Citrus Sinensis ID: 038365

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------15
MVAGGQEFRMTEKQMVRHAQGLHNVDGDKNYKAYLSPEYFDAPVTQLGWQQGVHPCDKRRSISDYQFLFPAVDFSLIESDEDVLWKANVRETNEEVAARGLKFMNCMTGSDSSSTNYPGKIPSALDLPADIAERSHEKEDADTNSVDR
ccccccccEEEEEEEEEEccEEEEccccccccccccccccccccEEcccccccccccccccHHHHHHHccccEEccccccccccccccccccHHHHHHHHHHHHHcccccccccccccccccccccccHHHHHHHccccccccccccc
cccccccccEEEEEEEEcccccccccccccHHcccccccEEccccHcccccccccccccccHHHHHHHccccccccccccccccccccccccHHHHHHHHHHHHHHHHcccccccccccccccccccccHHHHHHHcccccccccccc
MVAGGQEFRMTEKQMVRHAQglhnvdgdknykaylspeyfdapvtqlgwqqgvhpcdkrrsisdyqflfpavdfsliesdEDVLWKANVRETNEEVAARGLKFmncmtgsdssstnypgkipsaldlpadiaershekedadtnsvdr
MVAGGQEFRMTEKQMVRHAQGLHNVDGDKNYKAYLSPEYFDAPVTQLGWQQGVHPCDKRRSISDYQFLFPAVDFSLIESDEDVLWKANVRETNEEVAARGLKFMNCMTGSDSSSTNYPGKIPSALDLPADIAershekedadtnsvdr
MVAGGQEFRMTEKQMVRHAQGLHNVDGDKNYKAYLSPEYFDAPVTQLGWQQGVHPCDKRRSISDYQFLFPAVDFSLIESDEDVLWKANVRETNEEVAARGLKFMNCMTGSDSSSTNYPGKIPSALDLPADIAERSHEKEDADTNSVDR
*********************LHNVDGDKNYKAYLSPEYFDAPVTQLGWQQGVHPCDKRRSISDYQFLFPAVDFSLIESDEDVLWKANVRETNEEVAARGLKFMNC******************************************
*********MTEKQMVRHAQGLHNVDGDKNYKAYLSPEYFDAPVTQLGWQQGVHPCDKRRSISDYQFLFPAVDFSLIESDEDVLWKANVRETNEEVAARGLKFMNCMTGSDSSSTNYPGKIPSALDL*********************
MVAGGQEFRMTEKQMVRHAQGLHNVDGDKNYKAYLSPEYFDAPVTQLGWQQGVHPCDKRRSISDYQFLFPAVDFSLIESDEDVLWKANVRETNEEVAARGLKFMNCMT********YPGKIPSALDLPADIAER**************
*****QEFRMTEKQMVRHAQGLHNVDGDKNYKAYLSPEYFDAPVTQLGWQQGVHPCDKRRSISDYQFLFPAVDFSLIESDEDVLWKANVRETNEEVAARGLKFMNCMTGSDSSSTNYP*K*PS*LDLPADIAERS*************
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVAGGQEFRMTEKQMVRHAQGLHNVDGDKNYKAYLSPEYFDAPVTQLGWQQGVHPCDKRRSISDYQFLFPAVDFSLIESDEDVLWKANVRETNEEVAARGLKFMNCMTGSDSSSTNYPGKIPSALDLPADIAERSHEKEDADTNSVDR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

No hits with e-value below 0.001 by BLAST

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query148
359475590 332 PREDICTED: uncharacterized protein LOC10 0.594 0.265 0.531 2e-30
296088089 287 unnamed protein product [Vitis vinifera] 0.594 0.306 0.517 4e-29
147866249 262 hypothetical protein VITISV_026200 [Viti 0.885 0.5 0.380 1e-28
449459558 356 PREDICTED: uncharacterized protein LOC10 0.601 0.25 0.479 1e-26
118486741 281 unknown [Populus trichocarpa] 0.554 0.291 0.474 2e-25
359492982 335 PREDICTED: uncharacterized protein LOC10 0.628 0.277 0.452 3e-25
351721195 284 phosphoglycerate mutase-like protein [Gl 0.574 0.299 0.442 6e-25
255645719200 unknown [Glycine max] 0.574 0.425 0.442 9e-25
413917827244 hypothetical protein ZEAMMB73_693025 [Ze 0.594 0.360 0.563 1e-24
356519489 324 PREDICTED: uncharacterized protein C5H10 0.574 0.262 0.452 1e-24
>gi|359475590|ref|XP_002264303.2| PREDICTED: uncharacterized protein LOC100257829 [Vitis vinifera] Back     alignment and taxonomy information
 Score =  137 bits (344), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 76/143 (53%), Positives = 81/143 (56%), Gaps = 55/143 (38%)

Query: 52  GVHPCDKRRSISDYQFLFPAVDFSLIESDEDVLWKANVRETNEEVAARGLKFM------- 104
           GVHPCDKRRSISDYQFLFPA+DFSLIESDED+LWKANVRETNEEVAARGLKFM       
Sbjct: 183 GVHPCDKRRSISDYQFLFPAIDFSLIESDEDILWKANVRETNEEVAARGLKFMNWLWTRK 242

Query: 105 -------------------------------------NC-----------MTGSDSSSTN 116
                                                NC           M GSDSS+TN
Sbjct: 243 EKEIAIVTHSGFLFHTLNAFGNDCHPLVKTEICKHFANCELRSMIIVDRSMAGSDSSTTN 302

Query: 117 YPGKIPSALDLPADIAERSHEKE 139
           YPGKIP  LDLP+DIA+   E E
Sbjct: 303 YPGKIPPGLDLPSDIADGKLENE 325

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|296088089|emb|CBI35448.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|147866249|emb|CAN82045.1| hypothetical protein VITISV_026200 [Vitis vinifera] Back     alignment and taxonomy information
>gi|449459558|ref|XP_004147513.1| PREDICTED: uncharacterized protein LOC101216588 [Cucumis sativus] gi|449511380|ref|XP_004163940.1| PREDICTED: uncharacterized LOC101216588 [Cucumis sativus] Back     alignment and taxonomy information
>gi|118486741|gb|ABK95206.1| unknown [Populus trichocarpa] Back     alignment and taxonomy information
>gi|359492982|ref|XP_002285596.2| PREDICTED: uncharacterized protein LOC100265997 [Vitis vinifera] gi|302142108|emb|CBI19311.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|351721195|ref|NP_001237969.1| phosphoglycerate mutase-like protein [Glycine max] gi|21700765|gb|AAG38144.1| phosphoglycerate mutase-like protein [Glycine max] Back     alignment and taxonomy information
>gi|255645719|gb|ACU23353.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|413917827|gb|AFW57759.1| hypothetical protein ZEAMMB73_693025 [Zea mays] Back     alignment and taxonomy information
>gi|356519489|ref|XP_003528405.1| PREDICTED: uncharacterized protein C5H10.03-like [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query148
TAIR|locus:2179381282 AT5G64460 "AT5G64460" [Arabido 0.364 0.191 0.851 1.5e-45
TAIR|locus:2016640343 AT1G58280 [Arabidopsis thalian 0.391 0.169 0.603 3.3e-37
TAIR|locus:2827577271 AT2G17280 "AT2G17280" [Arabido 0.358 0.195 0.641 3.1e-35
TAIR|locus:504956275231 AT1G09935 [Arabidopsis thalian 0.371 0.238 0.6 4.9e-24
TAIR|locus:1005716755260 AT1G09932 "AT1G09932" [Arabido 0.371 0.211 0.527 1.5e-17
ASPGD|ASPL0000072665329 AN4653 [Emericella nidulans (t 0.513 0.231 0.337 0.00023
TAIR|locus:2179381 AT5G64460 "AT5G64460" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 244 (91.0 bits), Expect = 1.5e-45, Sum P(3) = 1.5e-45
 Identities = 46/54 (85%), Positives = 51/54 (94%)

Query:    52 GVHPCDKRRSISDYQFLFPAVDFSLIESDEDVLWKANVRETNEEVAARGLKFMN 105
             GVHPCD+RRSISDYQFLFPAVDFSLIES+ED LWKA+VRET EE+AARG KF+N
Sbjct:   138 GVHPCDQRRSISDYQFLFPAVDFSLIESEEDKLWKADVRETIEELAARGKKFLN 191
GO:0003674 "molecular_function" evidence=ND
GO:0008150 "biological_process" evidence=ND
GO:0005829 "cytosol" evidence=IDA
GO:0009736 "cytokinin mediated signaling pathway" evidence=RCA
TAIR|locus:2016640 AT1G58280 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2827577 AT2G17280 "AT2G17280" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:504956275 AT1G09935 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:1005716755 AT1G09932 "AT1G09932" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
ASPGD|ASPL0000072665 AN4653 [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 148
KOG4754248 consensus Predicted phosphoglycerate mutase [Carbo 99.93
PRK14116228 gpmA phosphoglyceromutase; Provisional 99.89
PRK13463203 phosphatase PhoE; Provisional 99.88
PRK14119228 gpmA phosphoglyceromutase; Provisional 99.88
PRK14117230 gpmA phosphoglyceromutase; Provisional 99.88
PRK13462203 acid phosphatase; Provisional 99.88
PRK03482215 phosphoglycerate mutase; Provisional 99.87
PRK01112228 phosphoglyceromutase; Provisional 99.87
COG0406208 phoE Broad specificity phosphatase PhoE and relate 99.86
PRK14118227 gpmA phosphoglyceromutase; Provisional 99.85
PRK15004199 alpha-ribazole phosphatase; Provisional 99.85
PRK01295206 phosphoglyceromutase; Provisional 99.84
TIGR03848204 MSMEG_4193 probable phosphomutase, MSMEG_4193 fami 99.84
PRK14120249 gpmA phosphoglyceromutase; Provisional 99.83
PRK14115247 gpmA phosphoglyceromutase; Provisional 99.82
TIGR01258245 pgm_1 phosphoglycerate mutase, BPG-dependent, fami 99.82
TIGR03162177 ribazole_cobC alpha-ribazole phosphatase. Members 99.81
PRK07238372 bifunctional RNase H/acid phosphatase; Provisional 99.81
smart00855155 PGAM Phosphoglycerate mutase family. Phosphoglycer 99.78
PF00300158 His_Phos_1: Histidine phosphatase superfamily (bra 99.77
PTZ00322664 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas 99.75
KOG0235214 consensus Phosphoglycerate mutase [Carbohydrate tr 99.7
cd07067153 HP_PGM_like Histidine phosphatase domain found in 99.43
PTZ00122299 phosphoglycerate mutase; Provisional 99.37
COG0588230 GpmA Phosphoglycerate mutase 1 [Carbohydrate trans 99.36
PTZ00123236 phosphoglycerate mutase like-protein; Provisional 99.35
cd07040153 HP Histidine phosphatase domain found in a functio 99.28
PRK06193206 hypothetical protein; Provisional 99.24
TIGR00249152 sixA phosphohistidine phosphatase SixA. 98.97
PRK10848159 phosphohistidine phosphatase; Provisional 98.84
KOG0234438 consensus Fructose-6-phosphate 2-kinase/fructose-2 98.84
PRK15416201 lipopolysaccharide core heptose(II)-phosphate phos 98.56
COG2062163 SixA Phosphohistidine phosphatase SixA [Signal tra 98.13
KOG3734272 consensus Predicted phosphoglycerate mutase [Carbo 97.92
KOG4609284 consensus Predicted phosphoglycerate mutase [Gener 97.88
>KOG4754 consensus Predicted phosphoglycerate mutase [Carbohydrate transport and metabolism] Back     alignment and domain information 
Probab=99.93  E-value=6e-26  Score=177.63  Aligned_cols=117  Identities=44%  Similarity=0.744  Sum_probs=108.5

Q ss_pred             CCccceEEEEeeCCcccccccCCcccccccCCCccCCCCChhhhhc----------------------------------
Q 038365            6 QEFRMTEKQMVRHAQGLHNVDGDKNYKAYLSPEYFDAPVTQLGWQQ----------------------------------   51 (148)
Q Consensus         6 ~~~~mk~iyLvRHGeT~~N~~~r~~~~~y~~qg~~D~pLTe~G~~Q----------------------------------   51 (148)
                      +....|+||||||||+.||+++..+|..||+.-|+||.||++|++|                                  
T Consensus        10 t~~r~KtiyLvRHgQg~HNV~g~~~h~ay~s~~~fD~~LTplG~~Qv~~l~~~~~A~qL~~~ieliv~SPMrRtLqT~v~   89 (248)
T KOG4754|consen   10 TKNRCKTIYLVRHGQGIHNVAGEEDHKAYWSEDYFDPHLTPLGWKQVDNLRKHLMAKQLPNKIELIVVSPMRRTLQTMVI   89 (248)
T ss_pred             ccCcceEEEEEeccccccccCcccchhhhhhhhccccccCHHHHHHHHHHhhhhhhhhcCCceeEEEechHHHHHHHHHH
Confidence            4556899999999999999999999999999999999999999999                                  


Q ss_pred             ------------------------------ccccCCCCCCHHHHHHhCCCCCcCCcccCCCccccCCCCCCHHHHHHHHH
Q 038365           52 ------------------------------GVHPCDKRRSISDYQFLFPAVDFSLIESDEDVLWKANVRETNEEVAARGL  101 (148)
Q Consensus        52 ------------------------------~~~~~d~~r~~~~i~~~fp~~~f~~~~~~~d~~w~~~~gEs~~~v~~Rv~  101 (148)
                                                    |.++||+|+....+.+.||.+||+....+.++.|++.-+|+.++.+.|-+
T Consensus        90 ~f~~~~~e~g~~~~p~~vsp~~i~~~rE~lG~hpCD~r~~v~~~~~lfp~~DFs~~~~dv~~~~~pdy~ed~e~~a~r~r  169 (248)
T KOG4754|consen   90 AFGGYLAEDGEDPAPVKVSPPFIAVCRETLGDHPCDRRSSVTDLMKLFPAYDFSLCETDVDPLKKPDYREDDEESAARSR  169 (248)
T ss_pred             HhcceeccCCCcCCceeecchHHHHHHHHhCCCcccccchhHHHHhhcccccceeeccCcchhccCcchhhHHHHHHhHH
Confidence                                          56899999999999999999999988777889999999999999999999


Q ss_pred             HHHHHHHcCCC---Ceeecccccc
Q 038365          102 KFMNCMTGSDS---SSTNYPGKIP  122 (148)
Q Consensus       102 ~fl~~i~~~~~---~vVsHgg~I~  122 (148)
                      +|+++|....+   .||+|+|.|+
T Consensus       170 e~~~~l~~r~ek~iavvths~fl~  193 (248)
T KOG4754|consen  170 EFLEWLAKRPEKEIAVVTHSGFLR  193 (248)
T ss_pred             HHHHHHHhCccceEEEEEehHHHH
Confidence            99999998765   5799999996

>PRK14116 gpmA phosphoglyceromutase; Provisional Back     alignment and domain information
>PRK13463 phosphatase PhoE; Provisional Back     alignment and domain information
>PRK14119 gpmA phosphoglyceromutase; Provisional Back     alignment and domain information
>PRK14117 gpmA phosphoglyceromutase; Provisional Back     alignment and domain information
>PRK13462 acid phosphatase; Provisional Back     alignment and domain information
>PRK03482 phosphoglycerate mutase; Provisional Back     alignment and domain information
>PRK01112 phosphoglyceromutase; Provisional Back     alignment and domain information
>COG0406 phoE Broad specificity phosphatase PhoE and related phosphatases [General function prediction only] Back     alignment and domain information
>PRK14118 gpmA phosphoglyceromutase; Provisional Back     alignment and domain information
>PRK15004 alpha-ribazole phosphatase; Provisional Back     alignment and domain information
>PRK01295 phosphoglyceromutase; Provisional Back     alignment and domain information
>TIGR03848 MSMEG_4193 probable phosphomutase, MSMEG_4193 family Back     alignment and domain information
>PRK14120 gpmA phosphoglyceromutase; Provisional Back     alignment and domain information
>PRK14115 gpmA phosphoglyceromutase; Provisional Back     alignment and domain information
>TIGR01258 pgm_1 phosphoglycerate mutase, BPG-dependent, family 1 Back     alignment and domain information
>TIGR03162 ribazole_cobC alpha-ribazole phosphatase Back     alignment and domain information
>PRK07238 bifunctional RNase H/acid phosphatase; Provisional Back     alignment and domain information
>smart00855 PGAM Phosphoglycerate mutase family Back     alignment and domain information
>PF00300 His_Phos_1: Histidine phosphatase superfamily (branch 1); InterPro: IPR013078 The histidine phosphatase superfamily is so named because catalysis centres on a conserved His residue that is transiently phosphorylated during the catalytic cycle Back     alignment and domain information
>PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>KOG0235 consensus Phosphoglycerate mutase [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd07067 HP_PGM_like Histidine phosphatase domain found in phosphoglycerate mutases and related proteins, mostly phosphatases; contains a His residue which is phosphorylated during the reaction Back     alignment and domain information
>PTZ00122 phosphoglycerate mutase; Provisional Back     alignment and domain information
>COG0588 GpmA Phosphoglycerate mutase 1 [Carbohydrate transport and metabolism] Back     alignment and domain information
>PTZ00123 phosphoglycerate mutase like-protein; Provisional Back     alignment and domain information
>cd07040 HP Histidine phosphatase domain found in a functionally diverse set of proteins, mostly phosphatases; contains a His residue which is phosphorylated during the reaction Back     alignment and domain information
>PRK06193 hypothetical protein; Provisional Back     alignment and domain information
>TIGR00249 sixA phosphohistidine phosphatase SixA Back     alignment and domain information
>PRK10848 phosphohistidine phosphatase; Provisional Back     alignment and domain information
>KOG0234 consensus Fructose-6-phosphate 2-kinase/fructose-2,6-biphosphatase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK15416 lipopolysaccharide core heptose(II)-phosphate phosphatase; Provisional Back     alignment and domain information
>COG2062 SixA Phosphohistidine phosphatase SixA [Signal transduction mechanisms] Back     alignment and domain information
>KOG3734 consensus Predicted phosphoglycerate mutase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG4609 consensus Predicted phosphoglycerate mutase [General function prediction only] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

No hit with e-value below 0.005

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query148
3r7a_A237 Phosphoglycerate mutase, putative; structural geno 99.88
1h2e_A207 Phosphatase, YHFR; hydrolase, broad specificity ph 99.86
4emb_A274 2,3-bisphosphoglycerate-dependent phosphoglycerat; 99.86
3gp3_A257 2,3-bisphosphoglycerate-dependent phosphoglycerat; 99.86
3hjg_A213 Putative alpha-ribazole-5'-phosphate phosphatase C 99.86
1e58_A249 Phosphoglycerate mutase; phosphohistidine, glycoly 99.86
1yfk_A262 Phosphoglycerate mutase 1; alpha/beta, isomerase, 99.85
3kkk_A258 Phosphoglycerate mutase; PGAM, glycolysis, malaria 99.85
3f3k_A265 Uncharacterized protein YKR043C; structural genomi 99.85
1fzt_A211 Phosphoglycerate mutase; open B-sheet-helices, iso 99.85
3d8h_A267 Glycolytic phosphoglycerate mutase; structural gen 99.85
2hhj_A267 Bisphosphoglycerate mutase; isomerase; HET: NEP DG 99.85
1v37_A177 Phosphoglycerate mutase; riken structu genomics/pr 99.85
1rii_A265 2,3-bisphosphoglycerate-dependent phosphoglycerat; 99.84
1qhf_A240 Protein (phosphoglycerate mutase); transferase (ph 99.83
2qni_A219 AGR_C_517P, uncharacterized protein ATU0299; MCSG, 99.83
3e9c_A265 ZGC:56074; histidine phosphatase, hydrolase; 2.00A 99.83
3dcy_A275 Regulator protein; OMIM 610775, C12ORF5, tigar, TP 99.83
2a6p_A208 Possible phosphoglycerate mutase GPM2; predicted p 99.82
4eo9_A268 2,3-bisphosphoglycerate-dependent phosphoglycerat; 99.82
3c7t_A263 Ecdysteroid-phosphate phosphatase; ecdysone, 2H-ph 99.79
3d4i_A273 STS-2 protein; PGM, 2H-phosphatase, PTP, SH3 domai 99.78
3eoz_A214 Putative phosphoglycerate mutase; PGAM, malaria, s 99.76
1bif_A469 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; 99.75
2axn_A 520 6-phosphofructo-2-kinase/fructose-2,6- biphosphata 99.73
3mxo_A202 Serine/threonine-protein phosphatase PGAM5, mitoc; 99.68
3mbk_A264 Ubiquitin-associated and SH3 domain-containing PR; 99.68
1ujc_A161 Phosphohistidine phosphatase SIXA; alpha-beta fold 99.63
2rfl_A173 Putative phosphohistidine phosphatase SIXA; alpha- 99.58
3fjy_A364 Probable MUTT1 protein; dimer, protein structure i 99.26
3f2i_A172 ALR0221 protein; alpha-beta protein, structural ge 99.13
4hbz_A186 Putative phosphohistidine phosphatase, SIXA; struc 98.66
>3r7a_A Phosphoglycerate mutase, putative; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE EPE; 1.84A {Bacillus anthracis} Back     alignment and structure
Probab=99.88  E-value=2.1e-23  Score=162.65  Aligned_cols=114  Identities=15%  Similarity=0.206  Sum_probs=87.5

Q ss_pred             CCCCccceEEEEeeCCcccccccCCcccccccCCCccCCCCChhhhhc--------------ccccCCCCCCHHHHHHh-
Q 038365            4 GGQEFRMTEKQMVRHAQGLHNVDGDKNYKAYLSPEYFDAPVTQLGWQQ--------------GVHPCDKRRSISDYQFL-   68 (148)
Q Consensus         4 ~~~~~~mk~iyLvRHGeT~~N~~~r~~~~~y~~qg~~D~pLTe~G~~Q--------------~~~~~d~~r~~~~i~~~-   68 (148)
                      +.+...|++|||||||||.||..++.       +|+.|+|||+.|++|              .+++|+..|++++++.. 
T Consensus         7 ~~~~~~~~~l~lvRHGet~~n~~~~~-------~G~~D~pLt~~G~~qA~~l~~~l~~~~~~~i~sSpl~Ra~qTA~~i~   79 (237)
T 3r7a_A            7 RETDSNVVTLYVTRHGKTILNTNHRA-------QGWADSPLVEKGVEVATNLGTGLKDIHFMNAYSSDSGRAIETANLVL   79 (237)
T ss_dssp             CTTTTCEEEEEEEECCCBHHHHTTBC-------CSSCCCCBCHHHHHHHHHHHHHTTTSCEEEEEECSCHHHHHHHHHHH
T ss_pred             ccccCCceEEEEEeCCcccccccccc-------cCCCCCCcCHHHHHHHHHHHHHhcCCCCCEEEECCcHHHHHHHHHHH
Confidence            45577889999999999999999875       899999999999999              47899999999877632 


Q ss_pred             ---------------CCCCCcCCcccC-----------------CCcc----------c-----cCCCCCCHHHHHHHHH
Q 038365           69 ---------------FPAVDFSLIESD-----------------EDVL----------W-----KANVRETNEEVAARGL  101 (148)
Q Consensus        69 ---------------fp~~~f~~~~~~-----------------~d~~----------w-----~~~~gEs~~~v~~Rv~  101 (148)
                                     +-|++|+.+...                 .+.+          |     .+++|||+.++.+|+.
T Consensus        80 ~~~~~~~~~~~~~~~L~E~~~G~~eg~~~~e~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~gEs~~~~~~R~~  159 (237)
T 3r7a_A           80 KYSEQSKLKLEQRKKLRELNFGIFEGEKLDNMWDAVGKAAGVTSPEELLKFSIQEVIDLIRAADPTKQAEDWELFSTRIK  159 (237)
T ss_dssp             HHTTCTTSCEEECGGGCCCCCGGGTTSBHHHHHHHHHHHHTCSSGGGGGGSCHHHHHHHHHHHCTTCCSCCHHHHHHHHH
T ss_pred             HhcccCCCCeeeCCCCcccCcchhcCCCHHHHHHHhhhhcCCCCHHHHHHhhhhhhhHHHhhcCCCCCCCCHHHHHHHHH
Confidence                           124455433110                 0111          1     3478999999999999


Q ss_pred             HHHHHHHcC---C--C--CeeecccccccC
Q 038365          102 KFMNCMTGS---D--S--SSTNYPGKIPSA  124 (148)
Q Consensus       102 ~fl~~i~~~---~--~--~vVsHgg~I~~~  124 (148)
                      .+|++|..+   +  .  .|||||++|+++
T Consensus       160 ~~l~~l~~~~~~~~~~~vlvVsHg~~i~~l  189 (237)
T 3r7a_A          160 AEIDKISEEAAKDGGGNVLVVVHGLLITTL  189 (237)
T ss_dssp             HHHHHHHHHHHHTTCEEEEEEECHHHHHHH
T ss_pred             HHHHHHHHHhhcCCCCeEEEEcCHHHHHHH
Confidence            999999864   2  2  469999999854
>1h2e_A Phosphatase, YHFR; hydrolase, broad specificity phosphatase, DPGM homolog; 1.69A {Bacillus stearothermophilus} SCOP: c.60.1.1 PDB: 1h2f_A* 1ebb_A Back     alignment and structure
>4emb_A 2,3-bisphosphoglycerate-dependent phosphoglycerat; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.30A {Borrelia burgdorferi} Back     alignment and structure
>3gp3_A 2,3-bisphosphoglycerate-dependent phosphoglycerat; phosphoglyceromutase, decode, SBRI, niaid, UWPPG, glycolysis isomerase; HET: PG4 SEP; 1.50A {Burkholderia pseudomallei} SCOP: c.60.1.1 PDB: 3fdz_A* 3ezn_A* 3gp5_A* 3gw8_A* 3lnt_A Back     alignment and structure
>3hjg_A Putative alpha-ribazole-5'-phosphate phosphatase COBC; PSI-2, NYSGXRC, structural genomics, protein structure initiative; 2.80A {Vibrio parahaemolyticus} Back     alignment and structure
>1e58_A Phosphoglycerate mutase; phosphohistidine, glycolysis and gluconeogenesis, isomerase; HET: NEP; 1.25A {Escherichia coli} SCOP: c.60.1.1 PDB: 1e59_A* Back     alignment and structure
>1yfk_A Phosphoglycerate mutase 1; alpha/beta, isomerase, hydrolase; HET: CIT; 2.70A {Homo sapiens} PDB: 1yjx_A* Back     alignment and structure
>3kkk_A Phosphoglycerate mutase; PGAM, glycolysis, malaria, structural genomics, medical STRU genomics of pathogenic protozoa, MSGPP; 2.08A {Plasmodium falciparum 3D7} PDB: 1xq9_A Back     alignment and structure
>3f3k_A Uncharacterized protein YKR043C; structural genomics,, PSI-2, prote structure initiative; 1.75A {Saccharomyces cerevisiae} PDB: 3lg2_A 3oi7_A* 3ll4_A* Back     alignment and structure
>1fzt_A Phosphoglycerate mutase; open B-sheet-helices, isomerase; NMR {Schizosaccharomyces pombe} SCOP: c.60.1.1 Back     alignment and structure
>3d8h_A Glycolytic phosphoglycerate mutase; structural genomics, malaria, glycolysis, I structural genomics consortium, SGC; 2.01A {Cryptosporidium parvum} Back     alignment and structure
>2hhj_A Bisphosphoglycerate mutase; isomerase; HET: NEP DG2 3PG; 1.50A {Homo sapiens} SCOP: c.60.1.1 PDB: 1t8p_A* 2f90_A* 2a9j_A* 2h4z_A* 2h52_A* 2h4x_A* 3nfy_A Back     alignment and structure
>1v37_A Phosphoglycerate mutase; riken structu genomics/proteomics initiative, RSGI, structural genomics,; 1.40A {Thermus thermophilus} SCOP: c.60.1.1 PDB: 1v7q_A 2hia_A 2pa0_A 2p2y_A 2p77_A 2p6m_A 2p9y_A 2p30_A 2ekz_A 2p9f_A 2p79_A 2p78_A 2p2z_A 2p75_A 2owe_A 2enu_A 2ekb_A 2p6o_A 2owd_A 2enw_A ... Back     alignment and structure
>1rii_A 2,3-bisphosphoglycerate-dependent phosphoglycerat; phosphoglyerate mutase, SH3 domain binding, structural genom TBSGC; 1.70A {Mycobacterium tuberculosis} SCOP: c.60.1.1 Back     alignment and structure
>1qhf_A Protein (phosphoglycerate mutase); transferase (phosphoryl); HET: 3PG; 1.70A {Saccharomyces cerevisiae} SCOP: c.60.1.1 PDB: 5pgm_D 1bq3_D* 1bq4_D 4pgm_A 3pgm_A* Back     alignment and structure
>2qni_A AGR_C_517P, uncharacterized protein ATU0299; MCSG, in SITU proteolysis, structural genomics, PSI protein structure initiative; 1.80A {Agrobacterium tumefaciens str} Back     alignment and structure
>3e9c_A ZGC:56074; histidine phosphatase, hydrolase; 2.00A {Danio rerio} PDB: 3e9d_A 3e9e_A Back     alignment and structure
>3dcy_A Regulator protein; OMIM 610775, C12ORF5, tigar, TP53-induced glycolysis and apoptosis regulator, CAsp target, structural genomics medical relevance; HET: MSE; 1.75A {Homo sapiens} Back     alignment and structure
>2a6p_A Possible phosphoglycerate mutase GPM2; predicted phosphoglycerate mutase, structural genomics, PSI, structure initiative; 2.20A {Mycobacterium tuberculosis} Back     alignment and structure
>4eo9_A 2,3-bisphosphoglycerate-dependent phosphoglycerat; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.45A {Mycobacterium leprae} Back     alignment and structure
>3c7t_A Ecdysteroid-phosphate phosphatase; ecdysone, 2H-phosphatase, PGM, hydrolase; 1.76A {Bombyx mori} Back     alignment and structure
>3d4i_A STS-2 protein; PGM, 2H-phosphatase, PTP, SH3 domain, hydrolase; 1.95A {Mus musculus} PDB: 3d6a_A 3db1_A Back     alignment and structure
>3eoz_A Putative phosphoglycerate mutase; PGAM, malaria, structural genomics, isomerase, structural GE consortium, SGC; 2.40A {Plasmodium falciparum} Back     alignment and structure
>1bif_A 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; transferase (phospho), phosphatase, hydrolase (phosp glycolysis, bifunctional enzyme; HET: AGS; 2.00A {Rattus norvegicus} SCOP: c.37.1.7 c.60.1.4 PDB: 3bif_A* 2bif_A* 1k6m_A* 1c80_A* 1c7z_A* 1c81_A* 1tip_A* 1fbt_A Back     alignment and structure
>2axn_A 6-phosphofructo-2-kinase/fructose-2,6- biphosphatase 3 (6PF-2-K/FRU- 2,6-P2ASE brain/placenta-type...; bifunctional enzyme, EDTA complex; HET: F6P EDT ADP; 2.10A {Homo sapiens} PDB: 2dwo_A* 2dwp_A* 2i1v_B* 3qpu_A* 3qpv_A* 3qpw_A* Back     alignment and structure
>3mxo_A Serine/threonine-protein phosphatase PGAM5, mitoc; phosphoglycerate mutase family member 5, BXLBV68, MGC protein, structural genomics consortium; HET: PG4 PGE PEG; 1.70A {Homo sapiens} PDB: 3o0t_A Back     alignment and structure
>3mbk_A Ubiquitin-associated and SH3 domain-containing PR; PGM, STS-1, signaling protein, low PH, alternative splicing, cytoplasm, nucleus, phosphoprotein; 1.35A {Mus musculus} PDB: 2ikq_A 2h0q_A Back     alignment and structure
>1ujc_A Phosphohistidine phosphatase SIXA; alpha-beta fold, hydrolase; 1.90A {Escherichia coli} PDB: 1ujb_A Back     alignment and structure
>2rfl_A Putative phosphohistidine phosphatase SIXA; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; 2.35A {Agrobacterium tumefaciens str} Back     alignment and structure
>3fjy_A Probable MUTT1 protein; dimer, protein structure initiative II), NYSGXRC, 11181H, structural genomics; 2.15A {Bifidobacterium adolescentis atcc 1570ORGANISM_TAXID} Back     alignment and structure
>3f2i_A ALR0221 protein; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG, function; 2.00A {Nostoc SP} Back     alignment and structure
>4hbz_A Putative phosphohistidine phosphatase, SIXA; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, HP_PGM_LIKE; HET: PGE; 1.55A {Nakamurella multipartita} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query148
d1h2ea_207 Broad specificity phosphatase PhoE (YhfR) {Bacillu 99.9
d1v37a_171 Alpha-ribazole-5'-phosphate phosphatase {Thermus t 99.89
d1e58a_247 Phosphoglycerate mutase {Escherichia coli [TaxId: 99.89
d1fzta_211 Phosphoglycerate mutase {Fission yeast (Schizosacc 99.88
d1riia_243 Phosphoglycerate mutase {Mycobacterium tuberculosi 99.87
d1xq9a_241 Phosphoglycerate mutase {Plasmodium falciparum [Ta 99.87
d2hhja1248 Phosphoglycerate mutase {Human (Homo sapiens) [Tax 99.86
d1bifa2219 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata 99.85
d1qhfa_240 Phosphoglycerate mutase {Baker's yeast (Saccharomy 99.82
>d1h2ea_ c.60.1.1 (A:) Broad specificity phosphatase PhoE (YhfR) {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Phosphoglycerate mutase-like
superfamily: Phosphoglycerate mutase-like
family: Cofactor-dependent phosphoglycerate mutase
domain: Broad specificity phosphatase PhoE (YhfR)
species: Bacillus stearothermophilus [TaxId: 1422]

Probab=99.90  E-value=4.4e-25  Score=167.25  Aligned_cols=106  Identities=16%  Similarity=0.231  Sum_probs=83.6

Q ss_pred             eEEEEeeCCcccccccCCcccccccCCCccCCCCChhhhhc--------------ccccCCCCCCHHHHHHh--------
Q 038365           11 TEKQMVRHAQGLHNVDGDKNYKAYLSPEYFDAPVTQLGWQQ--------------GVHPCDKRRSISDYQFL--------   68 (148)
Q Consensus        11 k~iyLvRHGeT~~N~~~r~~~~~y~~qg~~D~pLTe~G~~Q--------------~~~~~d~~r~~~~i~~~--------   68 (148)
                      ++|||||||||.||+.++.       +|+.|+|||++|++|              .+++|+..|++++++..        
T Consensus         2 tti~lvRHGet~~n~~~~~-------~G~~D~~Lt~~G~~QA~~~~~~l~~~~~~~i~sSpl~Ra~qTa~~i~~~~~~~~   74 (207)
T d1h2ea_           2 TTLYLTRHGETKWNVERRM-------QGWQDSPLTEKGRQDAMRLGKRLEAVELAAIYTSTSGRALETAEIVRGGRLIPI   74 (207)
T ss_dssp             EEEEEEECCCBHHHHTTBC-------CTTSCCCBCHHHHHHHHHHHHHTTTSCCSEEEECSSHHHHHHHHHHHTTCSCCE
T ss_pred             cEEEEEeCCCCCccccCcc-------cCCCCCCCCHHHHHHHHHHHhhhhccccceeecCccHHHHHHHhhhcccccccc
Confidence            7899999999999999875       799999999999999              47889999999887632        


Q ss_pred             -----CCCCCcCCccc------------------CCCccccCCCCCCHHHHHHHHHHHHHHHHcCCC----Ceeeccccc
Q 038365           69 -----FPAVDFSLIES------------------DEDVLWKANVRETNEEVAARGLKFMNCMTGSDS----SSTNYPGKI  121 (148)
Q Consensus        69 -----fp~~~f~~~~~------------------~~d~~w~~~~gEs~~~v~~Rv~~fl~~i~~~~~----~vVsHgg~I  121 (148)
                           +.|++|+.+..                  +.+..|.+++|||+.++..|+..|+++|.+.+.    .|||||++|
T Consensus        75 ~~~~~L~E~~~g~~~g~~~~e~~~~~~~~~~~~~~~~~~~~~~~gEs~~~~~~Rv~~~l~~l~~~~~~~~vlvVsHg~~i  154 (207)
T d1h2ea_          75 YQDERLREIHLGDWEGKTHDEIRQMDPIAFDHFWQAPHLYAPQRGERFCDVQQRALEAVQSIVDRHEGETVLIVTHGVVL  154 (207)
T ss_dssp             EECGGGSCCCCGGGTTCBHHHHHHHCHHHHHHHHHCGGGCCCSSSCCHHHHHHHHHHHHHHHHHHCTTCEEEEEECHHHH
T ss_pred             cccccccccCCCcccccccccccccccccccccccCCccccccCCcccccccccchhHHHhhhhccCCCeEEEEECHHHH
Confidence                 23444443210                  112345667999999999999999999986542    369999999


Q ss_pred             cc
Q 038365          122 PS  123 (148)
Q Consensus       122 ~~  123 (148)
                      ++
T Consensus       155 ~~  156 (207)
T d1h2ea_         155 KT  156 (207)
T ss_dssp             HH
T ss_pred             HH
Confidence            74
>d1v37a_ c.60.1.1 (A:) Alpha-ribazole-5'-phosphate phosphatase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1e58a_ c.60.1.1 (A:) Phosphoglycerate mutase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fzta_ c.60.1.1 (A:) Phosphoglycerate mutase {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1riia_ c.60.1.1 (A:) Phosphoglycerate mutase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1xq9a_ c.60.1.1 (A:) Phosphoglycerate mutase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d2hhja1 c.60.1.1 (A:3-250) Phosphoglycerate mutase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bifa2 c.60.1.4 (A:250-468) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, phosphatase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1qhfa_ c.60.1.1 (A:) Phosphoglycerate mutase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure