhhhH-HHHHHHHhhccCCcccccchHHHHHHHHhccCcCccccccchhcchHHHHHHHHHHHHHhh
Confidence            467899999999999995 6999999999999999999999999999999999866777899999999999999999987


Q ss_pred             cC---CCCceeccchHHHHHHHHhh-----cCCeEEecCCCCcccccccCccCCCeEEEcCCCCCccCCcccCCCCccEE
Q 038338           81 GD---AEDEVKMHDIIHVVAVSVAA-----ETRMFNIPNVADLEKKMEETIRKDPIAISLPQRNIQELPERLQCPNLQLF  152 (421)
Q Consensus        81 ~~---~~~~~~~hd~~~~l~~~~~~-----~e~~~~~~~~~~~~~~~~~~~~~~l~~l~l~~~~~~~l~~~~~~~~L~~L  152 (421)
                      .+   ....|+|||++|+||.+++.     .++.+ +.++......+....+...|++++.++.+..++....+++|++|
T Consensus       472 ~~~~~~~~~~kmHDvvRe~al~ias~~~~~~e~~i-v~~~~~~~~~~~~~~~~~~rr~s~~~~~~~~~~~~~~~~~L~tL  550 (889)
T KOG4658|consen  472 ERDEGRKETVKMHDVVREMALWIASDFGKQEENQI-VSDGVGLSEIPQVKSWNSVRRMSLMNNKIEHIAGSSENPKLRTL  550 (889)
T ss_pred             cccccceeEEEeeHHHHHHHHHHhccccccccceE-EECCcCccccccccchhheeEEEEeccchhhccCCCCCCccceE
Confidence            64   45789999999999999999     56644 33333444456677788999999999999888888888999999


Q ss_pred             EeeecCCCCcccChHHhccCCCccEEEccCC-CCCCCChhhhcccCCcEEEcccccCCC-cccccCcCCCCEEEeeCCC-
Q 038338          153 LLFRQGYGPVQISDLFFEGTEELKVLSLIGI-HFSSLPSSLGRLINLQTLCLDWCQLED-VAAIGQLKKLEILNLADSN-  229 (421)
Q Consensus       153 ~l~~~~~~~~~~~~~~~~~l~~L~~L~l~~~-~~~~lp~~i~~l~~L~~L~l~~~~~~~-~~~~~~l~~L~~L~l~~~~-  229 (421)
                      -+.+|..-...++..+|..++.|++||+++| .+.++|.+|+.+.+||||+++++.+.. |.+++++..|.+|++..+. 
T Consensus       551 ll~~n~~~l~~is~~ff~~m~~LrVLDLs~~~~l~~LP~~I~~Li~LryL~L~~t~I~~LP~~l~~Lk~L~~Lnl~~~~~  630 (889)
T KOG4658|consen  551 LLQRNSDWLLEISGEFFRSLPLLRVLDLSGNSSLSKLPSSIGELVHLRYLDLSDTGISHLPSGLGNLKKLIYLNLEVTGR  630 (889)
T ss_pred             EEeecchhhhhcCHHHHhhCcceEEEECCCCCccCcCChHHhhhhhhhcccccCCCccccchHHHHHHhhheeccccccc
Confidence            9999861136778888899999999999987 456799999999999999999999999 9999999999999999884 


Q ss_pred             CcccchhhcCCCCCCEEeccCCcCC-cccchhhhcCCCCCcEEEcccCCCCCccccCCCCcChhhhcCCCCCC----EEE
Q 038338          230 IEQLPLEIGQLTGLRLLDLTNCWSL-QVIAPNVISKLSRLEELYMDNSFSGWEKVEGGSNASLVELKRLTKLT----TLE  304 (421)
Q Consensus       230 l~~lp~~~~~l~~L~~L~l~~~~~~-~~~~~~~l~~l~~L~~L~l~~~~~~~~~~~~~~~~~~~~l~~l~~L~----~L~  304 (421)
                      +..+|.....|++|++|.+...... +......+..+++|+.+.......          .....+..+..|.    .+.
T Consensus       631 l~~~~~i~~~L~~Lr~L~l~~s~~~~~~~~l~el~~Le~L~~ls~~~~s~----------~~~e~l~~~~~L~~~~~~l~  700 (889)
T KOG4658|consen  631 LESIPGILLELQSLRVLRLPRSALSNDKLLLKELENLEHLENLSITISSV----------LLLEDLLGMTRLRSLLQSLS  700 (889)
T ss_pred             cccccchhhhcccccEEEeeccccccchhhHHhhhcccchhhheeecchh----------HhHhhhhhhHHHHHHhHhhh
Confidence            4455555566999999998764311 111111134444555444422211          1123333444444    233


Q ss_pred             EEecCccccCCcc-cccCCceEEEEEcCCccchh----hhhhc-hhhhceeEEEcCCcccccccchhHHHHhhhcccEEE
Q 038338          305 IEVRDAEILLPDF-VSVELQRYRIRIGDKLEYEI----DQLLV-KSEALRLMMLKGLEKVSILQENDGTKMLLQRTEDLW  378 (421)
Q Consensus       305 l~~~~~~~~~~~~-~~~~L~~L~l~~~~~~~~~~----~~~~~-~l~~L~~L~l~~~~~~~~~~~~~~~~~~~~~L~~L~  378 (421)
                      +.++.....+..+ ...+|+.|.+..+.......    ..... .++++..+.+.+|.   ....+.|... .|+|+.|.
T Consensus       701 ~~~~~~~~~~~~~~~l~~L~~L~i~~~~~~e~~~~~~~~~~~~~~f~~l~~~~~~~~~---~~r~l~~~~f-~~~L~~l~  776 (889)
T KOG4658|consen  701 IEGCSKRTLISSLGSLGNLEELSILDCGISEIVIEWEESLIVLLCFPNLSKVSILNCH---MLRDLTWLLF-APHLTSLS  776 (889)
T ss_pred             hcccccceeecccccccCcceEEEEcCCCchhhcccccccchhhhHHHHHHHHhhccc---cccccchhhc-cCcccEEE
Confidence            3333333333333 55888888887665543111    11111 14556666555543   2333444433 38888888


Q ss_pred             eccccCccccc
Q 038338          379 LVKLEGVQNVV  389 (421)
Q Consensus       379 l~~~~~~~~~~  389 (421)
                      +..|...+.+.
T Consensus       777 l~~~~~~e~~i  787 (889)
T KOG4658|consen  777 LVSCRLLEDII  787 (889)
T ss_pred             EecccccccCC
Confidence            88888776554



>PLN03210 Resistant to P Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query421
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-19
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 5e-19
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 5e-17
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 8e-15
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-19
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 9e-19
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-17
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 7e-12
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-06
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-14
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-14
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-11
4fmz_A347 Internalin; leucine rich repeat, structural genomi 8e-11
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 4e-06
4fmz_A347 Internalin; leucine rich repeat, structural genomi 8e-06
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-14
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 3e-13
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-12
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-11
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-09
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-08
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 9e-08
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 8e-04
1o6v_A 466 Internalin A; bacterial infection, extracellular r 2e-14
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-13
1o6v_A466 Internalin A; bacterial infection, extracellular r 6e-13
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-12
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-10
1o6v_A 466 Internalin A; bacterial infection, extracellular r 7e-05
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-14
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 2e-13
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 4e-10
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 6e-14
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-10
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-08
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-08
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-06
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 8e-14
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 1e-11
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 3e-11
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 3e-11
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 4e-10
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 9e-10
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 2e-06
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 1e-13
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 6e-07
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 5e-04
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-13
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 3e-08
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-13
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-13
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-10
4ezg_A197 Putative uncharacterized protein; internalin-A, le 6e-05
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-12
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-11
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 5e-11
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-10
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-09
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 3e-09
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-07
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 6e-07
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 6e-07
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-12
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 7e-10
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 4e-07
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-12
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-10
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 7e-07
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 9e-07
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 6e-06
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 2e-12
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-12
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 3e-10
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 8e-09
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 6e-07
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 3e-12
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-11
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 5e-11
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 9e-07
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 4e-12
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 8e-10
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-09
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-09
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 6e-09
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-08
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 5e-07
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 4e-12
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 1e-11
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 8e-12
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-06
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-05
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 9e-12
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-07
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 4e-07
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 6e-06
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 1e-11
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 5e-11
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 1e-11
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 3e-10
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 2e-06
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-11
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 6e-11
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-10
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-08
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-08
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-07
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 5e-06
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-05
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-11
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-08
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 4e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-11
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-07
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 3e-11
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 8e-09
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 9e-09
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-07
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-11
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-09
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-09
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-07
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-10
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 9e-10
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-09
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-06
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-10
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 5e-08
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-07
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 7e-07
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-06
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 3e-10
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 7e-09
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-08
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 5e-10
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 6e-10
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 4e-09
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 5e-07
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 8e-10
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 6e-09
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 8e-09
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 4e-04
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-09
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 5e-08
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-06
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 3e-06
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 3e-06
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-09
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 8e-09
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-07
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 2e-09
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 2e-09
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 8e-09
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 8e-08
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-07
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-07
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 9e-09
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-07
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 9e-07
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-06
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-05
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 2e-08
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 3e-08
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 2e-06
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 6e-08
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 4e-07
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 5e-07
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 8e-07
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 7e-08
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 4e-05
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 8e-08
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 3e-07
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 7e-07
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-05
2a5y_B549 CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis 9e-08
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 1e-07
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 2e-07
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 1e-05
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 2e-07
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 2e-07
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 3e-06
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 3e-07
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 7e-05
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 7e-07
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-06
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-04
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 2e-06
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-06
3m19_A251 Variable lymphocyte receptor A diversity region; a 6e-06
3m19_A251 Variable lymphocyte receptor A diversity region; a 7e-06
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 7e-06
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-05
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 1e-05
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 1e-05
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 2e-05
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 6e-05
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 1e-04
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 2e-04
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-04
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 8e-04
3e6j_A229 Variable lymphocyte receptor diversity region; var 4e-04
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Length = 549 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query421
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.94
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.94
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 99.94
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.93
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.93
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.93
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.93
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.93
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 99.93
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.93
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.93
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.92
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.92
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.92
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.92
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.92
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.91
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.91
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.91
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.91
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 99.91
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.91
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.91
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 99.91
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.91
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.91
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.91
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.9
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.9
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.9
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.9
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.9
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.9
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.9
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.9
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.9
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 99.9
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.9
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.9
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.89
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.89
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.89
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.89
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.89
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.89
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.89
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.89
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.89
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.89
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.88
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.88
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.88
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.88
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.87
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.87
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.86
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.85
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.85
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.84
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.84
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.84
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.83
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.83
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.83
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.82
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.82
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.82
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.81
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.81
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.81
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.81
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.8
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.8
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.8
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.79
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.79
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.79
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.78
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.78
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.78
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.77
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.77
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.76
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.76
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.76
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.76
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.75
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 99.74
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.73
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.72
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.72
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.72
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.71
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.7
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.69
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.69
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.69
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.67
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.67
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.66
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.66
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.66
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.65
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.65
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.65
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 99.65
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 99.63
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.63
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.63
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.62
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.62
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.6
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.6
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.6
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.58
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.57
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.56
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.55
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.55
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.53
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.52
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.5
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.48
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.47
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.45
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.45
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.45
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.44
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.44
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.44
2a5y_B549 CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis 99.37
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.37
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.36
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.36
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.27
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.24
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.23
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.2
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.17
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.16
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.11
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.1
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.09
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 99.02
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.02
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 98.94
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 98.89
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 98.84
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 98.77
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.65
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 98.55
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.52
1z6t_A591 APAF-1, apoptotic protease activating factor 1; ca 98.46
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.37
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.3
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.28
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.19
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 98.08
4gt6_A394 Cell surface protein; leucine rich repeats, putati 98.08
4gt6_A394 Cell surface protein; leucine rich repeats, putati 98.05
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.97
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.94
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 96.97
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 96.85
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 96.55
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 95.68
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 95.14
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 94.47
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
Probab=99.94  E-value=3.3e-25  Score=206.87  Aligned_cols=194  Identities=18%  Similarity=0.174  Sum_probs=126.0

Q ss_pred             ccccccCccCCCeEEEcCCCCCccCCcccCCCCccEEEeeecCCCCcccChHHhccCCCccEEEccCCCCCCCChhhhcc
Q 038338          116 EKKMEETIRKDPIAISLPQRNIQELPERLQCPNLQLFLLFRQGYGPVQISDLFFEGTEELKVLSLIGIHFSSLPSSLGRL  195 (421)
Q Consensus       116 ~~~~~~~~~~~l~~l~l~~~~~~~l~~~~~~~~L~~L~l~~~~~~~~~~~~~~~~~l~~L~~L~l~~~~~~~lp~~i~~l  195 (421)
                      ..++.+..++++++|++++|.+..++....+++|++|++++|.+  ..++.  +..+++|++|++++|.+..++. +..+
T Consensus        57 ~~~~~~~~~~~L~~L~l~~n~i~~~~~~~~l~~L~~L~L~~n~i--~~~~~--~~~l~~L~~L~l~~n~i~~~~~-~~~l  131 (347)
T 4fmz_A           57 ASIQGIEYLTNLEYLNLNGNQITDISPLSNLVKLTNLYIGTNKI--TDISA--LQNLTNLRELYLNEDNISDISP-LANL  131 (347)
T ss_dssp             CCCTTGGGCTTCCEEECCSSCCCCCGGGTTCTTCCEEECCSSCC--CCCGG--GTTCTTCSEEECTTSCCCCCGG-GTTC
T ss_pred             ccchhhhhcCCccEEEccCCccccchhhhcCCcCCEEEccCCcc--cCchH--HcCCCcCCEEECcCCcccCchh-hccC
Confidence            33445666778888888888877777666788888888888865  34432  5778888888888888777766 7777


Q ss_pred             cCCcEEEcccccCCC-cccccCcCCCCEEEeeCCCCcccchhhcCCCCCCEEeccCCcCCcccchhhhcCCCCCcEEEcc
Q 038338          196 INLQTLCLDWCQLED-VAAIGQLKKLEILNLADSNIEQLPLEIGQLTGLRLLDLTNCWSLQVIAPNVISKLSRLEELYMD  274 (421)
Q Consensus       196 ~~L~~L~l~~~~~~~-~~~~~~l~~L~~L~l~~~~l~~lp~~~~~l~~L~~L~l~~~~~~~~~~~~~l~~l~~L~~L~l~  274 (421)
                      ++|++|++++|.... +..+..+++|++|++++|.+..++. +..+++|++|++++|. +..++.  +..+++|+.|+++
T Consensus       132 ~~L~~L~l~~n~~~~~~~~~~~l~~L~~L~l~~~~~~~~~~-~~~l~~L~~L~l~~n~-l~~~~~--~~~l~~L~~L~l~  207 (347)
T 4fmz_A          132 TKMYSLNLGANHNLSDLSPLSNMTGLNYLTVTESKVKDVTP-IANLTDLYSLSLNYNQ-IEDISP--LASLTSLHYFTAY  207 (347)
T ss_dssp             TTCCEEECTTCTTCCCCGGGTTCTTCCEEECCSSCCCCCGG-GGGCTTCSEEECTTSC-CCCCGG--GGGCTTCCEEECC
T ss_pred             CceeEEECCCCCCcccccchhhCCCCcEEEecCCCcCCchh-hccCCCCCEEEccCCc-cccccc--ccCCCccceeecc
Confidence            888888888875444 5567777777777777777776654 6777777777777753 344443  5566666666666


Q ss_pred             cCCCCCccccCCCCcChhhhcCCCCCCEEEEEecCccccCCcccccCCceEEEE
Q 038338          275 NSFSGWEKVEGGSNASLVELKRLTKLTTLEIEVRDAEILLPDFVSVELQRYRIR  328 (421)
Q Consensus       275 ~~~~~~~~~~~~~~~~~~~l~~l~~L~~L~l~~~~~~~~~~~~~~~~L~~L~l~  328 (421)
                      +|.+.....          +..+++|++|++++|.+..++....+++|+.|++.
T Consensus       208 ~n~l~~~~~----------~~~~~~L~~L~l~~n~l~~~~~~~~l~~L~~L~l~  251 (347)
T 4fmz_A          208 VNQITDITP----------VANMTRLNSLKIGNNKITDLSPLANLSQLTWLEIG  251 (347)
T ss_dssp             SSCCCCCGG----------GGGCTTCCEEECCSSCCCCCGGGTTCTTCCEEECC
T ss_pred             cCCCCCCch----------hhcCCcCCEEEccCCccCCCcchhcCCCCCEEECC
Confidence            665544321          34444455555544444444432233444444443



>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 421
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-10
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 3e-07
d2omza2 384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 5e-06
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 3e-07
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 1e-05
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.001
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 3e-05
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 4e-05
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 9e-05
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 1e-04
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 1e-04
d1m9la_198 c.10.3.1 (A:) Outer arm dynein light chain 1 {Gree 1e-04
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 2e-04
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 0.001
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 2e-04
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 0.001
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 0.001
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 0.003
d2omxa2199 c.10.2.1 (A:37-235) Internalin B {Listeria monocyt 0.004
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 0.004
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]
 Score = 60.0 bits (144), Expect = 2e-10
 Identities = 33/168 (19%), Positives = 65/168 (38%), Gaps = 31/168 (18%)

Query: 130 ISLPQRNIQELPERLQCPNLQLFLLFRQGYGPVQISDLF-FEGTEELKVLSLIGIHFSSL 188
           +SL    ++++       NL    L        QIS+L    G  +L  L L     S++
Sbjct: 224 LSLNGNQLKDIGTLASLTNLTDLDLANN-----QISNLAPLSGLTKLTELKLGANQISNI 278

Query: 189 PSSLG---------------------RLINLQTLCLDWCQLEDVAAIGQLKKLEILNLAD 227
               G                      L NL  L L +  + D++ +  L KL+ L  A+
Sbjct: 279 SPLAGLTALTNLELNENQLEDISPISNLKNLTYLTLYFNNISDISPVSSLTKLQRLFFAN 338

Query: 228 SNIEQLPLEIGQLTGLRLLDLTNCWSLQVIAPNVISKLSRLEELYMDN 275
           + +  +   +  LT +  L   +   +  + P  ++ L+R+ +L +++
Sbjct: 339 NKVSDVS-SLANLTNINWLSAGHN-QISDLTP--LANLTRITQLGLND 382


>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Length = 198 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 199 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query421
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.85
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.85
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.84
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.84
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.8
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.78
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.78
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.77
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.76
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.74
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.71
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.71
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.7
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.69
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.68
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.67
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.63
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.62
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.56
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.54
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.5
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.5
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.48
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.46
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.45
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.41
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.39
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.39
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.27
d1z7xw1 460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.25
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.23
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.14
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.13
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 98.99
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.91
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.91
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.85
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.85
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.45
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.37
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.08
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 96.83
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]
Probab=99.85  E-value=1.6e-21  Score=176.84  Aligned_cols=246  Identities=14%  Similarity=0.104  Sum_probs=162.6

Q ss_pred             CccEEEeeecCCCCc--ccChHHhccCCCccEEEccC-CCCC-CCChhhhcccCCcEEEcccccCCC--cccccCcCCCC
Q 038338          148 NLQLFLLFRQGYGPV--QISDLFFEGTEELKVLSLIG-IHFS-SLPSSLGRLINLQTLCLDWCQLED--VAAIGQLKKLE  221 (421)
Q Consensus       148 ~L~~L~l~~~~~~~~--~~~~~~~~~l~~L~~L~l~~-~~~~-~lp~~i~~l~~L~~L~l~~~~~~~--~~~~~~l~~L~  221 (421)
                      +++.|+++++.. .+  .+|..+ +++++|++|++++ |.+. .+|++++++.+|++|++++|.+..  +..+..+.+|+
T Consensus        51 ~v~~L~L~~~~l-~g~~~lp~~l-~~L~~L~~L~Ls~~N~l~g~iP~~i~~L~~L~~L~Ls~N~l~~~~~~~~~~~~~L~  128 (313)
T d1ogqa_          51 RVNNLDLSGLNL-PKPYPIPSSL-ANLPYLNFLYIGGINNLVGPIPPAIAKLTQLHYLYITHTNVSGAIPDFLSQIKTLV  128 (313)
T ss_dssp             CEEEEEEECCCC-SSCEECCGGG-GGCTTCSEEEEEEETTEESCCCGGGGGCTTCSEEEEEEECCEEECCGGGGGCTTCC
T ss_pred             EEEEEECCCCCC-CCCCCCChHH-hcCccccccccccccccccccccccccccccchhhhccccccccccccccchhhhc
Confidence            566777777665 32  456654 6777888888775 5555 477777778888888888777766  56677777788


Q ss_pred             EEEeeCCCCc-ccchhhcCCCCCCEEeccCCcCCcccchhhhcCCCCC-cEEEcccCCCCCccccCCCCcChhhhcCCCC
Q 038338          222 ILNLADSNIE-QLPLEIGQLTGLRLLDLTNCWSLQVIAPNVISKLSRL-EELYMDNSFSGWEKVEGGSNASLVELKRLTK  299 (421)
Q Consensus       222 ~L~l~~~~l~-~lp~~~~~l~~L~~L~l~~~~~~~~~~~~~l~~l~~L-~~L~l~~~~~~~~~~~~~~~~~~~~l~~l~~  299 (421)
                      ++++++|.+. .+|..++.+++|+++++++|...+.+|.. +..+..+ +.+.++.|.+....+        ..++.+..
T Consensus       129 ~l~l~~N~~~~~~p~~l~~l~~L~~l~l~~n~l~~~ip~~-~~~l~~l~~~l~~~~n~l~~~~~--------~~~~~l~~  199 (313)
T d1ogqa_         129 TLDFSYNALSGTLPPSISSLPNLVGITFDGNRISGAIPDS-YGSFSKLFTSMTISRNRLTGKIP--------PTFANLNL  199 (313)
T ss_dssp             EEECCSSEEESCCCGGGGGCTTCCEEECCSSCCEEECCGG-GGCCCTTCCEEECCSSEEEEECC--------GGGGGCCC
T ss_pred             ccccccccccccCchhhccCcccceeeccccccccccccc-ccccccccccccccccccccccc--------cccccccc
Confidence            8888777555 66777777888888888776666666665 5666654 667777766554433        34444443


Q ss_pred             CCEEEEEecCcc-ccCCcc-cccCCceEEEEEcCCccchhhhhhchhhhceeEEEcCCcccccccchhHHHHhhhcccEE
Q 038338          300 LTTLEIEVRDAE-ILLPDF-VSVELQRYRIRIGDKLEYEIDQLLVKSEALRLMMLKGLEKVSILQENDGTKMLLQRTEDL  377 (421)
Q Consensus       300 L~~L~l~~~~~~-~~~~~~-~~~~L~~L~l~~~~~~~~~~~~~~~~l~~L~~L~l~~~~~~~~~~~~~~~~~~~~~L~~L  377 (421)
                      + .+++..+... .+|... ..++++.+++..+ .... .++.++.+++|+.|++++|++  ...+|++++++ ++|++|
T Consensus       200 ~-~l~l~~~~~~~~~~~~~~~~~~l~~l~~~~~-~l~~-~~~~~~~~~~L~~L~Ls~N~l--~g~iP~~l~~L-~~L~~L  273 (313)
T d1ogqa_         200 A-FVDLSRNMLEGDASVLFGSDKNTQKIHLAKN-SLAF-DLGKVGLSKNLNGLDLRNNRI--YGTLPQGLTQL-KFLHSL  273 (313)
T ss_dssp             S-EEECCSSEEEECCGGGCCTTSCCSEEECCSS-EECC-BGGGCCCCTTCCEEECCSSCC--EECCCGGGGGC-TTCCEE
T ss_pred             c-ccccccccccccccccccccccccccccccc-cccc-cccccccccccccccCccCee--cccCChHHhCC-CCCCEE
Confidence            3 4665555543 344443 3377777776533 2232 234567778888888888774  33567777777 888888


Q ss_pred             EeccccCcccccccccccCCCCCccEEEEeecCceee
Q 038338          378 WLVKLEGVQNVVHELDDGEGFPRLKHLHVESCYEIVH  414 (421)
Q Consensus       378 ~l~~~~~~~~~~~~~~~~~~~~~L~~L~i~~c~~L~~  414 (421)
                      ++++|...+.+|. .   .++++|+.+.+.+++.+..
T Consensus       274 ~Ls~N~l~g~iP~-~---~~L~~L~~l~l~~N~~l~g  306 (313)
T d1ogqa_         274 NVSFNNLCGEIPQ-G---GNLQRFDVSAYANNKCLCG  306 (313)
T ss_dssp             ECCSSEEEEECCC-S---TTGGGSCGGGTCSSSEEES
T ss_pred             ECcCCcccccCCC-c---ccCCCCCHHHhCCCccccC
Confidence            8888877666664 2   3678888888888876654



>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure