Citrus Sinensis ID: 038410

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850
MRVAVIGGGMSGLVSAYVLAKAGVEVVLYEKEDSLGGHAKTVTIDGVDLDIGFMLFNHVEYPNMMEFLESLGVDMGTSDMSFSVSLDKGQGYEWGTRNGLSSLFAQKKNVLNPYFWQMLREMMKFKDDVLSYVEELENSPDIDRNETLGHFIKSRGYSELFLKAYLIPICSSVWSCPSDGAMRFSAFSVLSFCRLFQLFGHPQCVTVRRHSHSQIDKVSEQLKSWGIQIRMSCEVYSVFPADEGCSIVCVNGSQEFYNGCVMAVHAPDALRILGNQATFDETRILGAFRYVYRDVFLHRDKNFMPQNPAAWSAWNFVGSTNGKICLTYCLNVLQNIGETSMPFLATLNPDRTPQNTLLKWSTGHSVPSVAASKASLELHLIQGKRGIWYSGVDQGYGFPEDGLKVGMIAAHGVLGKSCAILGNPKQMVPSLMEKGARLFVARFLRQFISTGCFILLEEGGKTFTFEGPRTNCPLKSDLRIQNPQFYWKVMTQADLGLANSYINGDFSFIDKDEGLLNLFLIVIANQGLDSSTSKLNLRSIASAKYYFRHISRKNTLAQARRNISHHYDVSNELFSLFLGKSMMYSCAIFKSEYEDLDVAQMRKVSLLIEKARVNKGLDVLEIGCGWGTLAIEIVKQTGCKYTGITLSEEQLKYTETKVKEAGLQDHIRLYLCDYRQMPEVKKYDTIISCEMIENVGHEYIEEFFGCCESLLAEHGLLLLQFSSVPDQCYDGHRLSPGFITEYVFPGGCLPSLNRITSAMTSSSRLCVEHLENIGIHFYQTLRCWRTNLMEKQSEILALGFNEKFIRTWEYYFDYCAAGFKSRTLGNYQIVFSRPSIVAAFSNPHESFPSA
cEEEEEcccHHHHHHHHHHHccccEEEEEEcccccccccccccccccccccccccccccccHHHHHHHHHcccccccccEEEEEEEcccccEEEccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHccccHHHHHHcccccccccccccHHHHHHccHHHHHHHHcccccccccccEEEccccHHHHHHHHHHHHccccEEEEcccEEEEEEccccEEEEEccccEEEccEEEEEccHHHHHHHHcccccHHHHHHccccccccccEEEEccccccccccccEEEccccccccccEEEEEEcccccccccccccEEEEcccccccccEEEEEEEccccccHHHHHHHHHHHHHcccccEEEEccccccccccccEEEEEHHHHccccccccccccccccccHHHHHHHHHHHHHHHHHHHcccEEEEEccccEEEEEEcccccccccEEEEEEcHHHHHHHHHcccccHHHHHHccccccccccccHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHccccccHHHHHHHHHHHHcccHHHHHHcccccccccccccccccccHHHHHHHHHHHHHHHccccccccEEEEcccHHHHHHHHHHHcccEEEEEcccHHHHHHHHHHHHHccccccEEEEEcccccccccccccEEEEEEEEcccccccHHHHHHHHHHccccccEEEEEEEccccccHHHHcccccccccccccccccccHHHHHHHHHHccccEEEEHHccccHHHHHHHHHHHHHHHcHHHHHHccccHHHHHHHHHHHHHHHHHcccccccEEEEEEEcccccccccccccccccc
cEEEEEcccHHHHHHHHHHHccEcEEEEEcccccccccccEEEcccEEEccEEEEEcccccHHHHHHHHHcccccccccEEEEEEccccccEEEcccccHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHccccHHHHHHcccHHHHHHHcccHHHHHHccHHHHHHHHHHHcccccccEEEEccccHHHHHHHHHHHHHHcccEEccccEEEEEEccccEEEEEccccEEEccEEEEEEcHHHHHHHHcccccHHHHHHHHccccccccEEEEcccccccccHHHHHHHHcccccccccEEEHHHHHHcccccccccEEEEccccccHHHHEEEEEcccccccHHHHHHHHHHHHHcccccEEEEEEEcccccccHHHHHHHHHHHHHcccccccccccccccccccHHHHHHHHHHHHHHHcccccEEEEEcccEEEEEccccccccEEEEEEEccHHHHHHHHHHccccHHHHHEcccccccccHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHcccHHHHcccccccccccccccccccccHHHHHHHHHHHHHcccccccccEEEEEcccccHHHHHHHHHHccEEEEEEccHHHHHHHHHHHHHccccccEEEEEccHHHccccccccEEEEHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEEEEccHHHHHHHHccHHHHHHHccccccHHHHHHHHHHHHHccccEEEcHHHccHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHcccccEEEEEEcccccccccccccccccc
MRVAVIGGGMSGLVSAYVLAKAGVEVVLYEKedslgghaktvtidgvdlDIGFMLFNHVEYPNMMEFLESLgvdmgtsdmsfsvsldkgqgyewgtrnglSSLFAQKKNVLNPYFWQMLREMMKFKDDVLSYVEELenspdidrnetlGHFIKSRGYSELFLKAYLIpicssvwscpsdgamrfSAFSVLSFCRLfqlfghpqcvtvrrhshSQIDKVSEQLKSWGIQIrmscevysvfpadegcsivcvngsqefyngcvmavhaPDALrilgnqatfdeTRILGAFRYVYRDVflhrdknfmpqnpaawsawnfvgstngKICLTYCLNVLQnigetsmpflatlnpdrtpqntllkwstghsvpsvaaSKASLELHLIQGkrgiwysgvdqgygfpedglkvGMIAAHGvlgkscailgnpkqmvpSLMEKGARLFVARFLRQFISTGCFILleeggktftfegprtncplksdlriqnpQFYWKVMTQADLGlansyingdfsfidkdEGLLNLFLIVIANqgldsstsklnLRSIASAKYYFRHISRKNTLAQARRNISHHYDVSNELFSLFLGKSMMYSCAIfkseyedldVAQMRKVSLLIEKARVNKGLDVLEIGCGWGTLAIEIVKQTGckytgitlsEEQLKYTETKVKEAGLQDHIRLYLCdyrqmpevkkydtIISCEMIENVGHEYIEEFFGCCESLLAEHGLLLLqfssvpdqcydghrlspgfiteyvfpggclpslnritsamtssSRLCVEHLENIGIHFYQTLRCWRTNLMEKQSEILALGFNEKFIRTWEYYFDYCAagfksrtlgnyqivfsrpsivaafsnphesfpsa
mrvavigggmsGLVSAYVLAKAGVEVVLYEkedslgghaktvtidgvDLDIGFMLFNHVEYPNMMEFLESLGVDMGTSDMSFSVSLDKGQGYEWGTRNGLSSLFAQKKNVLNPYFWQMLREMMKFKDDVLSYVEELenspdidrnetLGHFIKSRGYSELFLKAYLIPICSSVWSCPSDGAMRFSAFSVLSFCRLFQLFGHPQCVTVRRHSHSQIDKVSEQLKSWGIQIRMSCEVYSVFPADEGCSIVCVNGSQEFYNGCVMAVHAPDALRILGNQATFDETRILGAFRYVYRDVFLHRDKNFMPQNPAAWSAWNFVGSTNGKICLTYCLNVLQNIGETSMPFLATLNPDRTPQNTLLKWSTGHSVPSVAASKASLELHLIQGKRGIWYSGVDQGYGFPEDGLKVGMIAAHGVLGKSCAILGNPKQMVPSLMEKGARLFVARFLRQFISTGCFILLEEGGKTFTFEGPRTNCPLKSDLRIQNPQFYWKVMTQADLGLANSYINGDFSFIDKDEGLLNLFLIVIANQgldsstsklnlRSIASAKYYFRHISRKNTLAQARRNISHHYDVSNELFSLFLGKSMMYSCAIFKSEYEDLDVAQMRKVSLLIEKARVNKGLDVLEIGCGWGTLAIEIVKQTGCKYTGITLSEEQLKYTETkvkeaglqdhIRLYLCDYRQMPEVKKYDTIISCEMIENVGHEYIEEFFGCCESLLAEHGLLLLQFSSVPDQCYDGHRLSPGFITEYVFPGGCLPSLNRITSAMTSSSRLCVEHLENIGIHFYQTLRCWRTNLMEKQSEILALGFNEKFIRTWEYYFDYCAAGFKSRTLGNYQIVFSRPSIvaafsnphesfpsa
MRVAVIGGGMSGLVSAYVLAKAGVEVVLYEKEDSLGGHAKTVTIDGVDLDIGFMLFNHVEYPNMMEFLESLGVDMGTSDMSFSVSLDKGQGYEWGTRNGLSSLFAQKKNVLNPYFWQMLREMMKFKDDVLSYVEELENSPDIDRNETLGHFIKSRGYSELFLKAYLIPICSSVWSCPSDGAMRFSAFSVLSFCRLFQLFGHPQCVTVRRHSHSQIDKVSEQLKSWGIQIRMSCEVYSVFPADEGCSIVCVNGSQEFYNGCVMAVHAPDALRILGNQATFDETRILGAFRYVYRDVFLHRDKNFMPQNPAAWSAWNFVGSTNGKICLTYCLNVLQNIGETSMPFLATLNPDRTPQNTLLKWSTGHSVPSVAASKASLELHLIQGKRGIWYSGVDQGYGFPEDGLKVGMIAAHGVLGKSCAILGNPKQMVPSLMEKGARLFVARFLRQFISTGCFILLEEGGKTFTFEGPRTNCPLKSDLRIQNPQFYWKVMTQADLGLANSYINGDFSFIDKDEGLLNLFLIVIANQGLDSSTSKLNLRSIASAKYYFRHISRKNTLAQARRNISHHYDVSNELFSLFLGKSMMYSCAIFKSEYEDLDVAQMRKVSLLIEKARVNKGLDVLEIGCGWGTLAIEIVKQTGCKYTGITLSEEQLKYTETKVKEAGLQDHIRLYLCDYRQMPEVKKYDTIISCEMIENVGHEYIEEFFGCCESllaehgllllQFSSVPDQCYDGHRLSPGFITEYVFPGGCLPSLNRITSAMTSSSRLCVEHLENIGIHFYQTLRCWRTNLMEKQSEILALGFNEKFIRTWEYYFDYCAAGFKSRTLGNYQIVFSRPSIVAAFSNPHESFPSA
***AVIGGGMSGLVSAYVLAKAGVEVVLYEKEDSLGGHAKTVTIDGVDLDIGFMLFNHVEYPNMMEFLESLGVDMGTSDMSFSVSLDKGQGYEWGTRNGLSSLFAQKKNVLNPYFWQMLREMMKFKDDVLSYVEELENSPDIDRNETLGHFIKSRGYSELFLKAYLIPICSSVWSCPSDGAMRFSAFSVLSFCRLFQLFGHPQCVTVRRHSHSQIDKVSEQLKSWGIQIRMSCEVYSVFPADEGCSIVCVNGSQEFYNGCVMAVHAPDALRILGNQATFDETRILGAFRYVYRDVFLHRDKNFMPQNPAAWSAWNFVGSTNGKICLTYCLNVLQNIGETSMPFLATLNPDRTPQNTLLKWSTGHSVPSVAASKASLELHLIQGKRGIWYSGVDQGYGFPEDGLKVGMIAAHGVLGKSCAILGNPKQMVPSLMEKGARLFVARFLRQFISTGCFILLEEGGKTFTFEGPRTNCPLKSDLRIQNPQFYWKVMTQADLGLANSYINGDFSFIDKDEGLLNLFLIVIANQGLDSSTSKLNLRSIASAKYYFRHISRKNTLAQARRNISHHYDVSNELFSLFLGKSMMYSCAIFKSEYEDLDVAQMRKVSLLIEKARVNKGLDVLEIGCGWGTLAIEIVKQTGCKYTGITLSEEQLKYTETKVKEAGLQDHIRLYLCDYRQMPEVKKYDTIISCEMIENVGHEYIEEFFGCCESLLAEHGLLLLQFSSVPDQCYDGHRLSPGFITEYVFPGGCLPSLNRITSAMTSSSRLCVEHLENIGIHFYQTLRCWRTNLMEKQSEILALGFNEKFIRTWEYYFDYCAAGFKSRTLGNYQIVFSRPSIVAAF**********
MRVAVIGGGMSGLVSAYVLAKAGVEVVLYEKEDSLGGHAKTVTIDGVDLDIGFMLFNHVEYPNMMEFLESLGVDMGTSDMSFSVSLDKGQGYEWGTRNGLSSLFAQKKNVLNPYFWQMLREMMKFKDDVLSYVEELENSPDIDRNETLGHFIKSRGYSELFLKAYLIPICSSVWSCPSDGAMRFSAFSVLSFCRLFQLFGHPQCVTVRRHSHSQIDKVSEQLKSWGIQIRMSCEVYSVFPADEGCSIVCVNGSQEFYNGCVMAVHAPDALRILGNQATFDETRILGAFRYVYRDVFLHRDKNFMPQNPAAWSAWNFVGSTNGKICLTYCLNVLQNIGETSMPFLATLNPDRTPQNTLLKWSTGHSVPSVAASKASLELHLIQGKRGIWYSGVDQGYGFPEDGLKVGMIAAHGVLGKSCAILGNPKQMVPSLMEKGARLFVARFLRQFISTGCFILLEEGGKTFTFEGPRTNCPLKSDLRIQNPQFYWKVMTQADLGLANSYINGDFSFIDKDEGLLNLFLIVIANQGLDSSTSKLNLRSIASAKYYFRHISRKNTLAQARRNISHHYDVSNELFSLFLGKSMMYSCAIFKSEYEDLDVAQMRKVSLLIEKARVNKGLDVLEIGCGWGTLAIEIVKQTGCKYTGITLSEEQLKYTETKVKEAGLQDHIRLYLCDYRQMPEVKKYDTIISCEMIENVGHEYIEEFFGCCESLLAEHGLLLLQFSSVPDQCYDGHRLSPGFITEYVFPGGCLPSLNRITSAMTSSSRLCVEHLENIGIHFYQTLRCWRTNLMEKQSEILALGFNEKFIRTWEYYFDYCAAGFKSRTLGNYQIVFSRPSIVAAFSN********
MRVAVIGGGMSGLVSAYVLAKAGVEVVLYEKEDSLGGHAKTVTIDGVDLDIGFMLFNHVEYPNMMEFLESLGVDMGTSDMSFSVSLDKGQGYEWGTRNGLSSLFAQKKNVLNPYFWQMLREMMKFKDDVLSYVEELENSPDIDRNETLGHFIKSRGYSELFLKAYLIPICSSVWSCPSDGAMRFSAFSVLSFCRLFQLFGHPQCVT**********KVSEQLKSWGIQIRMSCEVYSVFPADEGCSIVCVNGSQEFYNGCVMAVHAPDALRILGNQATFDETRILGAFRYVYRDVFLHRDKNFMPQNPAAWSAWNFVGSTNGKICLTYCLNVLQNIGETSMPFLATLNPDRTPQNTLLKWSTGHSVPSVAASKASLELHLIQGKRGIWYSGVDQGYGFPEDGLKVGMIAAHGVLGKSCAILGNPKQMVPSLMEKGARLFVARFLRQFISTGCFILLEEGGKTFTFEGPRTNCPLKSDLRIQNPQFYWKVMTQADLGLANSYINGDFSFIDKDEGLLNLFLIVIANQGLDSSTSKLNLRSIASAKYYFRHISRKNTLAQARRNISHHYDVSNELFSLFLGKSMMYSCAIFKSEYEDLDVAQMRKVSLLIEKARVNKGLDVLEIGCGWGTLAIEIVKQTGCKYTGITLSEEQLKYTETKVKEAGLQDHIRLYLCDYRQMPEVKKYDTIISCEMIENVGHEYIEEFFGCCESLLAEHGLLLLQFSSVPDQCYDGHRLSPGFITEYVFPGGCLPSLNRITSAMTSSSRLCVEHLENIGIHFYQTLRCWRTNLMEKQSEILALGFNEKFIRTWEYYFDYCAAGFKSRTLGNYQIVFSRPSIVAAFSN********
MRVAVIGGGMSGLVSAYVLAKAGVEVVLYEKEDSLGGHAKTVTIDGVDLDIGFMLFNHVEYPNMMEFLESLGVDMGTSDMSFSVSLDKGQGYEWGTRNGLSSLFAQKKNVLNPYFWQMLREMMKFKDDVLSYVEELENSPDIDRNETLGHFIKSRGYSELFLKAYLIPICSSVWSCPSDGAMRFSAFSVLSFCRLFQLFGHPQCVTVRRHSHSQIDKVSEQLKSWGIQIRMSCEVYSVFPADEGCSIVCVNGSQEFYNGCVMAVHAPDALRILGNQATFDETRILGAFRYVYRDVFLHRDKNFMPQNPAAWSAWNFVGSTNGKICLTYCLNVLQNIGETSMPFLATLNPDRTPQNTLLKWSTGHSVPSVAASKASLELHLIQGKRGIWYSGVDQGYGFPEDGLKVGMIAAHGVLGKSCAILGNPKQMVPSLMEKGARLFVARFLRQFISTGCFILLEEGGKTFTFEGPRTNCPLKSDLRIQNPQFYWKVMTQADLGLANSYINGDFSFIDKDEGLLNLFLIVIANQGLDSSTSKLNLRSIASAKYYFRHISRKNTLAQARRNISHHYDVSNELFSLFLGKSMMYSCAIFKSEYEDLDVAQMRKVSLLIEKARVNKGLDVLEIGCGWGTLAIEIVKQTGCKYTGITLSEEQLKYTETKVKEAGLQDHIRLYLCDYRQMPEVKKYDTIISCEMIENVGHEYIEEFFGCCESLLAEHGLLLLQFSSVPDQCYDGHRLSPGFITEYVFPGGCLPSLNRITSAMTSSSRLCVEHLENIGIHFYQTLRCWRTNLMEKQSEILALGFNEKFIRTWEYYFDYCAAGFKSRTLGNYQIVFSRPSIVAAF*NP*E*****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRVAVIGGGMSGLVSAYVLAKAGVEVVLYEKEDSLGGHAKTVTIDGVDLDIGFMLFNHVEYPNMMEFLESLGVDMGTSDMSFSVSLDKGQGYEWGTRNGLSSLFAQKKNVLNPYFWQMLREMMKFKDDVLSYVEELENSPDIDRNETLGHFIKSRGYSELFLKAYLIPICSSVWSCPSDGAMRFSAFSVLSFCRLFQLFGHPQCVTVRRHSHSQIDKVSEQLKSWGIQIRMSCEVYSVFPADEGCSIVCVNGSQEFYNGCVMAVHAPDALRILGNQATFDETRILGAFRYVYRDVFLHRDKNFMPQNPAAWSAWNFVGSTNGKICLTYCLNVLQNIGETSMPFLATLNPDRTPQNTLLKWSTGHSVPSVAASKASLELHLIQGKRGIWYSGVDQGYGFPEDGLKVGMIAAHGVLGKSCAILGNPKQMVPSLMEKGARLFVARFLRQFISTGCFILLEEGGKTFTFEGPRTNCPLKSDLRIQNPQFYWKVMTQADLGLANSYINGDFSFIDKDEGLLNLFLIVIANQGLDSSTSKLNLRSIASAKYYFRHISRKNTLAQARRNISHHYDVSNELFSLFLGKSMMYSCAIFKSEYEDLDVAQMRKVSLLIEKARVNKGLDVLEIGCGWGTLAIEIVKQTGCKYTGITLSEEQLKYTETKVKEAGLQDHIRLYLCDYRQMPEVKKYDTIISCEMIENVGHEYIEEFFGCCESLLAEHGLLLLQFSSVPDQCYDGHRLSPGFITEYVFPGGCLPSLNRITSAMTSSSRLCVEHLENIGIHFYQTLRCWRTNLMEKQSEILALGFNEKFIRTWEYYFDYCAAGFKSRTLGNYQIVFSRPSIVAAFSNPHESFPSA
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query850 2.2.26 [Sep-21-2011]
P0A9H7382 Cyclopropane-fatty-acyl-p N/A no 0.402 0.895 0.324 3e-43
P0A9H8382 Cyclopropane-fatty-acyl-p yes no 0.402 0.895 0.324 3e-43
P31049394 Probable fatty acid methy no no 0.336 0.725 0.358 7e-43
Q49807308 Cyclopropane mycolic acid no no 0.297 0.821 0.312 9e-27
P0C5C2287 Cyclopropane mycolic acid no no 0.3 0.888 0.294 1e-26
A5U866287 Cyclopropane mycolic acid no no 0.3 0.888 0.294 1e-26
Q79FX6287 Cyclopropane mycolic acid no no 0.309 0.916 0.286 3e-26
A5U029287 Cyclopropane mycolic acid no no 0.309 0.916 0.286 3e-26
Q7U1J9287 Cyclopropane mycolic acid no no 0.309 0.916 0.286 6e-26
Q7U1K1301 Hydroxymycolate synthase no no 0.278 0.787 0.306 4e-25
>sp|P0A9H7|CFA_ECOLI Cyclopropane-fatty-acyl-phospholipid synthase OS=Escherichia coli (strain K12) GN=cfa PE=1 SV=2 Back     alignment and function desciption
 Score =  177 bits (450), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 120/370 (32%), Positives = 197/370 (53%), Gaps = 28/370 (7%)

Query: 467 GPRTNCPLKSDLRIQNPQFYWKVMTQADLGLANSYINGDFSFIDKDEGLLNLFLIVIANQ 526
           G   N    +D+R++NP F+ +V+ +  LGL  SY++G +   D+    L++F   +   
Sbjct: 28  GIAINGSAPADIRVKNPDFFKRVLQEGSLGLGESYMDGWWE-CDR----LDMFFSKVLRA 82

Query: 527 GLDSSTS---KLNLRSIASAKYYFRHISRKNTLAQARRNISHHYDVSNELFSLFLGKSMM 583
           GL++      K  LR IA A+  F   S+K      +     HYD+ N+LFS  L   M 
Sbjct: 83  GLENQLPHHFKDTLR-IAGARL-FNLQSKKRAWIVGK----EHYDLGNDLFSRMLDPFMQ 136

Query: 584 YSCAIFKSEYEDLDVAQMRKVSLLIEKARVNKGLDVLEIGCGWGTLAIEIVKQTGCKYTG 643
           YSCA +K + ++L+ AQ  K+ ++ EK ++  G+ VL+IGCGWG LA  +         G
Sbjct: 137 YSCAYWK-DADNLESAQQAKLKMICEKLQLKPGMRVLDIGCGWGGLAHYMASNYDVSVVG 195

Query: 644 ITLSEEQLKYTETKVKEAGLQDHIRLYLCDYRQMPEVKKYDTIISCEMIENVGHEYIEEF 703
           +T+S EQ K  + + +  GL   + + L DYR + +  ++D I+S  M E+VG +  + +
Sbjct: 196 VTISAEQQKMAQERCE--GLD--VTILLQDYRDLND--QFDRIVSVGMFEHVGPKNYDTY 249

Query: 704 FGCCESLLAEHGLLLLQFSSVPDQCYDGHRLSPGFITEYVFPGGCLPSLNRITSAMTSSS 763
           F   +  L   G+ LL   ++  +  D + + P +I +Y+FP GCLPS+ +I  A +S  
Sbjct: 250 FAVVDRNLKPEGIFLLH--TIGSKKTDLN-VDP-WINKYIFPNGCLPSVRQI--AQSSEP 303

Query: 764 RLCVEHLENIGIHFYQTLRCWRTNLMEKQSEILALGFNEKFIRTWEYYFDYCAAGFKSRT 823
              +E   N G  +  TL  W    +    EI A  ++E+F R + YY + CA  F++R 
Sbjct: 304 HFVMEDWHNFGADYDTTLMAWYERFLAAWPEI-ADNYSERFKRMFTYYLNACAGAFRARD 362

Query: 824 LGNYQIVFSR 833
           +  +Q+VFSR
Sbjct: 363 IQLWQVVFSR 372
Transfers a methylene group from S-adenosyl-L-methionine to the cis double bond of an unsaturated fatty acid chain resulting in the replacement of the double bond with a methylene bridge.
Escherichia coli (strain K12) (taxid: 83333)
EC: 2EC: .EC: 1EC: .EC: 1EC: .EC: 7EC: 9
>sp|P0A9H8|CFA_ECOL6 Cyclopropane-fatty-acyl-phospholipid synthase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=cfa PE=3 SV=2 Back     alignment and function description
>sp|P31049|FAMT_PSEPU Probable fatty acid methyltransferase OS=Pseudomonas putida PE=3 SV=1 Back     alignment and function description
>sp|Q49807|CMAS2_MYCLE Cyclopropane mycolic acid synthase 2 OS=Mycobacterium leprae (strain TN) GN=cmaA2 PE=3 SV=1 Back     alignment and function description
>sp|P0C5C2|CMAS1_MYCTU Cyclopropane mycolic acid synthase 1 OS=Mycobacterium tuberculosis GN=cmaA1 PE=1 SV=1 Back     alignment and function description
>sp|A5U866|CMAS1_MYCTA Cyclopropane mycolic acid synthase 1 OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=cmaA1 PE=1 SV=1 Back     alignment and function description
>sp|Q79FX6|MMAA2_MYCTU Cyclopropane mycolic acid synthase MmaA2 OS=Mycobacterium tuberculosis GN=mmaA2 PE=1 SV=1 Back     alignment and function description
>sp|A5U029|MMAA2_MYCTA Cyclopropane mycolic acid synthase MmaA2 OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=mmaA2 PE=1 SV=1 Back     alignment and function description
>sp|Q7U1J9|MMAA2_MYCBO Cyclopropane mycolic acid synthase MmaA2 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=cmaC PE=1 SV=1 Back     alignment and function description
>sp|Q7U1K1|MMAA4_MYCBO Hydroxymycolate synthase MmaA4 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=cmaA PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query850
224107479866 predicted protein [Populus trichocarpa] 1.0 0.981 0.722 0.0
224099967862 predicted protein [Populus trichocarpa] 0.996 0.982 0.723 0.0
225433227865 PREDICTED: uncharacterized protein LOC10 1.0 0.982 0.717 0.0
359477758865 PREDICTED: uncharacterized protein LOC10 0.998 0.981 0.711 0.0
255575825865 methyltransferase, putative [Ricinus com 1.0 0.982 0.697 0.0
296083708898 unnamed protein product [Vitis vinifera] 1.0 0.946 0.686 0.0
147791135874 hypothetical protein VITISV_025151 [Viti 0.98 0.953 0.705 0.0
50313464865 cyclopropane fatty acid synthase [Gossyp 1.0 0.982 0.686 0.0
296083705881 unnamed protein product [Vitis vinifera] 0.998 0.963 0.691 0.0
297831102867 hypothetical protein ARALYDRAFT_898865 [ 1.0 0.980 0.659 0.0
>gi|224107479|ref|XP_002314493.1| predicted protein [Populus trichocarpa] gi|222863533|gb|EEF00664.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score = 1329 bits (3439), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 625/865 (72%), Positives = 725/865 (83%), Gaps = 15/865 (1%)

Query: 1   MRVAVIGGGMSGLVSAYVLAKAGVEVVLYEKEDSLGGHAKTVTIDGVDLDIGFMLFNHVE 60
           MRVAV+G G+SGLVSAYVLAKAG EVVLYEKEDSLGGHAKTV  DGVDLD+GFM+FN V 
Sbjct: 1   MRVAVVGAGISGLVSAYVLAKAGAEVVLYEKEDSLGGHAKTVCFDGVDLDLGFMVFNRVT 60

Query: 61  YPNMMEFLESLGVDMGTSDMSFSVSLDKGQGYEWGTRNGLSSLFAQKKNVLNPYFWQMLR 120
           YPNMMEF E+LG+DM  SDMSFSVSLD+G+G EWG+RNG S LFAQKKN LNPYFW+MLR
Sbjct: 61  YPNMMEFFENLGIDMELSDMSFSVSLDQGKGCEWGSRNGFSGLFAQKKNALNPYFWKMLR 120

Query: 121 EMMKFKDDVLSYVEELENSPDIDRNETLGHFIKSRGYSELFLKAYLIPICSSVWSCPSDG 180
           E++KFKDDVLSY+E LEN+P +DRNETLG F+KSRGYSELF KAYL+P+C S+WSCPS+G
Sbjct: 121 EIVKFKDDVLSYLEVLENNPVVDRNETLGQFVKSRGYSELFQKAYLVPVCGSIWSCPSEG 180

Query: 181 AMRFSAFSVLSFCR---LFQLFGHPQCVTVRRHSHSQIDKVSEQLKSWGIQIRMSCEVYS 237
            M FSAFSVLSFCR   L QLFG PQ +TVRR SHS ++KV E+L+SWG QIR  CEV +
Sbjct: 181 VMNFSAFSVLSFCRNHHLLQLFGRPQWLTVRRRSHSYVNKVREKLESWGCQIRTGCEVQA 240

Query: 238 VFPADE-GCSIVCVNGSQEFYNGCVMAVHAPDALRILGNQATFDETRILGAFRYVYRDVF 296
           V   DE GC+++C++G  E Y+GC+MAVHAPDAL +LG QATFDETRILGAF+Y+Y ++F
Sbjct: 241 VSTTDEAGCAVLCIDGLLEMYSGCIMAVHAPDALGLLGEQATFDETRILGAFQYMYSEIF 300

Query: 297 LHRDKNFMPQNPAAWSAWNFVGSTNGKICLTYCLNVLQNIGETSMPFLATLNPDRTPQNT 356
           LHRDK +MPQN AAWSAWNF+GST  K+CLTY LNVLQNI ET +PFL TLNPD  P +T
Sbjct: 301 LHRDKTYMPQNSAAWSAWNFLGSTENKVCLTYWLNVLQNIDETGLPFLVTLNPDNAPDHT 360

Query: 357 LLKWSTGHSVPSVAASKASLELHLIQGKRGIWYSGVDQGYGFPEDGLKVGMIAAHGVLGK 416
           LLKWSTG  VPSVAA+KASLEL  IQGKR IW+ G  QGYGF EDGLK GM+AAHG+LGK
Sbjct: 361 LLKWSTGRPVPSVAATKASLELDHIQGKRRIWFGGAYQGYGFYEDGLKSGMVAAHGLLGK 420

Query: 417 SCAILGNPKQMVPSLMEKGARLFVARFLRQFISTGCFILLEEGGKTFTFEGPRTNCPLKS 476
           SC IL NPK MVPS++E GARLFV RFL   ISTGC  LLE+GG  F+FEG    C LK+
Sbjct: 421 SCDILRNPKHMVPSMLETGARLFVTRFLGHHISTGCLTLLEDGGTVFSFEGTSKKCSLKT 480

Query: 477 DLRIQNPQFYWKVMTQADLGLANSYINGDFSFIDKDEGLLNLFLIVIANQGLDSSTSKLN 536
            L++ NPQFYWK+MTQADLGLA++YINGDFSF+DKDEGL+NLF+I+I N+  D+STSKLN
Sbjct: 481 VLKVHNPQFYWKIMTQADLGLADAYINGDFSFVDKDEGLINLFMILIVNRDADNSTSKLN 540

Query: 537 LR-----------SIASAKYYFRHISRKNTLAQARRNISHHYDVSNELFSLFLGKSMMYS 585
            +            IASAK++ +H+SR+NTL QARRNIS HYD+SNELF+LFL ++M YS
Sbjct: 541 KKRGWWTPLLFTAGIASAKFFIQHVSRQNTLTQARRNISRHYDLSNELFALFLDETMTYS 600

Query: 586 CAIFKSEYEDLDVAQMRKVSLLIEKARVNKGLDVLEIGCGWGTLAIEIVKQTGCKYTGIT 645
           CA+FK E EDL  AQ+RK+SLLIEKARVNK  +VLEIGCGWGTLAIE+V++TGCKYTGIT
Sbjct: 601 CALFKKEDEDLKAAQIRKISLLIEKARVNKDHEVLEIGCGWGTLAIEVVQRTGCKYTGIT 660

Query: 646 LSEEQLKYTETKVKEAGLQDHIRLYLCDYRQMPEVKKYDTIISCEMIENVGHEYIEEFFG 705
           LSEEQLKY E KVKEAGLQD I+ +LCDYRQ+P+  KYDTIISCEMIE VGHEY+EEFFG
Sbjct: 661 LSEEQLKYAELKVKEAGLQDSIKFHLCDYRQLPKTHKYDTIISCEMIEAVGHEYMEEFFG 720

Query: 706 CCESLLAEHGLLLLQFSSVPDQCYDGHRLSPGFITEYVFPGGCLPSLNRITSAMTSSSRL 765
           CCES+LAE+GL +LQF S+P++ YD +R S  FI EY+FPGGCLPSL RITSAM SSSRL
Sbjct: 721 CCESVLAENGLFVLQFISIPEERYDEYRKSSDFIKEYIFPGGCLPSLTRITSAMASSSRL 780

Query: 766 CVEHLENIGIHFYQTLRCWRTNLMEKQSEILALGFNEKFIRTWEYYFDYCAAGFKSRTLG 825
           CVEH+ENIGI +YQTLR WR N +E Q EIL+LGFNEKFIRTWEYYFDYCAAGFK+ TLG
Sbjct: 781 CVEHVENIGIQYYQTLRYWRKNFLENQREILSLGFNEKFIRTWEYYFDYCAAGFKTHTLG 840

Query: 826 NYQIVFSRPSIVAAFSNPHESFPSA 850
           NYQ+VFSRP  V A SNP+  FPSA
Sbjct: 841 NYQVVFSRPGNVVALSNPYRGFPSA 865

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224099967|ref|XP_002311690.1| predicted protein [Populus trichocarpa] gi|222851510|gb|EEE89057.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|225433227|ref|XP_002281958.1| PREDICTED: uncharacterized protein LOC100249441 [Vitis vinifera] Back     alignment and taxonomy information
>gi|359477758|ref|XP_002281923.2| PREDICTED: uncharacterized protein LOC100242555 [Vitis vinifera] Back     alignment and taxonomy information
>gi|255575825|ref|XP_002528810.1| methyltransferase, putative [Ricinus communis] gi|223531722|gb|EEF33544.1| methyltransferase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|296083708|emb|CBI23697.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|147791135|emb|CAN68017.1| hypothetical protein VITISV_025151 [Vitis vinifera] Back     alignment and taxonomy information
>gi|50313464|gb|AAT74602.1| cyclopropane fatty acid synthase [Gossypium hirsutum] Back     alignment and taxonomy information
>gi|296083705|emb|CBI23694.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|297831102|ref|XP_002883433.1| hypothetical protein ARALYDRAFT_898865 [Arabidopsis lyrata subsp. lyrata] gi|297329273|gb|EFH59692.1| hypothetical protein ARALYDRAFT_898865 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query850
TAIR|locus:2088070867 AT3G23530 [Arabidopsis thalian 1.0 0.980 0.652 1.90000000008e-314
TAIR|locus:2088712867 AT3G23510 [Arabidopsis thalian 1.0 0.980 0.647 3.50000000002e-313
TAIR|locus:2088717461 AT3G23470 [Arabidopsis thalian 0.512 0.945 0.619 8.8e-150
TAIR|locus:2090915305 AT3G23460 [Arabidopsis thalian 0.222 0.619 0.555 5.2e-81
DICTYBASE|DDB_G0283847430 DDB_G0283847 "cyclopropane fat 0.415 0.820 0.416 5.3e-72
TIGR_CMR|GSU_2329421 GSU_2329 "cyclopropane-fatty-a 0.477 0.964 0.332 1.2e-60
UNIPROTKB|Q0C192438 HNE_1797 "Putative uncharacter 0.470 0.913 0.345 3.2e-58
UNIPROTKB|Q9KSY4432 VC_1122 "Cyclopropane-fatty-ac 0.46 0.905 0.334 1.2e-57
TIGR_CMR|SO_3379418 SO_3379 "cyclopropane-fatty-ac 0.456 0.928 0.333 1.2e-57
TIGR_CMR|VC_1122432 VC_1122 "cyclopropane-fatty-ac 0.46 0.905 0.334 1.2e-57
TAIR|locus:2088070 AT3G23530 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 3016 (1066.7 bits), Expect = 1.9e-314, P = 1.9e-314
 Identities = 563/863 (65%), Positives = 685/863 (79%)

Query:     1 MRVAVIGGGMSGLVSAYVLAKAGV-EVVLYEKEDSLGGHAKTVTIDGVDLDIGFMLFNHV 59
             M+VAVIG G+SGL SAYVLA  GV EVVLYEKE+SLGGHAKTV  DGVDLD+GFM+FN V
Sbjct:     1 MKVAVIGSGISGLGSAYVLANQGVKEVVLYEKEESLGGHAKTVRFDGVDLDLGFMVFNRV 60

Query:    60 EYPNMMEFLESLGVDMGTSDMSFSVSLDKGQGYEWGTRNGLSSLFAQKKNVLNPYFWQML 119
              YPNMMEF E+LGV+M  SDMSF+VSLD G+G EWG+RNG+S LFAQKKNVLNPYFWQM+
Sbjct:    61 TYPNMMEFFENLGVEMEVSDMSFAVSLDNGKGCEWGSRNGVSGLFAQKKNVLNPYFWQMI 120

Query:   120 REMMKFKDDVLSYVEELENSPDIDRNETLGHFIKSRGYSELFLKAYLIPICSSVWSCPSD 179
             RE+++FK+DVL Y+EELE +PDIDR ETLG F+ SRGYSELF +AYL+PIC S+WSCPSD
Sbjct:   121 REIVRFKEDVLKYIEELEGNPDIDRKETLGEFLNSRGYSELFQQAYLVPICGSIWSCPSD 180

Query:   180 GAMRFSAFSVLSFC---RLFQLFGHPQCVTVRRHSHSQIDKVSEQLKSWGIQIRMSCEVY 236
             G + FSA+SVLSFC    L Q+FG PQ +TV   S + + KV  +L+  G +IR SC+V 
Sbjct:   181 GVLSFSAYSVLSFCCNHHLLQIFGRPQWLTVAGRSQTYVAKVRTELERLGCRIRTSCDVK 240

Query:   237 SVFPADEGC-SIVCVNGSQEFYNGCVMAVHAPDALRILGNQATFDETRILGAFRYVYRDV 295
             SV  ++ GC ++   +GS+E ++ C++A+HAPDALR+LG + TFDE+R+LGAF+YVY D+
Sbjct:   241 SVSTSENGCVTVTSGDGSKEVFDRCILAMHAPDALRLLGEEVTFDESRVLGAFQYVYSDI 300

Query:   296 FLHRDKNFMPQNPAAWSAWNFVGSTNGKICLTYCLNVLQNIGETSMPFLATLNPDRTPQN 355
             +LH D + MP+N AAWSAWNF+GST  K+C+TY LN+LQN+GE S PF  TLNPD TP+ 
Sbjct:   301 YLHHDIDLMPRNQAAWSAWNFLGSTEKKVCVTYWLNILQNLGENSEPFFVTLNPDETPKK 360

Query:   356 TLLKWSTGHSVPSVAASKASLELHLIQGKRGIWYSGVDQGYGFPEDGLKVGMIAAHGVLG 415
             TLLKW+TGH VPSVAA  AS ELH IQGKR IW+ G  QGYGF EDGLK GM AA G+LG
Sbjct:   361 TLLKWTTGHPVPSVAAWTASQELHKIQGKRNIWFCGAYQGYGFHEDGLKAGMAAARGLLG 420

Query:   416 KSCAILGNPKQMVPSLMEKGARLFVARFLRQFISTGCFILLEEGGKTFTFEGPRTNCPLK 475
             K  A+L NP+ MVPSL E GARLFV RFL QFISTG   +LEEGG  FTF G  + CPLK
Sbjct:   421 KETALLNNPRHMVPSLTETGARLFVTRFLGQFISTGSVTILEEGGTMFTFGGKDSTCPLK 480

Query:   476 SDLRIQNPQFYWKVMTQADLGLANSYINGDFSFIDKDEGLLNLFLIVIANQGLDSSTSKL 535
             S L+I +PQFYWKVMTQADLGLA++YINGDFSF+DK+ GLLNL +I+IAN+   S+ SK 
Sbjct:   481 SILKIHSPQFYWKVMTQADLGLADAYINGDFSFVDKESGLLNLIMILIANRDTKSNLSKK 540

Query:   536 N--------LRSIASAKYYFRHISRKNTLAQARRNISHHYDVSNELFSLFLGKSMMYSCA 587
                         +ASAKY+ +H+SR+NTL QARRNIS HYD+SNELF  FL  +M YS A
Sbjct:   541 RGWWTPMFLTAGLASAKYFLKHVSRQNTLTQARRNISRHYDLSNELFGFFLDDTMTYSSA 600

Query:   588 IFKSEYEDLDVAQMRKVSLLIEKARVNKGLDVLEIGCGWGTLAIEIVKQTGCKYTGITLS 647
             +FKS+ EDL  AQMRK+SLLI+KAR+ K  +VLEIGCGWGTLAIE+V++TGCKYTGITLS
Sbjct:   601 VFKSDDEDLRTAQMRKISLLIDKARIEKDHEVLEIGCGWGTLAIEVVRRTGCKYTGITLS 660

Query:   648 EEQLKYTETKVKEAGLQDHIRLYLCDYRQMPEVKKYDTIISCEMIENVGHEYIEEFFGCC 707
              EQLKY E KVKEAGLQD I   L DYRQ+ + +KYD IISCEM+E VGHE++E FF  C
Sbjct:   661 IEQLKYAEEKVKEAGLQDWITFELRDYRQLSDAQKYDRIISCEMLEAVGHEFMEMFFSRC 720

Query:   708 ESXXXXXXXXXXQFSSVPDQCYDGHRLSPGFITEYVFPGGCLPSLNRITSAMTSSSRLCV 767
             E+          QF S+P++ Y+ +RLS  FI EY+FPGGCLPSL R+T+AM+SSSRLC+
Sbjct:   721 EAALAENGLIVLQFISIPEERYNEYRLSSDFIKEYIFPGGCLPSLARVTTAMSSSSRLCI 780

Query:   768 EHLENIGIHFYQTLRCWRTNLMEKQSEILALGFNEKFIRTWEYYFDYCAAGFKSRTLGNY 827
             EH+ENIGIH+YQTLR WR N + +Q +I+ALGF++KF+RTWEYYFDYCAAGFK+ TLGNY
Sbjct:   781 EHVENIGIHYYQTLRLWRKNFLARQKQIMALGFDDKFVRTWEYYFDYCAAGFKTLTLGNY 840

Query:   828 QIVFSRPSIVAAFSNPHESFPSA 850
             Q+VFSRP  VAAF++ +  FPSA
Sbjct:   841 QLVFSRPGNVAAFADSYRGFPSA 863
GO:0005737 "cytoplasm" evidence=ISM
GO:0008610 "lipid biosynthetic process" evidence=IEA;ISS
GO:0008825 "cyclopropane-fatty-acyl-phospholipid synthase activity" evidence=ISS
GO:0016491 "oxidoreductase activity" evidence=IEA
GO:0055114 "oxidation-reduction process" evidence=IEA
TAIR|locus:2088712 AT3G23510 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2088717 AT3G23470 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2090915 AT3G23460 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0283847 DDB_G0283847 "cyclopropane fatty acid synthase" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
TIGR_CMR|GSU_2329 GSU_2329 "cyclopropane-fatty-acyl-phospholipid synthase" [Geobacter sulfurreducens PCA (taxid:243231)] Back     alignment and assigned GO terms
UNIPROTKB|Q0C192 HNE_1797 "Putative uncharacterized protein" [Hyphomonas neptunium ATCC 15444 (taxid:228405)] Back     alignment and assigned GO terms
UNIPROTKB|Q9KSY4 VC_1122 "Cyclopropane-fatty-acyl-phospholipid synthase" [Vibrio cholerae O1 biovar El Tor str. N16961 (taxid:243277)] Back     alignment and assigned GO terms
TIGR_CMR|SO_3379 SO_3379 "cyclopropane-fatty-acyl-phospholipid synthase" [Shewanella oneidensis MR-1 (taxid:211586)] Back     alignment and assigned GO terms
TIGR_CMR|VC_1122 VC_1122 "cyclopropane-fatty-acyl-phospholipid synthase" [Vibrio cholerae O1 biovar El Tor (taxid:686)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer2.1.10.691

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query850
COG2230283 COG2230, Cfa, Cyclopropane fatty acid synthase and 3e-87
pfam02353273 pfam02353, CMAS, Mycolic acid cyclopropane synthet 4e-80
COG2907447 COG2907, COG2907, Predicted NAD/FAD-binding protei 6e-80
PRK11705383 PRK11705, PRK11705, cyclopropane fatty acyl phosph 4e-65
pfam1345066 pfam13450, NAD_binding_8, NAD(P)-binding Rossmann- 1e-17
pfam01593444 pfam01593, Amino_oxidase, Flavin containing amine 7e-17
COG1232444 COG1232, HemY, Protoporphyrinogen oxidase [Coenzym 1e-15
cd02440107 cd02440, AdoMet_MTases, S-adenosylmethionine-depen 2e-14
PRK07233434 PRK07233, PRK07233, hypothetical protein; Provisio 1e-11
pfam12847104 pfam12847, Methyltransf_18, Methyltransferase doma 3e-11
COG1233487 COG1233, COG1233, Phytoene dehydrogenase and relat 4e-11
PRK11883451 PRK11883, PRK11883, protoporphyrinogen oxidase; Re 5e-11
COG3349485 COG3349, COG3349, Uncharacterized conserved protei 1e-10
COG2227243 COG2227, UbiG, 2-polyprenyl-3-methyl-5-hydroxy-6-m 6e-10
PRK07208479 PRK07208, PRK07208, hypothetical protein; Provisio 1e-09
pfam0824298 pfam08242, Methyltransf_12, Methyltransferase doma 2e-09
TIGR00562462 TIGR00562, proto_IX_ox, protoporphyrinogen oxidase 1e-08
PRK04176257 PRK04176, PRK04176, ribulose-1,5-biphosphate synth 1e-08
TIGR01983224 TIGR01983, UbiG, ubiquinone biosynthesis O-methylt 3e-08
COG0665387 COG0665, DadA, Glycine/D-amino acid oxidases (deam 3e-08
COG1635262 COG1635, THI4, Ribulose 1,5-bisphosphate synthetas 3e-08
COG0644396 COG0644, FixC, Dehydrogenases (flavoproteins) [Ene 3e-08
pfam01266234 pfam01266, DAO, FAD dependent oxidoreductase 4e-08
COG2226238 COG2226, UbiE, Methylase involved in ubiquinone/me 6e-08
COG3380331 COG3380, COG3380, Predicted NAD/FAD-dependent oxid 7e-08
smart00828224 smart00828, PKS_MT, Methyltransferase in polyketid 8e-08
PRK12810471 PRK12810, gltD, glutamate synthase subunit beta; R 9e-08
PRK098531019 PRK09853, PRK09853, putative selenate reductase su 2e-07
COG1231450 COG1231, COG1231, Monoamine oxidase [Amino acid tr 2e-07
pfam13489154 pfam13489, Methyltransf_23, Methyltransferase doma 5e-07
COG1148622 COG1148, HdrA, Heterodisulfide reductase, subunit 5e-07
COG0654387 COG0654, UbiH, 2-polyprenyl-6-methoxyphenol hydrox 6e-07
PRK11749457 PRK11749, PRK11749, dihydropyrimidine dehydrogenas 8e-07
pfam0824192 pfam08241, Methyltransf_11, Methyltransferase doma 9e-07
PLN02576496 PLN02576, PLN02576, protoporphyrinogen oxidase 1e-06
pfam13847151 pfam13847, Methyltransf_31, Methyltransferase doma 2e-06
TIGR02734502 TIGR02734, crtI_fam, phytoene desaturase 2e-06
PRK05134233 PRK05134, PRK05134, bifunctional 3-demethylubiquin 3e-06
COG0493457 COG0493, GltD, NADPH-dependent glutamate synthase 5e-06
pfam01946229 pfam01946, Thi4, Thi4 family 5e-06
pfam01494349 pfam01494, FAD_binding_3, FAD binding domain 6e-06
pfam00890401 pfam00890, FAD_binding_2, FAD binding domain 7e-06
COG0446415 COG0446, HcaD, Uncharacterized NAD(FAD)-dependent 8e-06
PRK12771564 PRK12771, PRK12771, putative glutamate synthase (N 1e-05
COG2072443 COG2072, TrkA, Predicted flavoprotein involved in 2e-05
TIGR033151012 TIGR03315, Se_ygfK, putative selenate reductase, Y 2e-05
PRK05335436 PRK05335, PRK05335, tRNA (uracil-5-)-methyltransfe 2e-05
TIGR00292254 TIGR00292, TIGR00292, thiazole biosynthesis enzyme 2e-05
PLN02244340 PLN02244, PLN02244, tocopherol O-methyltransferase 3e-05
PLN02268435 PLN02268, PLN02268, probable polyamine oxidase 3e-05
PRK01747662 PRK01747, mnmC, bifunctional tRNA (mnm(5)s(2)U34)- 3e-05
PRK06185407 PRK06185, PRK06185, hypothetical protein; Provisio 4e-05
TIGR01318467 TIGR01318, gltD_gamma_fam, glutamate synthase smal 4e-05
TIGR02731453 TIGR02731, phytoene_desat, phytoene desaturase 4e-05
pfam13659117 pfam13659, Methyltransf_26, Methyltransferase doma 4e-05
TIGR02733492 TIGR02733, desat_CrtD, C-3',4' desaturase CrtD 5e-05
pfam07992283 pfam07992, Pyr_redox_2, Pyridine nucleotide-disulp 6e-05
pfam1364997 pfam13649, Methyltransf_25, Methyltransferase doma 8e-05
pfam03486405 pfam03486, HI0933_like, HI0933-like protein 8e-05
COG2081408 COG2081, COG2081, Predicted flavoproteins [General 9e-05
COG1249454 COG1249, Lpd, Pyruvate/2-oxoglutarate dehydrogenas 1e-04
pfam0007082 pfam00070, Pyr_redox, Pyridine nucleotide-disulphi 2e-04
PRK11728393 PRK11728, PRK11728, hydroxyglutarate oxidase; Prov 2e-04
PRK00711416 PRK00711, PRK00711, D-amino acid dehydrogenase sma 2e-04
PRK12834549 PRK12834, PRK12834, putative FAD-binding dehydroge 2e-04
PRK00216239 PRK00216, ubiE, ubiquinone/menaquinone biosynthesi 3e-04
TIGR01317485 TIGR01317, GOGAT_sm_gam, glutamate synthases, NADH 3e-04
PRK06753373 PRK06753, PRK06753, hypothetical protein; Provisio 3e-04
PTZ003061167 PTZ00306, PTZ00306, NADH-dependent fumarate reduct 5e-04
TIGR02732474 TIGR02732, zeta_caro_desat, 9,9'-di-cis-zeta-carot 6e-04
PLN02396322 PLN02396, PLN02396, hexaprenyldihydroxybenzoate me 6e-04
PLN00093450 PLN00093, PLN00093, geranylgeranyl diphosphate red 6e-04
TIGR00275400 TIGR00275, TIGR00275, flavoprotein, HI0933 family 6e-04
pfam02737180 pfam02737, 3HCDH_N, 3-hydroxyacyl-CoA dehydrogenas 7e-04
pfam05175170 pfam05175, MTS, Methyltransferase small domain 9e-04
pfam07992283 pfam07992, Pyr_redox_2, Pyridine nucleotide-disulp 0.001
TIGR03997645 TIGR03997, mycofact_OYE_2, mycofactocin system Fad 0.001
TIGR00406288 TIGR00406, prmA, ribosomal protein L11 methyltrans 0.001
TIGR01934223 TIGR01934, MenG_MenH_UbiE, ubiquinone/menaquinone 0.001
PRK12409410 PRK12409, PRK12409, D-amino acid dehydrogenase sma 0.002
PRK13984604 PRK13984, PRK13984, putative oxidoreductase; Provi 0.002
PRK06847375 PRK06847, PRK06847, hypothetical protein; Provisio 0.002
TIGR02023388 TIGR02023, BchP-ChlP, geranylgeranyl reductase 0.002
PRK12769654 PRK12769, PRK12769, putative oxidoreductase Fe-S b 0.002
PRK13943322 PRK13943, PRK13943, protein-L-isoaspartate O-methy 0.002
PLN02676487 PLN02676, PLN02676, polyamine oxidase 0.002
COG1053562 COG1053, SdhA, Succinate dehydrogenase/fumarate re 0.002
PLN02487569 PLN02487, PLN02487, zeta-carotene desaturase 0.002
PRK07538413 PRK07538, PRK07538, hypothetical protein; Provisio 0.002
COG1206439 COG1206, Gid, NAD(FAD)-utilizing enzyme possibly i 0.003
PRK12779944 PRK12779, PRK12779, putative bifunctional glutamat 0.003
TIGR02752231 TIGR02752, MenG_heptapren, demethylmenaquinone met 0.003
PLN02612567 PLN02612, PLN02612, phytoene desaturase 0.004
PRK06912458 PRK06912, acoL, dihydrolipoamide dehydrogenase; Va 0.004
PRK10015429 PRK10015, PRK10015, oxidoreductase; Provisional 0.004
pfam12831415 pfam12831, FAD_oxidored, FAD dependent oxidoreduct 0.004
>gnl|CDD|225139 COG2230, Cfa, Cyclopropane fatty acid synthase and related methyltransferases [Cell envelope biogenesis, outer membrane] Back     alignment and domain information 
 Score =  278 bits (713), Expect = 3e-87
 Identities = 110/287 (38%), Positives = 165/287 (57%), Gaps = 7/287 (2%)

Query: 547 FRHISRKNTLAQARRNISHHYDVSNELFSLFLGKSMMYSCAIFKSEYEDLDVAQMRKVSL 606
            R +  +++  +A  NI  HYD+SN+ + LFL  SM YSCA F+     L+ AQ  K+ L
Sbjct: 4   LRRLLNRHSKRRAAENIQAHYDLSNDFYRLFLDPSMTYSCAYFEDPDMTLEEAQRAKLDL 63

Query: 607 LIEKARVNKGLDVLEIGCGWGTLAIEIVKQTGCKYTGITLSEEQLKYTETKVKEAGLQDH 666
           ++EK  +  G+ +L+IGCGWG LAI   ++ G    G+TLSEEQL Y E ++   GL+D+
Sbjct: 64  ILEKLGLKPGMTLLDIGCGWGGLAIYAAEEYGVTVVGVTLSEEQLAYAEKRIAARGLEDN 123

Query: 667 IRLYLCDYRQMPEVKKYDTIISCEMIENVGHEYIEEFFGCCESLLAEHGLLLLQFSSVPD 726
           + + L DYR   E   +D I+S  M E+VG E  ++FF    +LL   G +LL   + PD
Sbjct: 124 VEVRLQDYRDFEE--PFDRIVSVGMFEHVGKENYDDFFKKVYALLKPGGRMLLHSITGPD 181

Query: 727 QCYDGHRLSPGFITEYVFPGGCLPSLNRITSAMTSSSRLCVEHLENIGIHFYQTLRCWRT 786
           Q     R  P FI +Y+FPGG LPS++ I     S +   V  +E++  H+ +TLR WR 
Sbjct: 182 Q---EFRRFPDFIDKYIFPGGELPSISEILELA-SEAGFVVLDVESLRPHYARTLRLWRE 237

Query: 787 NLMEKQSEILALGFNEKFIRTWEYYFDYCAAGFKSRTLGNYQIVFSR 833
                + E +AL ++E+F R WE Y   CAA F++  +  +Q   ++
Sbjct: 238 RFEANRDEAIAL-YDERFYRMWELYLAACAAAFRAGYIDVFQFTLTK 283

Length = 283
>gnl|CDD|216988 pfam02353, CMAS, Mycolic acid cyclopropane synthetase Back     alignment and domain information
>gnl|CDD|225459 COG2907, COG2907, Predicted NAD/FAD-binding protein [General function prediction only] Back     alignment and domain information
>gnl|CDD|183282 PRK11705, PRK11705, cyclopropane fatty acyl phospholipid synthase; Provisional Back     alignment and domain information
>gnl|CDD|205628 pfam13450, NAD_binding_8, NAD(P)-binding Rossmann-like domain Back     alignment and domain information
>gnl|CDD|216593 pfam01593, Amino_oxidase, Flavin containing amine oxidoreductase Back     alignment and domain information
>gnl|CDD|224153 COG1232, HemY, Protoporphyrinogen oxidase [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|100107 cd02440, AdoMet_MTases, S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I; AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy) Back     alignment and domain information
>gnl|CDD|235977 PRK07233, PRK07233, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|221804 pfam12847, Methyltransf_18, Methyltransferase domain Back     alignment and domain information
>gnl|CDD|224154 COG1233, COG1233, Phytoene dehydrogenase and related proteins [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>gnl|CDD|237009 PRK11883, PRK11883, protoporphyrinogen oxidase; Reviewed Back     alignment and domain information
>gnl|CDD|225885 COG3349, COG3349, Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>gnl|CDD|225137 COG2227, UbiG, 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|235967 PRK07208, PRK07208, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|219760 pfam08242, Methyltransf_12, Methyltransferase domain Back     alignment and domain information
>gnl|CDD|213540 TIGR00562, proto_IX_ox, protoporphyrinogen oxidase Back     alignment and domain information
>gnl|CDD|235241 PRK04176, PRK04176, ribulose-1,5-biphosphate synthetase; Provisional Back     alignment and domain information
>gnl|CDD|233668 TIGR01983, UbiG, ubiquinone biosynthesis O-methyltransferase Back     alignment and domain information
>gnl|CDD|223737 COG0665, DadA, Glycine/D-amino acid oxidases (deaminating) [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|224550 COG1635, THI4, Ribulose 1,5-bisphosphate synthetase, converts PRPP to RuBP, flavoprotein [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|223717 COG0644, FixC, Dehydrogenases (flavoproteins) [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|216400 pfam01266, DAO, FAD dependent oxidoreductase Back     alignment and domain information
>gnl|CDD|225136 COG2226, UbiE, Methylase involved in ubiquinone/menaquinone biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|225915 COG3380, COG3380, Predicted NAD/FAD-dependent oxidoreductase [General function prediction only] Back     alignment and domain information
>gnl|CDD|214839 smart00828, PKS_MT, Methyltransferase in polyketide synthase (PKS) enzymes Back     alignment and domain information
>gnl|CDD|237213 PRK12810, gltD, glutamate synthase subunit beta; Reviewed Back     alignment and domain information
>gnl|CDD|236630 PRK09853, PRK09853, putative selenate reductase subunit YgfK; Provisional Back     alignment and domain information
>gnl|CDD|224152 COG1231, COG1231, Monoamine oxidase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|222171 pfam13489, Methyltransf_23, Methyltransferase domain Back     alignment and domain information
>gnl|CDD|224070 COG1148, HdrA, Heterodisulfide reductase, subunit A and related polyferredoxins [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|223727 COG0654, UbiH, 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases [Coenzyme metabolism / Energy production and conversion] Back     alignment and domain information
>gnl|CDD|236967 PRK11749, PRK11749, dihydropyrimidine dehydrogenase subunit A; Provisional Back     alignment and domain information
>gnl|CDD|219759 pfam08241, Methyltransf_11, Methyltransferase domain Back     alignment and domain information
>gnl|CDD|215314 PLN02576, PLN02576, protoporphyrinogen oxidase Back     alignment and domain information
>gnl|CDD|222415 pfam13847, Methyltransf_31, Methyltransferase domain Back     alignment and domain information
>gnl|CDD|233988 TIGR02734, crtI_fam, phytoene desaturase Back     alignment and domain information
>gnl|CDD|235350 PRK05134, PRK05134, bifunctional 3-demethylubiquinone-9 3-methyltransferase/ 2-octaprenyl-6-hydroxy phenol methylase; Provisional Back     alignment and domain information
>gnl|CDD|223567 COG0493, GltD, NADPH-dependent glutamate synthase beta chain and related oxidoreductases [Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>gnl|CDD|145231 pfam01946, Thi4, Thi4 family Back     alignment and domain information
>gnl|CDD|216530 pfam01494, FAD_binding_3, FAD binding domain Back     alignment and domain information
>gnl|CDD|216176 pfam00890, FAD_binding_2, FAD binding domain Back     alignment and domain information
>gnl|CDD|223523 COG0446, HcaD, Uncharacterized NAD(FAD)-dependent dehydrogenases [General function prediction only] Back     alignment and domain information
>gnl|CDD|237198 PRK12771, PRK12771, putative glutamate synthase (NADPH) small subunit; Provisional Back     alignment and domain information
>gnl|CDD|224983 COG2072, TrkA, Predicted flavoprotein involved in K+ transport [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|132358 TIGR03315, Se_ygfK, putative selenate reductase, YgfK subunit Back     alignment and domain information
>gnl|CDD|235416 PRK05335, PRK05335, tRNA (uracil-5-)-methyltransferase Gid; Reviewed Back     alignment and domain information
>gnl|CDD|232908 TIGR00292, TIGR00292, thiazole biosynthesis enzyme Back     alignment and domain information
>gnl|CDD|215135 PLN02244, PLN02244, tocopherol O-methyltransferase Back     alignment and domain information
>gnl|CDD|177909 PLN02268, PLN02268, probable polyamine oxidase Back     alignment and domain information
>gnl|CDD|234978 PRK01747, mnmC, bifunctional tRNA (mnm(5)s(2)U34)-methyltransferase/FAD-dependent cmnm(5)s(2)U34 oxidoreductase; Reviewed Back     alignment and domain information
>gnl|CDD|235729 PRK06185, PRK06185, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|130385 TIGR01318, gltD_gamma_fam, glutamate synthase small subunit family protein, proteobacterial Back     alignment and domain information
>gnl|CDD|131778 TIGR02731, phytoene_desat, phytoene desaturase Back     alignment and domain information
>gnl|CDD|222295 pfam13659, Methyltransf_26, Methyltransferase domain Back     alignment and domain information
>gnl|CDD|233987 TIGR02733, desat_CrtD, C-3',4' desaturase CrtD Back     alignment and domain information
>gnl|CDD|219686 pfam07992, Pyr_redox_2, Pyridine nucleotide-disulphide oxidoreductase Back     alignment and domain information
>gnl|CDD|222287 pfam13649, Methyltransf_25, Methyltransferase domain Back     alignment and domain information
>gnl|CDD|217590 pfam03486, HI0933_like, HI0933-like protein Back     alignment and domain information
>gnl|CDD|224992 COG2081, COG2081, Predicted flavoproteins [General function prediction only] Back     alignment and domain information
>gnl|CDD|224169 COG1249, Lpd, Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component, and related enzymes [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|215691 pfam00070, Pyr_redox, Pyridine nucleotide-disulphide oxidoreductase Back     alignment and domain information
>gnl|CDD|183292 PRK11728, PRK11728, hydroxyglutarate oxidase; Provisional Back     alignment and domain information
>gnl|CDD|234819 PRK00711, PRK00711, D-amino acid dehydrogenase small subunit; Validated Back     alignment and domain information
>gnl|CDD|183782 PRK12834, PRK12834, putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|234689 PRK00216, ubiE, ubiquinone/menaquinone biosynthesis methyltransferase; Reviewed Back     alignment and domain information
>gnl|CDD|162300 TIGR01317, GOGAT_sm_gam, glutamate synthases, NADH/NADPH, small subunit Back     alignment and domain information
>gnl|CDD|168661 PRK06753, PRK06753, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|140327 PTZ00306, PTZ00306, NADH-dependent fumarate reductase; Provisional Back     alignment and domain information
>gnl|CDD|131779 TIGR02732, zeta_caro_desat, 9,9'-di-cis-zeta-carotene desaturase Back     alignment and domain information
>gnl|CDD|178018 PLN02396, PLN02396, hexaprenyldihydroxybenzoate methyltransferase Back     alignment and domain information
>gnl|CDD|177713 PLN00093, PLN00093, geranylgeranyl diphosphate reductase; Provisional Back     alignment and domain information
>gnl|CDD|232901 TIGR00275, TIGR00275, flavoprotein, HI0933 family Back     alignment and domain information
>gnl|CDD|202367 pfam02737, 3HCDH_N, 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain Back     alignment and domain information
>gnl|CDD|203189 pfam05175, MTS, Methyltransferase small domain Back     alignment and domain information
>gnl|CDD|219686 pfam07992, Pyr_redox_2, Pyridine nucleotide-disulphide oxidoreductase Back     alignment and domain information
>gnl|CDD|234436 TIGR03997, mycofact_OYE_2, mycofactocin system FadH/OYE family oxidoreductase 2 Back     alignment and domain information
>gnl|CDD|232960 TIGR00406, prmA, ribosomal protein L11 methyltransferase Back     alignment and domain information
>gnl|CDD|233645 TIGR01934, MenG_MenH_UbiE, ubiquinone/menaquinone biosynthesis methyltransferases Back     alignment and domain information
>gnl|CDD|237093 PRK12409, PRK12409, D-amino acid dehydrogenase small subunit; Provisional Back     alignment and domain information
>gnl|CDD|172486 PRK13984, PRK13984, putative oxidoreductase; Provisional Back     alignment and domain information
>gnl|CDD|235874 PRK06847, PRK06847, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|233689 TIGR02023, BchP-ChlP, geranylgeranyl reductase Back     alignment and domain information
>gnl|CDD|183733 PRK12769, PRK12769, putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>gnl|CDD|237568 PRK13943, PRK13943, protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|215362 PLN02676, PLN02676, polyamine oxidase Back     alignment and domain information
>gnl|CDD|223981 COG1053, SdhA, Succinate dehydrogenase/fumarate reductase, flavoprotein subunit [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|215268 PLN02487, PLN02487, zeta-carotene desaturase Back     alignment and domain information
>gnl|CDD|236046 PRK07538, PRK07538, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|224127 COG1206, Gid, NAD(FAD)-utilizing enzyme possibly involved in translation [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|183740 PRK12779, PRK12779, putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Provisional Back     alignment and domain information
>gnl|CDD|131799 TIGR02752, MenG_heptapren, demethylmenaquinone methyltransferase Back     alignment and domain information
>gnl|CDD|215330 PLN02612, PLN02612, phytoene desaturase Back     alignment and domain information
>gnl|CDD|180743 PRK06912, acoL, dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|182194 PRK10015, PRK10015, oxidoreductase; Provisional Back     alignment and domain information
>gnl|CDD|221798 pfam12831, FAD_oxidored, FAD dependent oxidoreductase Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 850
COG2230283 Cfa Cyclopropane fatty acid synthase and related m 100.0
PRK11705383 cyclopropane fatty acyl phospholipid synthase; Pro 100.0
PF02353273 CMAS: Mycolic acid cyclopropane synthetase; InterP 100.0
COG2907447 Predicted NAD/FAD-binding protein [General functio 100.0
COG1232444 HemY Protoporphyrinogen oxidase [Coenzyme metaboli 100.0
TIGR00562462 proto_IX_ox protoporphyrinogen oxidase. This prote 100.0
PRK12416463 protoporphyrinogen oxidase; Provisional 100.0
PRK11883451 protoporphyrinogen oxidase; Reviewed 100.0
PLN02576496 protoporphyrinogen oxidase 100.0
PRK07208479 hypothetical protein; Provisional 99.98
PRK07233434 hypothetical protein; Provisional 99.97
PLN02268435 probable polyamine oxidase 99.97
TIGR02731453 phytoene_desat phytoene desaturase. Plants and cya 99.97
PLN02612567 phytoene desaturase 99.97
TIGR02732474 zeta_caro_desat carotene 7,8-desaturase. Carotene 99.97
KOG1276491 consensus Protoporphyrinogen oxidase [Coenzyme tra 99.97
PLN02487569 zeta-carotene desaturase 99.97
PLN02529738 lysine-specific histone demethylase 1 99.97
smart00828224 PKS_MT Methyltransferase in polyketide synthase (P 99.96
PLN02568539 polyamine oxidase 99.96
PLN02328808 lysine-specific histone demethylase 1 homolog 99.96
PLN02244340 tocopherol O-methyltransferase 99.96
PLN03000881 amine oxidase 99.95
TIGR03467419 HpnE squalene-associated FAD-dependent desaturase. 99.95
PLN02676487 polyamine oxidase 99.95
TIGR02733492 desat_CrtD C-3',4' desaturase CrtD. Members of thi 99.95
COG1231450 Monoamine oxidase [Amino acid transport and metabo 99.94
TIGR02734502 crtI_fam phytoene desaturase. Phytoene is converte 99.94
PLN029761713 amine oxidase 99.93
KOG0685498 consensus Flavin-containing amine oxidase [Coenzym 99.93
COG3380331 Predicted NAD/FAD-dependent oxidoreductase [Genera 99.93
KOG0029501 consensus Amine oxidase [Secondary metabolites bio 99.92
PF01593450 Amino_oxidase: Flavin containing amine oxidoreduct 99.92
TIGR02730493 carot_isom carotene isomerase. Members of this fam 99.91
COG2226238 UbiE Methylase involved in ubiquinone/menaquinone 99.9
PTZ00098263 phosphoethanolamine N-methyltransferase; Provision 99.9
PLN02336475 phosphoethanolamine N-methyltransferase 99.89
PF01209233 Ubie_methyltran: ubiE/COQ5 methyltransferase famil 99.88
COG3349485 Uncharacterized conserved protein [Function unknow 99.88
COG1233487 Phytoene dehydrogenase and related proteins [Secon 99.87
PLN02233261 ubiquinone biosynthesis methyltransferase 99.84
PLN02396322 hexaprenyldihydroxybenzoate methyltransferase 99.81
COG2227243 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4- 99.81
TIGR02752231 MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone me 99.81
KOG1540296 consensus Ubiquinone biosynthesis methyltransferas 99.81
TIGR00031377 UDP-GALP_mutase UDP-galactopyranose mutase. The ge 99.8
KOG1270282 consensus Methyltransferases [Coenzyme transport a 99.77
PRK11036255 putative S-adenosyl-L-methionine-dependent methylt 99.76
PRK11207197 tellurite resistance protein TehB; Provisional 99.76
PRK14103255 trans-aconitate 2-methyltransferase; Provisional 99.75
PTZ00363443 rab-GDP dissociation inhibitor; Provisional 99.75
TIGR00452314 methyltransferase, putative. Known examples to dat 99.75
PF12847112 Methyltransf_18: Methyltransferase domain; PDB: 3G 99.74
PRK15068322 tRNA mo(5)U34 methyltransferase; Provisional 99.74
TIGR00477195 tehB tellurite resistance protein TehB. Part of a 99.73
PRK01683258 trans-aconitate 2-methyltransferase; Provisional 99.72
PLN02490340 MPBQ/MSBQ methyltransferase 99.69
PF0824195 Methyltransf_11: Methyltransferase domain; InterPr 99.69
PF03848192 TehB: Tellurite resistance protein TehB; InterPro: 99.68
PF13847152 Methyltransf_31: Methyltransferase domain; PDB: 3T 99.67
PRK07580230 Mg-protoporphyrin IX methyl transferase; Validated 99.67
TIGR01934223 MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis 99.67
TIGR02021219 BchM-ChlM magnesium protoporphyrin O-methyltransfe 99.67
TIGR03329460 Phn_aa_oxid putative aminophosphonate oxidoreducta 99.67
PRK00216239 ubiE ubiquinone/menaquinone biosynthesis methyltra 99.67
PRK10258251 biotin biosynthesis protein BioC; Provisional 99.67
PRK08317241 hypothetical protein; Provisional 99.66
PRK12335287 tellurite resistance protein TehB; Provisional 99.65
PRK11873272 arsM arsenite S-adenosylmethyltransferase; Reviewe 99.65
PRK15451247 tRNA cmo(5)U34 methyltransferase; Provisional 99.65
TIGR02716306 C20_methyl_CrtF C-20 methyltransferase BchU. Membe 99.64
PRK05785226 hypothetical protein; Provisional 99.63
TIGR03840213 TMPT_Se_Te thiopurine S-methyltransferase, Se/Te d 99.62
PF13489161 Methyltransf_23: Methyltransferase domain; PDB: 3J 99.62
TIGR02469124 CbiT precorrin-6Y C5,15-methyltransferase (decarbo 99.62
PRK13977576 myosin-cross-reactive antigen; Provisional 99.62
PRK00107187 gidB 16S rRNA methyltransferase GidB; Reviewed 99.61
PLN02585315 magnesium protoporphyrin IX methyltransferase 99.61
TIGR00740239 methyltransferase, putative. A simple BLAST search 99.61
PRK00711416 D-amino acid dehydrogenase small subunit; Validate 99.6
TIGR01377380 soxA_mon sarcosine oxidase, monomeric form. Sarcos 99.6
PF13649101 Methyltransf_25: Methyltransferase domain; PDB: 3B 99.59
PRK05134233 bifunctional 3-demethylubiquinone-9 3-methyltransf 99.59
PF08003315 Methyltransf_9: Protein of unknown function (DUF16 99.59
PRK13255218 thiopurine S-methyltransferase; Reviewed 99.58
TIGR00138181 gidB 16S rRNA methyltransferase GidB. GidB (glucos 99.58
COG4106257 Tam Trans-aconitate methyltransferase [General fun 99.58
PRK11259376 solA N-methyltryptophan oxidase; Provisional 99.57
PRK13944205 protein-L-isoaspartate O-methyltransferase; Provis 99.56
PF1345068 NAD_binding_8: NAD(P)-binding Rossmann-like domain 99.56
PF05175170 MTS: Methyltransferase small domain; InterPro: IPR 99.56
PF05401201 NodS: Nodulation protein S (NodS); InterPro: IPR00 99.56
TIGR00080215 pimt protein-L-isoaspartate(D-aspartate) O-methylt 99.55
PRK08287187 cobalt-precorrin-6Y C(15)-methyltransferase; Valid 99.55
KOG4254561 consensus Phytoene desaturase [Coenzyme transport 99.55
KOG1271227 consensus Methyltransferases [General function pre 99.55
TIGR03587204 Pse_Me-ase pseudaminic acid biosynthesis-associate 99.54
TIGR00537179 hemK_rel_arch HemK-related putative methylase. The 99.54
PRK12409410 D-amino acid dehydrogenase small subunit; Provisio 99.53
PF0824299 Methyltransf_12: Methyltransferase domain; InterPr 99.53
PF01266358 DAO: FAD dependent oxidoreductase; InterPro: IPR00 99.53
KOG4300252 consensus Predicted methyltransferase [General fun 99.52
TIGR01373407 soxB sarcosine oxidase, beta subunit family, heter 99.52
PRK01747662 mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltrans 99.52
PRK00377198 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; 99.52
PRK15001378 SAM-dependent 23S ribosomal RNA mG1835 methyltrans 99.51
PRK13942212 protein-L-isoaspartate O-methyltransferase; Provis 99.5
PRK06922677 hypothetical protein; Provisional 99.5
smart00138264 MeTrc Methyltransferase, chemotaxis proteins. Meth 99.5
PRK00517250 prmA ribosomal protein L11 methyltransferase; Revi 99.5
COG0562374 Glf UDP-galactopyranose mutase [Cell envelope biog 99.5
PRK06202232 hypothetical protein; Provisional 99.5
TIGR01983224 UbiG ubiquinone biosynthesis O-methyltransferase. 99.5
TIGR02072240 BioC biotin biosynthesis protein BioC. This enzyme 99.49
COG2081408 Predicted flavoproteins [General function predicti 99.48
PF07021193 MetW: Methionine biosynthesis protein MetW; InterP 99.48
PLN02336 475 phosphoethanolamine N-methyltransferase 99.48
PRK04266226 fibrillarin; Provisional 99.47
PRK14967223 putative methyltransferase; Provisional 99.47
PRK00121202 trmB tRNA (guanine-N(7)-)-methyltransferase; Revie 99.46
COG2242187 CobL Precorrin-6B methylase 2 [Coenzyme metabolism 99.46
TIGR00406288 prmA ribosomal protein L11 methyltransferase. Ribo 99.45
COG0665387 DadA Glycine/D-amino acid oxidases (deaminating) [ 99.45
PLN03075296 nicotianamine synthase; Provisional 99.45
COG2518209 Pcm Protein-L-isoaspartate carboxylmethyltransfera 99.44
COG2264300 PrmA Ribosomal protein L11 methylase [Translation, 99.44
PRK09489342 rsmC 16S ribosomal RNA m2G1207 methyltransferase; 99.44
COG2813300 RsmC 16S RNA G1207 methylase RsmC [Translation, ri 99.43
COG4976287 Predicted methyltransferase (contains TPR repeat) 99.43
COG4123248 Predicted O-methyltransferase [General function pr 99.43
PF13659117 Methyltransf_26: Methyltransferase domain; PDB: 3G 99.42
TIGR01177329 conserved hypothetical protein TIGR01177. This fam 99.41
PRK14968188 putative methyltransferase; Provisional 99.4
PRK07402196 precorrin-6B methylase; Provisional 99.4
TIGR03533284 L3_gln_methyl protein-(glutamine-N5) methyltransfe 99.4
TIGR02081194 metW methionine biosynthesis protein MetW. This pr 99.4
TIGR00091194 tRNA (guanine-N(7)-)-methyltransferase. In E. coli 99.4
KOG2820399 consensus FAD-dependent oxidoreductase [General fu 99.39
PRK00312212 pcm protein-L-isoaspartate O-methyltransferase; Re 99.39
PRK14121390 tRNA (guanine-N(7)-)-methyltransferase; Provisiona 99.38
PF06325295 PrmA: Ribosomal protein L11 methyltransferase (Prm 99.38
PRK13256226 thiopurine S-methyltransferase; Reviewed 99.37
PRK11805307 N5-glutamine S-adenosyl-L-methionine-dependent met 99.36
PF01135209 PCMT: Protein-L-isoaspartate(D-aspartate) O-methyl 99.36
KOG1541270 consensus Predicted protein carboxyl methylase [Ge 99.36
PF05724218 TPMT: Thiopurine S-methyltransferase (TPMT); Inter 99.36
TIGR00536284 hemK_fam HemK family putative methylases. The gene 99.35
PTZ00146293 fibrillarin; Provisional 99.33
PRK11088272 rrmA 23S rRNA methyltransferase A; Provisional 99.33
TIGR03438301 probable methyltransferase. This model represents 99.31
PRK11188209 rrmJ 23S rRNA methyltransferase J; Provisional 99.3
PF03486409 HI0933_like: HI0933-like protein; InterPro: IPR004 99.29
PRK10157428 putative oxidoreductase FixC; Provisional 99.29
PRK13943322 protein-L-isoaspartate O-methyltransferase; Provis 99.29
PLN02232160 ubiquinone biosynthesis methyltransferase 99.28
COG0579429 Predicted dehydrogenase [General function predicti 99.27
PHA03411279 putative methyltransferase; Provisional 99.27
PRK14966423 unknown domain/N5-glutamine S-adenosyl-L-methionin 99.27
TIGR03534251 RF_mod_PrmC protein-(glutamine-N5) methyltransfera 99.26
KOG2361264 consensus Predicted methyltransferase [General fun 99.26
PRK10901427 16S rRNA methyltransferase B; Provisional 99.26
PRK09328275 N5-glutamine S-adenosyl-L-methionine-dependent met 99.24
PRK11728393 hydroxyglutarate oxidase; Provisional 99.24
smart00650169 rADc Ribosomal RNA adenine dimethylases. 99.23
PLN02781234 Probable caffeoyl-CoA O-methyltransferase 99.23
PRK14904445 16S rRNA methyltransferase B; Provisional 99.22
PRK14903431 16S rRNA methyltransferase B; Provisional 99.22
COG2519256 GCD14 tRNA(1-methyladenosine) methyltransferase an 99.22
COG1635262 THI4 Ribulose 1,5-bisphosphate synthetase, convert 99.21
PRK01544 506 bifunctional N5-glutamine S-adenosyl-L-methionine- 99.21
COG0644396 FixC Dehydrogenases (flavoproteins) [Energy produc 99.21
PRK14901434 16S rRNA methyltransferase B; Provisional 99.2
TIGR00563426 rsmB ribosomal RNA small subunit methyltransferase 99.2
PRK04457262 spermidine synthase; Provisional 99.2
PF06080204 DUF938: Protein of unknown function (DUF938); Inte 99.19
TIGR00446264 nop2p NOL1/NOP2/sun family putative RNA methylase. 99.19
PRK14902444 16S rRNA methyltransferase B; Provisional 99.18
TIGR03364365 HpnW_proposed FAD dependent oxidoreductase TIGR033 99.16
PF00891241 Methyltransf_2: O-methyltransferase; InterPro: IPR 99.14
TIGR03704251 PrmC_rel_meth putative protein-(glutamine-N5) meth 99.14
PTZ00383497 malate:quinone oxidoreductase; Provisional 99.13
TIGR02032295 GG-red-SF geranylgeranyl reductase family. This mo 99.13
cd02440107 AdoMet_MTases S-adenosylmethionine-dependent methy 99.13
KOG3010261 consensus Methyltransferase [General function pred 99.13
PF08704247 GCD14: tRNA methyltransferase complex GCD14 subuni 99.13
PF01596205 Methyltransf_3: O-methyltransferase; InterPro: IPR 99.12
COG0654387 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and 99.12
PRK10015429 oxidoreductase; Provisional 99.12
COG4122219 Predicted O-methyltransferase [General function pr 99.11
PF05891218 Methyltransf_PK: AdoMet dependent proline di-methy 99.11
TIGR00438188 rrmJ cell division protein FtsJ. 99.1
PRK00811283 spermidine synthase; Provisional 99.1
COG2890280 HemK Methylase of polypeptide chain release factor 99.1
PRK15128396 23S rRNA m(5)C1962 methyltransferase; Provisional 99.09
PLN02476278 O-methyltransferase 99.09
TIGR01320483 mal_quin_oxido malate:quinone-oxidoreductase. This 99.07
PRK06847375 hypothetical protein; Provisional 99.06
PF02390195 Methyltransf_4: Putative methyltransferase ; Inter 99.05
KOG2844856 consensus Dimethylglycine dehydrogenase precursor 99.05
PRK04176257 ribulose-1,5-biphosphate synthetase; Provisional 99.05
TIGR00292254 thiazole biosynthesis enzyme. This enzyme is invol 99.04
PRK13168443 rumA 23S rRNA m(5)U1939 methyltransferase; Reviewe 99.04
PRK08773392 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 99.04
PHA03412241 putative methyltransferase; Provisional 99.03
PRK05257494 malate:quinone oxidoreductase; Validated 99.03
TIGR00275400 flavoprotein, HI0933 family. The model when search 99.03
PLN02172461 flavin-containing monooxygenase FMO GS-OX 99.03
PRK11101546 glpA sn-glycerol-3-phosphate dehydrogenase subunit 99.02
TIGR01988385 Ubi-OHases Ubiquinone biosynthesis hydroxylase, Ub 99.02
KOG2904328 consensus Predicted methyltransferase [General fun 99.01
PRK07588391 hypothetical protein; Provisional 99.0
PF13738203 Pyr_redox_3: Pyridine nucleotide-disulphide oxidor 99.0
PLN02366308 spermidine synthase 99.0
PRK11783702 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisi 99.0
TIGR03197381 MnmC_Cterm tRNA U-34 5-methylaminomethyl-2-thiouri 99.0
PRK08163396 salicylate hydroxylase; Provisional 99.0
TIGR00417270 speE spermidine synthase. the SpeE subunit of sper 98.99
PRK03522315 rumB 23S rRNA methyluridine methyltransferase; Rev 98.99
PRK05714405 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 98.99
PRK06753373 hypothetical protein; Provisional 98.99
PF00996438 GDI: GDP dissociation inhibitor; InterPro: IPR0182 98.99
KOG1269364 consensus SAM-dependent methyltransferases [Lipid 98.99
TIGR01984382 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase. T 98.98
PRK13369502 glycerol-3-phosphate dehydrogenase; Provisional 98.98
PF03291331 Pox_MCEL: mRNA capping enzyme; InterPro: IPR004971 98.98
PF05185448 PRMT5: PRMT5 arginine-N-methyltransferase; InterPr 98.98
TIGR02028398 ChlP geranylgeranyl reductase. This model represen 98.97
PF01946230 Thi4: Thi4 family; PDB: 1RP0_A 3FPZ_B 3JSK_K. 98.97
PRK07236386 hypothetical protein; Provisional 98.97
PRK12266508 glpD glycerol-3-phosphate dehydrogenase; Reviewed 98.97
PRK10909199 rsmD 16S rRNA m(2)G966-methyltransferase; Provisio 98.97
TIGR02023388 BchP-ChlP geranylgeranyl reductase. This model rep 98.96
PLN02589247 caffeoyl-CoA O-methyltransferase 98.95
PRK13339497 malate:quinone oxidoreductase; Reviewed 98.95
PRK08274466 tricarballylate dehydrogenase; Validated 98.95
PRK11727321 23S rRNA mA1618 methyltransferase; Provisional 98.94
PRK05868372 hypothetical protein; Validated 98.94
PRK06834488 hypothetical protein; Provisional 98.94
PRK03612521 spermidine synthase; Provisional 98.93
PRK06184502 hypothetical protein; Provisional 98.93
PRK07333403 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio 98.93
PLN00093450 geranylgeranyl diphosphate reductase; Provisional 98.92
PRK07608388 ubiquinone biosynthesis hydroxylase family protein 98.92
KOG1975389 consensus mRNA cap methyltransferase [RNA processi 98.91
TIGR03219414 salicylate_mono salicylate 1-monooxygenase. Member 98.91
PRK01581374 speE spermidine synthase; Validated 98.9
PF06100500 Strep_67kDa_ant: Streptococcal 67 kDa myosin-cross 98.89
PRK08013400 oxidoreductase; Provisional 98.89
COG0220227 Predicted S-adenosylmethionine-dependent methyltra 98.89
PLN02672 1082 methionine S-methyltransferase 98.89
PRK07045388 putative monooxygenase; Reviewed 98.89
PTZ00338294 dimethyladenosine transferase-like protein; Provis 98.88
PF01170179 UPF0020: Putative RNA methylase family UPF0020; In 98.88
PRK07190487 hypothetical protein; Provisional 98.88
PRK07364415 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 98.88
PRK08849384 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 98.87
KOG1499346 consensus Protein arginine N-methyltransferase PRM 98.87
PRK08020391 ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquin 98.86
PF10294173 Methyltransf_16: Putative methyltransferase; Inter 98.86
TIGR02085374 meth_trns_rumB 23S rRNA (uracil-5-)-methyltransfer 98.86
KOG1500 517 consensus Protein arginine N-methyltransferase CAR 98.85
PRK09126392 hypothetical protein; Provisional 98.85
PF05219265 DREV: DREV methyltransferase; InterPro: IPR007884 98.85
COG2263198 Predicted RNA methylase [Translation, ribosomal st 98.84
PF12147311 Methyltransf_20: Putative methyltransferase; Inter 98.84
TIGR01813439 flavo_cyto_c flavocytochrome c. This model describ 98.84
PRK06475400 salicylate hydroxylase; Provisional 98.83
PRK07494388 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio 98.83
PF02475200 Met_10: Met-10+ like-protein; InterPro: IPR003402 98.83
TIGR00479431 rumA 23S rRNA (uracil-5-)-methyltransferase RumA. 98.82
PRK08850405 2-octaprenyl-6-methoxyphenol hydroxylase; Validate 98.82
KOG2852380 consensus Possible oxidoreductase [General functio 98.82
PRK14896258 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 98.82
PRK06183538 mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Va 98.81
PRK06617374 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 98.81
PF05148219 Methyltransf_8: Hypothetical methyltransferase; In 98.81
PRK09897534 hypothetical protein; Provisional 98.81
PRK06481506 fumarate reductase flavoprotein subunit; Validated 98.81
PRK00274272 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 98.8
PLN02463447 lycopene beta cyclase 98.8
COG0578532 GlpA Glycerol-3-phosphate dehydrogenase [Energy pr 98.8
PF00890417 FAD_binding_2: FAD binding domain of the Pfam fami 98.79
PRK08244493 hypothetical protein; Provisional 98.79
PRK08243392 4-hydroxybenzoate 3-monooxygenase; Validated 98.79
PRK07538413 hypothetical protein; Provisional 98.79
PF13454156 NAD_binding_9: FAD-NAD(P)-binding 98.78
KOG2899288 consensus Predicted methyltransferase [General fun 98.78
COG1041347 Predicted DNA modification methylase [DNA replicat 98.78
KOG3045325 consensus Predicted RNA methylase involved in rRNA 98.78
COG2521287 Predicted archaeal methyltransferase [General func 98.77
KOG2853509 consensus Possible oxidoreductase [General functio 98.77
PRK06126545 hypothetical protein; Provisional 98.77
TIGR02360390 pbenz_hydroxyl 4-hydroxybenzoate 3-monooxygenase. 98.76
PLN02464627 glycerol-3-phosphate dehydrogenase 98.76
PRK05732395 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 98.76
PF01739196 CheR: CheR methyltransferase, SAM binding domain; 98.75
PF01494356 FAD_binding_3: FAD binding domain; InterPro: IPR00 98.75
PLN02661357 Putative thiazole synthesis 98.75
PRK08132547 FAD-dependent oxidoreductase; Provisional 98.74
COG1092393 Predicted SAM-dependent methyltransferases [Genera 98.74
PRK06116450 glutathione reductase; Validated 98.74
TIGR01424446 gluta_reduc_2 glutathione-disulfide reductase, pla 98.74
TIGR01790388 carotene-cycl lycopene cyclase family protein. Thi 98.73
PRK05249461 soluble pyridine nucleotide transhydrogenase; Prov 98.73
TIGR00095189 RNA methyltransferase, RsmD family. This model rep 98.73
TIGR01812566 sdhA_frdA_Gneg succinate dehydrogenase or fumarate 98.71
KOG1399448 consensus Flavin-containing monooxygenase [Seconda 98.71
TIGR01350461 lipoamide_DH dihydrolipoamide dehydrogenase. The m 98.71
PF00743531 FMO-like: Flavin-binding monooxygenase-like; Inter 98.71
TIGR02352337 thiamin_ThiO glycine oxidase ThiO. This family con 98.69
PRK05192618 tRNA uridine 5-carboxymethylaminomethyl modificati 98.69
PRK06185407 hypothetical protein; Provisional 98.69
KOG2940325 consensus Predicted methyltransferase [General fun 98.68
TIGR01292300 TRX_reduct thioredoxin-disulfide reductase. This m 98.68
TIGR00755253 ksgA dimethyladenosine transferase. Alternate name 98.67
KOG2415621 consensus Electron transfer flavoprotein ubiquinon 98.67
PRK07121492 hypothetical protein; Validated 98.66
PRK04148134 hypothetical protein; Provisional 98.66
PRK08401466 L-aspartate oxidase; Provisional 98.66
PRK07573640 sdhA succinate dehydrogenase flavoprotein subunit; 98.66
PRK06416462 dihydrolipoamide dehydrogenase; Reviewed 98.65
PRK12842574 putative succinate dehydrogenase; Reviewed 98.65
PRK11445351 putative oxidoreductase; Provisional 98.64
PLN02927668 antheraxanthin epoxidase/zeaxanthin epoxidase 98.63
TIGR01989437 COQ6 Ubiquinone biosynthesis mono0xygenase COQ6. T 98.63
COG3963194 Phospholipid N-methyltransferase [Lipid metabolism 98.63
TIGR01421450 gluta_reduc_1 glutathione-disulfide reductase, ani 98.63
PRK12845564 3-ketosteroid-delta-1-dehydrogenase; Reviewed 98.63
PLN02697529 lycopene epsilon cyclase 98.62
PRK01544506 bifunctional N5-glutamine S-adenosyl-L-methionine- 98.62
KOG3191209 consensus Predicted N6-DNA-methyltransferase [Tran 98.62
PRK05945575 sdhA succinate dehydrogenase flavoprotein subunit; 98.62
TIGR02485432 CobZ_N-term precorrin 3B synthase CobZ. CobZ is es 98.61
TIGR03378419 glycerol3P_GlpB glycerol-3-phosphate dehydrogenase 98.61
PRK07803626 sdhA succinate dehydrogenase flavoprotein subunit; 98.61
PLN02507499 glutathione reductase 98.61
PF10672286 Methyltrans_SAM: S-adenosylmethionine-dependent me 98.61
KOG1661237 consensus Protein-L-isoaspartate(D-aspartate) O-me 98.61
PRK10611287 chemotaxis methyltransferase CheR; Provisional 98.61
COG2072443 TrkA Predicted flavoprotein involved in K+ transpo 98.61
TIGR03140515 AhpF alkyl hydroperoxide reductase, F subunit. Thi 98.6
PF01134392 GIDA: Glucose inhibited division protein A; InterP 98.59
PRK08010441 pyridine nucleotide-disulfide oxidoreductase; Prov 98.59
PRK07804541 L-aspartate oxidase; Provisional 98.58
COG1249454 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, 98.58
PRK06996398 hypothetical protein; Provisional 98.57
PRK06452566 sdhA succinate dehydrogenase flavoprotein subunit; 98.57
PF05834374 Lycopene_cycl: Lycopene cyclase protein; InterPro: 98.56
PRK11933470 yebU rRNA (cytosine-C(5)-)-methyltransferase RsmF; 98.55
PRK12843578 putative FAD-binding dehydrogenase; Reviewed 98.55
COG0030259 KsgA Dimethyladenosine transferase (rRNA methylati 98.55
PRK05329422 anaerobic glycerol-3-phosphate dehydrogenase subun 98.55
PLN02823336 spermine synthase 98.55
PRK06134581 putative FAD-binding dehydrogenase; Reviewed 98.54
PRK06175433 L-aspartate oxidase; Provisional 98.54
PRK15317517 alkyl hydroperoxide reductase subunit F; Provision 98.54
PRK04338382 N(2),N(2)-dimethylguanosine tRNA methyltransferase 98.53
PRK06115466 dihydrolipoamide dehydrogenase; Reviewed 98.52
PRK06263543 sdhA succinate dehydrogenase flavoprotein subunit; 98.52
PF02527184 GidB: rRNA small subunit methyltransferase G; Inte 98.52
PRK07818466 dihydrolipoamide dehydrogenase; Reviewed 98.51
PRK08626657 fumarate reductase flavoprotein subunit; Provision 98.51
KOG3178342 consensus Hydroxyindole-O-methyltransferase and re 98.51
PF03602183 Cons_hypoth95: Conserved hypothetical protein 95; 98.51
TIGR00551488 nadB L-aspartate oxidase. L-aspartate oxidase is t 98.5
PRK06069577 sdhA succinate dehydrogenase flavoprotein subunit; 98.5
PTZ00139617 Succinate dehydrogenase [ubiquinone] flavoprotein 98.5
KOG0820315 consensus Ribosomal RNA adenine dimethylase [RNA p 98.5
PRK08958588 sdhA succinate dehydrogenase flavoprotein subunit; 98.5
TIGR02053463 MerA mercuric reductase. This model represents the 98.5
PRK05976472 dihydrolipoamide dehydrogenase; Validated 98.49
TIGR00478228 tly hemolysin TlyA family protein. Hemolysins are 98.49
PRK07251438 pyridine nucleotide-disulfide oxidoreductase; Prov 98.49
PF12831428 FAD_oxidored: FAD dependent oxidoreductase; PDB: 3 98.49
PRK14694468 putative mercuric reductase; Provisional 98.48
PRK09078598 sdhA succinate dehydrogenase flavoprotein subunit; 98.48
PRK06370463 mercuric reductase; Validated 98.48
PRK12835584 3-ketosteroid-delta-1-dehydrogenase; Reviewed 98.48
TIGR01811603 sdhA_Bsu succinate dehydrogenase or fumarate reduc 98.48
PRK06327475 dihydrolipoamide dehydrogenase; Validated 98.47
PRK12844557 3-ketosteroid-delta-1-dehydrogenase; Reviewed 98.47
KOG3420185 consensus Predicted RNA methylase [Translation, ri 98.47
PTZ00058561 glutathione reductase; Provisional 98.46
PLN00128635 Succinate dehydrogenase [ubiquinone] flavoprotein 98.46
PRK06467471 dihydrolipoamide dehydrogenase; Reviewed 98.46
PRK07057591 sdhA succinate dehydrogenase flavoprotein subunit; 98.46
COG2520341 Predicted methyltransferase [General function pred 98.45
KOG2614420 consensus Kynurenine 3-monooxygenase and related f 98.45
PRK00050296 16S rRNA m(4)C1402 methyltranserfase; Provisional 98.44
PRK07512513 L-aspartate oxidase; Provisional 98.44
PLN02985514 squalene monooxygenase 98.44
PRK12839572 hypothetical protein; Provisional 98.44
PF04820454 Trp_halogenase: Tryptophan halogenase; InterPro: I 98.43
COG1352268 CheR Methylase of chemotaxis methyl-accepting prot 98.43
PRK12834549 putative FAD-binding dehydrogenase; Reviewed 98.43
PRK05031362 tRNA (uracil-5-)-methyltransferase; Validated 98.43
TIGR02143353 trmA_only tRNA (uracil-5-)-methyltransferase. This 98.42
COG0421282 SpeE Spermidine synthase [Amino acid transport and 98.42
PF01234256 NNMT_PNMT_TEMT: NNMT/PNMT/TEMT family; InterPro: I 98.42
PRK07395553 L-aspartate oxidase; Provisional 98.41
PRK13748561 putative mercuric reductase; Provisional 98.41
PF06039488 Mqo: Malate:quinone oxidoreductase (Mqo); InterPro 98.41
PF07942270 N2227: N2227-like protein; InterPro: IPR012901 Thi 98.4
COG3075421 GlpB Anaerobic glycerol-3-phosphate dehydrogenase 98.4
COG0492305 TrxB Thioredoxin reductase [Posttranslational modi 98.4
PRK08205583 sdhA succinate dehydrogenase flavoprotein subunit; 98.4
PTZ00367567 squalene epoxidase; Provisional 98.4
PRK09231582 fumarate reductase flavoprotein subunit; Validated 98.39
KOG1663237 consensus O-methyltransferase [Secondary metabolit 98.39
PRK06854608 adenylylsulfate reductase subunit alpha; Validated 98.39
PF09445163 Methyltransf_15: RNA cap guanine-N2 methyltransfer 98.39
PRK07843557 3-ketosteroid-delta-1-dehydrogenase; Reviewed 98.38
PF00732296 GMC_oxred_N: GMC oxidoreductase; InterPro: IPR0001 98.37
PRK12837513 3-ketosteroid-delta-1-dehydrogenase; Provisional 98.37
PRK14727479 putative mercuric reductase; Provisional 98.37
PRK08071510 L-aspartate oxidase; Provisional 98.37
PRK08641589 sdhA succinate dehydrogenase flavoprotein subunit; 98.37
COG0116381 Predicted N6-adenine-specific DNA methylase [DNA r 98.36
PTZ00052499 thioredoxin reductase; Provisional 98.36
KOG2404477 consensus Fumarate reductase, flavoprotein subunit 98.36
PF03141 506 Methyltransf_29: Putative S-adenosyl-L-methionine- 98.36
PF02384311 N6_Mtase: N-6 DNA Methylase; InterPro: IPR003356 T 98.35
PLN02815594 L-aspartate oxidase 98.35
TIGR03143555 AhpF_homolog putative alkyl hydroperoxide reductas 98.34
TIGR01423486 trypano_reduc trypanothione-disulfide reductase. T 98.33
PRK08294634 phenol 2-monooxygenase; Provisional 98.33
COG0357215 GidB Predicted S-adenosylmethionine-dependent meth 98.32
PRK08275554 putative oxidoreductase; Provisional 98.31
TIGR01176580 fum_red_Fp fumarate reductase, flavoprotein subuni 98.3
PRK11783 702 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisi 98.3
KOG1439440 consensus RAB proteins geranylgeranyltransferase c 98.3
TIGR01372985 soxA sarcosine oxidase, alpha subunit family, hete 98.3
PF01564246 Spermine_synth: Spermine/spermidine synthase; Inte 98.3
PRK06912458 acoL dihydrolipoamide dehydrogenase; Validated 98.29
PF08123205 DOT1: Histone methylation protein DOT1 ; InterPro: 98.28
PLN02546558 glutathione reductase 98.28
PRK06292460 dihydrolipoamide dehydrogenase; Validated 98.28
KOG2915314 consensus tRNA(1-methyladenosine) methyltransferas 98.27
PRK07845466 flavoprotein disulfide reductase; Reviewed 98.27
TIGR00136617 gidA glucose-inhibited division protein A. GidA, t 98.27
COG0742187 N6-adenine-specific methylase [DNA replication, re 98.27
TIGR03439319 methyl_EasF probable methyltransferase domain, Eas 98.27
PF0007080 Pyr_redox: Pyridine nucleotide-disulphide oxidored 98.26
COG2265432 TrmA SAM-dependent methyltransferases related to t 98.25
PTZ003061167 NADH-dependent fumarate reductase; Provisional 98.23
PF07156368 Prenylcys_lyase: Prenylcysteine lyase; InterPro: I 98.21
PF04816205 DUF633: Family of unknown function (DUF633) ; Inte 98.21
TIGR01438484 TGR thioredoxin and glutathione reductase selenopr 98.21
COG0144355 Sun tRNA and rRNA cytosine-C5-methylases [Translat 98.2
PRK09077536 L-aspartate oxidase; Provisional 98.19
TIGR02462544 pyranose_ox pyranose oxidase. Pyranose oxidase (al 98.19
PRK12779944 putative bifunctional glutamate synthase subunit b 98.17
KOG1335506 consensus Dihydrolipoamide dehydrogenase [Energy p 98.16
COG1148622 HdrA Heterodisulfide reductase, subunit A and rela 98.16
PF01728181 FtsJ: FtsJ-like methyltransferase; InterPro: IPR00 98.14
TIGR033151012 Se_ygfK putative selenate reductase, YgfK subunit. 98.13
PRK00536262 speE spermidine synthase; Provisional 98.12
COG4716587 Myosin-crossreactive antigen [Function unknown] 98.11
COG1252405 Ndh NADH dehydrogenase, FAD-containing subunit [En 98.11
TIGR02061614 aprA adenosine phosphosulphate reductase, alpha su 98.08
KOG1331293 consensus Predicted methyltransferase [General fun 98.05
PRK098531019 putative selenate reductase subunit YgfK; Provisio 98.04
PF05958352 tRNA_U5-meth_tr: tRNA (Uracil-5-)-methyltransferas 98.03
PRK12831464 putative oxidoreductase; Provisional 98.03
KOG2665453 consensus Predicted FAD-dependent oxidoreductase [ 98.02
PF04672267 Methyltransf_19: S-adenosyl methyltransferase; Int 98.01
COG3573552 Predicted oxidoreductase [General function predict 98.0
PF00398262 RrnaAD: Ribosomal RNA adenine dimethylase; InterPr 98.0
COG5044434 MRS6 RAB proteins geranylgeranyltransferase compon 97.99
TIGR00308374 TRM1 tRNA(guanine-26,N2-N2) methyltransferase. Thi 97.99
PF09243274 Rsm22: Mitochondrial small ribosomal subunit Rsm22 97.98
PRK09564444 coenzyme A disulfide reductase; Reviewed 97.98
PLN02852491 ferredoxin-NADP+ reductase 97.97
PRK13512438 coenzyme A disulfide reductase; Provisional 97.97
COG4529474 Uncharacterized protein conserved in bacteria [Fun 97.96
PF13679141 Methyltransf_32: Methyltransferase domain 97.92
PRK09754396 phenylpropionate dioxygenase ferredoxin reductase 97.89
PRK10742250 putative methyltransferase; Provisional 97.89
PRK127751006 putative trifunctional 2-polyprenylphenol hydroxyl 97.89
PRK12769654 putative oxidoreductase Fe-S binding subunit; Revi 97.88
PF03059276 NAS: Nicotianamine synthase protein; InterPro: IPR 97.87
PRK14989847 nitrite reductase subunit NirD; Provisional 97.86
PRK04965377 NADH:flavorubredoxin oxidoreductase; Provisional 97.86
COG0493457 GltD NADPH-dependent glutamate synthase beta chain 97.86
COG0500257 SmtA SAM-dependent methyltransferases [Secondary m 97.86
COG4076252 Predicted RNA methylase [General function predicti 97.85
PF13578106 Methyltransf_24: Methyltransferase domain; PDB: 3S 97.85
PRK065671028 putative bifunctional glutamate synthase subunit b 97.85
PF01189283 Nol1_Nop2_Fmu: NOL1/NOP2/sun family; InterPro: IPR 97.83
TIGR01316449 gltA glutamate synthase (NADPH), homotetrameric. T 97.82
PRK05335436 tRNA (uracil-5-)-methyltransferase Gid; Reviewed 97.82
PRK12778752 putative bifunctional 2-polyprenylphenol hydroxyla 97.81
PTZ00188506 adrenodoxin reductase; Provisional 97.81
PLN02668386 indole-3-acetate carboxyl methyltransferase 97.79
COG1053562 SdhA Succinate dehydrogenase/fumarate reductase, f 97.78
KOG2187534 consensus tRNA uracil-5-methyltransferase and rela 97.78
PRK12814652 putative NADPH-dependent glutamate synthase small 97.76
PRK12810471 gltD glutamate synthase subunit beta; Reviewed 97.76
COG0029518 NadB Aspartate oxidase [Coenzyme metabolism] 97.76
KOG03992142 consensus Glutamate synthase [Amino acid transport 97.76
>COG2230 Cfa Cyclopropane fatty acid synthase and related methyltransferases [Cell envelope biogenesis, outer membrane] Back     alignment and domain information 
Probab=100.00  E-value=5.2e-67  Score=524.36  Aligned_cols=279  Identities=38%  Similarity=0.733  Sum_probs=267.2

Q ss_pred             hhhcccCchHHHHHhhhhccCCChHHHHHhcCCCcceeecccCCCCCCHHHHHHHHHHHHHHHcCCCCCCeEEEEccCcc
Q 038410          548 RHISRKNTLAQARRNISHHYDVSNELFSLFLGKSMMYSCAIFKSEYEDLDVAQMRKVSLLIEKARVNKGLDVLEIGCGWG  627 (850)
Q Consensus       548 ~~~~~~~~~~~~~~~i~~~Yd~~~~~~~~~l~~~~~ys~~~~~~~~~~l~~aq~~~~~~~~~~l~~~~~~~vLDiGcG~G  627 (850)
                      .++.++++.+++.+||++|||++|+||++|||++|+|||+||++++.+|++||.+|++.++++++++||++|||||||||
T Consensus         5 ~~~~~~~~~~~~~~~i~~HYDl~n~fy~l~Ld~~~~Yscayf~~~~~tL~eAQ~~k~~~~~~kl~L~~G~~lLDiGCGWG   84 (283)
T COG2230           5 RRLLNRHSKRRAAENIQAHYDLSNDFYRLFLDPSMTYSCAYFEDPDMTLEEAQRAKLDLILEKLGLKPGMTLLDIGCGWG   84 (283)
T ss_pred             ccccccccccchhhhhhhHhhcchHHHHHhcCCCCceeeEEeCCCCCChHHHHHHHHHHHHHhcCCCCCCEEEEeCCChh
Confidence            34556788899999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHhcCCEEEEEeCCHHHHHHHHHHHHHcCCCCCEEEEEcccCCCCCCCCccEEEEecchhhhChhhHHHHHHHH
Q 038410          628 TLAIEIVKQTGCKYTGITLSEEQLKYTETKVKEAGLQDHIRLYLCDYRQMPEVKKYDTIISCEMIENVGHEYIEEFFGCC  707 (850)
Q Consensus       628 ~~~~~la~~~~~~v~gid~s~~~~~~a~~~~~~~gl~~~v~~~~~D~~~~~~~~~fD~v~s~~~~~~~~~~~~~~~~~~~  707 (850)
                      .+++++|+++|++|+|+|+|++|.+.+++++++.|++++|+++..|++++.  ++||.|+|++||||+|.++++.||+.+
T Consensus        85 ~l~~~aA~~y~v~V~GvTlS~~Q~~~~~~r~~~~gl~~~v~v~l~d~rd~~--e~fDrIvSvgmfEhvg~~~~~~ff~~~  162 (283)
T COG2230          85 GLAIYAAEEYGVTVVGVTLSEEQLAYAEKRIAARGLEDNVEVRLQDYRDFE--EPFDRIVSVGMFEHVGKENYDDFFKKV  162 (283)
T ss_pred             HHHHHHHHHcCCEEEEeeCCHHHHHHHHHHHHHcCCCcccEEEeccccccc--cccceeeehhhHHHhCcccHHHHHHHH
Confidence            999999999999999999999999999999999999999999999999998  559999999999999999999999999


Q ss_pred             HhccccCeEEEEEEecCCCCcCCCCcCccccccccccCCCCCCCHHHHHHHHhcCCceEEEEeeecCCcHHHHHHHHHHH
Q 038410          708 ESLLAEHGLLLLQFSSVPDQCYDGHRLSPGFITEYVFPGGCLPSLNRITSAMTSSSRLCVEHLENIGIHFYQTLRCWRTN  787 (850)
Q Consensus       708 ~r~LkpgG~~~~~~~~~~~~~~~~~~~~~~~~~~~i~p~~~~~~~~~~~~~~~~~~gf~v~~~~~~~~~y~~tl~~w~~~  787 (850)
                      +++|+|||++++++|+.++..+.   ...+||.+||||||.+|+..++.+...+ +||.+.+++.++.||++|++.|.++
T Consensus       163 ~~~L~~~G~~llh~I~~~~~~~~---~~~~~i~~yiFPgG~lPs~~~i~~~~~~-~~~~v~~~~~~~~hYa~Tl~~W~~~  238 (283)
T COG2230         163 YALLKPGGRMLLHSITGPDQEFR---RFPDFIDKYIFPGGELPSISEILELASE-AGFVVLDVESLRPHYARTLRLWRER  238 (283)
T ss_pred             HhhcCCCceEEEEEecCCCcccc---cchHHHHHhCCCCCcCCCHHHHHHHHHh-cCcEEehHhhhcHHHHHHHHHHHHH
Confidence            99999999999999998886654   5788999999999999999999887665 7999999999999999999999999


Q ss_pred             HHhcHHHHHhccCCHHHHHHHHHHHHHHHHHhccCcceEEEEEEEe
Q 038410          788 LMEKQSEILALGFNEKFIRTWEYYFDYCAAGFKSRTLGNYQIVFSR  833 (850)
Q Consensus       788 ~~~~~~~~~~~~~~~~~~r~w~~yl~~~~~~f~~~~~~~~q~~~~~  833 (850)
                      |+++++++.++ ++|+|.|||++||++|+.+|+.|.++++|++++|
T Consensus       239 f~~~~~~a~~~-~~e~~~r~w~~yl~~~~~~Fr~~~~~~~q~~~~k  283 (283)
T COG2230         239 FEANRDEAIAL-YDERFYRMWELYLAACAAAFRAGYIDVFQFTLTK  283 (283)
T ss_pred             HHHHHHHHHHH-hhHHHHHHHHHHHHHHHHHhccCCceEEEEEeeC
Confidence            99999999998 9999999999999999999999999999999986

>PRK11705 cyclopropane fatty acyl phospholipid synthase; Provisional Back     alignment and domain information
>PF02353 CMAS: Mycolic acid cyclopropane synthetase; InterPro: IPR003333 This entry represents mycolic acid cyclopropane synthases and related enzymes, including CmaA1, CmaA2 (cyclopropane mycolic acid synthase A1 and A2) and MmaA1-4 (methoxymycolic acid synthase A1-4) Back     alignment and domain information
>COG2907 Predicted NAD/FAD-binding protein [General function prediction only] Back     alignment and domain information
>COG1232 HemY Protoporphyrinogen oxidase [Coenzyme metabolism] Back     alignment and domain information
>TIGR00562 proto_IX_ox protoporphyrinogen oxidase Back     alignment and domain information
>PRK12416 protoporphyrinogen oxidase; Provisional Back     alignment and domain information
>PRK11883 protoporphyrinogen oxidase; Reviewed Back     alignment and domain information
>PLN02576 protoporphyrinogen oxidase Back     alignment and domain information
>PRK07208 hypothetical protein; Provisional Back     alignment and domain information
>PRK07233 hypothetical protein; Provisional Back     alignment and domain information
>PLN02268 probable polyamine oxidase Back     alignment and domain information
>TIGR02731 phytoene_desat phytoene desaturase Back     alignment and domain information
>PLN02612 phytoene desaturase Back     alignment and domain information
>TIGR02732 zeta_caro_desat carotene 7,8-desaturase Back     alignment and domain information
>KOG1276 consensus Protoporphyrinogen oxidase [Coenzyme transport and metabolism] Back     alignment and domain information
>PLN02487 zeta-carotene desaturase Back     alignment and domain information
>PLN02529 lysine-specific histone demethylase 1 Back     alignment and domain information
>smart00828 PKS_MT Methyltransferase in polyketide synthase (PKS) enzymes Back     alignment and domain information
>PLN02568 polyamine oxidase Back     alignment and domain information
>PLN02328 lysine-specific histone demethylase 1 homolog Back     alignment and domain information
>PLN02244 tocopherol O-methyltransferase Back     alignment and domain information
>PLN03000 amine oxidase Back     alignment and domain information
>TIGR03467 HpnE squalene-associated FAD-dependent desaturase Back     alignment and domain information
>PLN02676 polyamine oxidase Back     alignment and domain information
>TIGR02733 desat_CrtD C-3',4' desaturase CrtD Back     alignment and domain information
>COG1231 Monoamine oxidase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR02734 crtI_fam phytoene desaturase Back     alignment and domain information
>PLN02976 amine oxidase Back     alignment and domain information
>KOG0685 consensus Flavin-containing amine oxidase [Coenzyme transport and metabolism] Back     alignment and domain information
>COG3380 Predicted NAD/FAD-dependent oxidoreductase [General function prediction only] Back     alignment and domain information
>KOG0029 consensus Amine oxidase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PF01593 Amino_oxidase: Flavin containing amine oxidoreductase This is a subset of the Pfam family; InterPro: IPR002937 This entry consists of various amine oxidases, including maize polyamine oxidase (PAO) [], L-amino acid oxidases (LAO) and various flavin containing monoamine oxidases (MAO) Back     alignment and domain information
>TIGR02730 carot_isom carotene isomerase Back     alignment and domain information
>COG2226 UbiE Methylase involved in ubiquinone/menaquinone biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>PTZ00098 phosphoethanolamine N-methyltransferase; Provisional Back     alignment and domain information
>PLN02336 phosphoethanolamine N-methyltransferase Back     alignment and domain information
>PF01209 Ubie_methyltran: ubiE/COQ5 methyltransferase family; InterPro: IPR004033 A number of methyltransferases have been shown to share regions of similarities [] Back     alignment and domain information
>COG3349 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG1233 Phytoene dehydrogenase and related proteins [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PLN02233 ubiquinone biosynthesis methyltransferase Back     alignment and domain information
>PLN02396 hexaprenyldihydroxybenzoate methyltransferase Back     alignment and domain information
>COG2227 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase [Coenzyme metabolism] Back     alignment and domain information
>TIGR02752 MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone methyltransferase Back     alignment and domain information
>KOG1540 consensus Ubiquinone biosynthesis methyltransferase COQ5 [Coenzyme transport and metabolism] Back     alignment and domain information
>TIGR00031 UDP-GALP_mutase UDP-galactopyranose mutase Back     alignment and domain information
>KOG1270 consensus Methyltransferases [Coenzyme transport and metabolism] Back     alignment and domain information
>PRK11036 putative S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>PRK11207 tellurite resistance protein TehB; Provisional Back     alignment and domain information
>PRK14103 trans-aconitate 2-methyltransferase; Provisional Back     alignment and domain information
>PTZ00363 rab-GDP dissociation inhibitor; Provisional Back     alignment and domain information
>TIGR00452 methyltransferase, putative Back     alignment and domain information
>PF12847 Methyltransf_18: Methyltransferase domain; PDB: 3G2Q_A 3G2O_A 3G2M_B 3G2P_B 3D2L_B 1IM8_B 3NJR_A 3E05_H 3EVZ_A 3HM2_A Back     alignment and domain information
>PRK15068 tRNA mo(5)U34 methyltransferase; Provisional Back     alignment and domain information
>TIGR00477 tehB tellurite resistance protein TehB Back     alignment and domain information
>PRK01683 trans-aconitate 2-methyltransferase; Provisional Back     alignment and domain information
>PLN02490 MPBQ/MSBQ methyltransferase Back     alignment and domain information
>PF08241 Methyltransf_11: Methyltransferase domain; InterPro: IPR013216 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (SAM) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>PF03848 TehB: Tellurite resistance protein TehB; InterPro: IPR015985 Tellurite resistance protein TehB is part of a tellurite-reducing operon tehA and tehB Back     alignment and domain information
>PF13847 Methyltransf_31: Methyltransferase domain; PDB: 3T0I_B 3SVZ_B 3SXJ_A 3F4K_A 3GU3_B 2GH1_A 1R8Y_E 1R8X_B 2B3T_A 1T43_A Back     alignment and domain information
>PRK07580 Mg-protoporphyrin IX methyl transferase; Validated Back     alignment and domain information
>TIGR01934 MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis methyltransferases Back     alignment and domain information
>TIGR02021 BchM-ChlM magnesium protoporphyrin O-methyltransferase Back     alignment and domain information
>TIGR03329 Phn_aa_oxid putative aminophosphonate oxidoreductase Back     alignment and domain information
>PRK00216 ubiE ubiquinone/menaquinone biosynthesis methyltransferase; Reviewed Back     alignment and domain information
>PRK10258 biotin biosynthesis protein BioC; Provisional Back     alignment and domain information
>PRK08317 hypothetical protein; Provisional Back     alignment and domain information
>PRK12335 tellurite resistance protein TehB; Provisional Back     alignment and domain information
>PRK11873 arsM arsenite S-adenosylmethyltransferase; Reviewed Back     alignment and domain information
>PRK15451 tRNA cmo(5)U34 methyltransferase; Provisional Back     alignment and domain information
>TIGR02716 C20_methyl_CrtF C-20 methyltransferase BchU Back     alignment and domain information
>PRK05785 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03840 TMPT_Se_Te thiopurine S-methyltransferase, Se/Te detoxification family Back     alignment and domain information
>PF13489 Methyltransf_23: Methyltransferase domain; PDB: 3JWJ_A 3JWH_B 2AOV_B 2AOT_A 1JQD_B 2AOX_A 1JQE_A 2AOU_B 2AOW_A 3DLI_C Back     alignment and domain information
>TIGR02469 CbiT precorrin-6Y C5,15-methyltransferase (decarboxylating), CbiT subunit Back     alignment and domain information
>PRK13977 myosin-cross-reactive antigen; Provisional Back     alignment and domain information
>PRK00107 gidB 16S rRNA methyltransferase GidB; Reviewed Back     alignment and domain information
>PLN02585 magnesium protoporphyrin IX methyltransferase Back     alignment and domain information
>TIGR00740 methyltransferase, putative Back     alignment and domain information
>PRK00711 D-amino acid dehydrogenase small subunit; Validated Back     alignment and domain information
>TIGR01377 soxA_mon sarcosine oxidase, monomeric form Back     alignment and domain information
>PF13649 Methyltransf_25: Methyltransferase domain; PDB: 3BXO_B 3GGD_A 3PX2_A 3PX3_A 3PFH_D 3PFG_A 1Y8C_A Back     alignment and domain information
>PRK05134 bifunctional 3-demethylubiquinone-9 3-methyltransferase/ 2-octaprenyl-6-hydroxy phenol methylase; Provisional Back     alignment and domain information
>PF08003 Methyltransf_9: Protein of unknown function (DUF1698); InterPro: IPR010017 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>PRK13255 thiopurine S-methyltransferase; Reviewed Back     alignment and domain information
>TIGR00138 gidB 16S rRNA methyltransferase GidB Back     alignment and domain information
>COG4106 Tam Trans-aconitate methyltransferase [General function prediction only] Back     alignment and domain information
>PRK11259 solA N-methyltryptophan oxidase; Provisional Back     alignment and domain information
>PRK13944 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>PF13450 NAD_binding_8: NAD(P)-binding Rossmann-like domain; PDB: 3KA7_A 1V0J_D 3INR_B 3KYB_B 3GF4_A 2BI8_A 3INT_B 1WAM_A 2BI7_A 3MJ4_G Back     alignment and domain information
>PF05175 MTS: Methyltransferase small domain; InterPro: IPR007848 This domain is found in ribosomal RNA small subunit methyltransferase C and in other methyltransferases Back     alignment and domain information
>PF05401 NodS: Nodulation protein S (NodS); InterPro: IPR008715 This entry consists of nodulation S (NodS) proteins Back     alignment and domain information
>TIGR00080 pimt protein-L-isoaspartate(D-aspartate) O-methyltransferase Back     alignment and domain information
>PRK08287 cobalt-precorrin-6Y C(15)-methyltransferase; Validated Back     alignment and domain information
>KOG4254 consensus Phytoene desaturase [Coenzyme transport and metabolism] Back     alignment and domain information
>KOG1271 consensus Methyltransferases [General function prediction only] Back     alignment and domain information
>TIGR03587 Pse_Me-ase pseudaminic acid biosynthesis-associated methylase Back     alignment and domain information
>TIGR00537 hemK_rel_arch HemK-related putative methylase Back     alignment and domain information
>PRK12409 D-amino acid dehydrogenase small subunit; Provisional Back     alignment and domain information
>PF08242 Methyltransf_12: Methyltransferase domain; InterPro: IPR013217 Methyl transfer from the ubiquitous donor S-adenosyl-L-methionine (SAM) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>PF01266 DAO: FAD dependent oxidoreductase; InterPro: IPR006076 This entry includes various FAD dependent oxidoreductases: Glycerol-3-phosphate dehydrogenase (1 Back     alignment and domain information
>KOG4300 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>TIGR01373 soxB sarcosine oxidase, beta subunit family, heterotetrameric form Back     alignment and domain information
>PRK01747 mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltransferase/FAD-dependent cmnm(5)s(2)U34 oxidoreductase; Reviewed Back     alignment and domain information
>PRK00377 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; Provisional Back     alignment and domain information
>PRK15001 SAM-dependent 23S ribosomal RNA mG1835 methyltransferase; Provisional Back     alignment and domain information
>PRK13942 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>PRK06922 hypothetical protein; Provisional Back     alignment and domain information
>smart00138 MeTrc Methyltransferase, chemotaxis proteins Back     alignment and domain information
>PRK00517 prmA ribosomal protein L11 methyltransferase; Reviewed Back     alignment and domain information
>COG0562 Glf UDP-galactopyranose mutase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK06202 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01983 UbiG ubiquinone biosynthesis O-methyltransferase Back     alignment and domain information
>TIGR02072 BioC biotin biosynthesis protein BioC Back     alignment and domain information
>COG2081 Predicted flavoproteins [General function prediction only] Back     alignment and domain information
>PF07021 MetW: Methionine biosynthesis protein MetW; InterPro: IPR010743 This family consists of several bacterial and one archaeal methionine biosynthesis MetW proteins Back     alignment and domain information
>PLN02336 phosphoethanolamine N-methyltransferase Back     alignment and domain information
>PRK04266 fibrillarin; Provisional Back     alignment and domain information
>PRK14967 putative methyltransferase; Provisional Back     alignment and domain information
>PRK00121 trmB tRNA (guanine-N(7)-)-methyltransferase; Reviewed Back     alignment and domain information
>COG2242 CobL Precorrin-6B methylase 2 [Coenzyme metabolism] Back     alignment and domain information
>TIGR00406 prmA ribosomal protein L11 methyltransferase Back     alignment and domain information
>COG0665 DadA Glycine/D-amino acid oxidases (deaminating) [Amino acid transport and metabolism] Back     alignment and domain information
>PLN03075 nicotianamine synthase; Provisional Back     alignment and domain information
>COG2518 Pcm Protein-L-isoaspartate carboxylmethyltransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG2264 PrmA Ribosomal protein L11 methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK09489 rsmC 16S ribosomal RNA m2G1207 methyltransferase; Provisional Back     alignment and domain information
>COG2813 RsmC 16S RNA G1207 methylase RsmC [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only] Back     alignment and domain information
>COG4123 Predicted O-methyltransferase [General function prediction only] Back     alignment and domain information
>PF13659 Methyltransf_26: Methyltransferase domain; PDB: 3GJY_A 3LPM_B 2NP6_D 1AQI_B 2ADM_B 2IH2_A 2JG3_A 2IBS_D 2NP7_A 2IBT_A Back     alignment and domain information
>TIGR01177 conserved hypothetical protein TIGR01177 Back     alignment and domain information
>PRK14968 putative methyltransferase; Provisional Back     alignment and domain information
>PRK07402 precorrin-6B methylase; Provisional Back     alignment and domain information
>TIGR03533 L3_gln_methyl protein-(glutamine-N5) methyltransferase, ribosomal protein L3-specific Back     alignment and domain information
>TIGR02081 metW methionine biosynthesis protein MetW Back     alignment and domain information
>TIGR00091 tRNA (guanine-N(7)-)-methyltransferase Back     alignment and domain information
>KOG2820 consensus FAD-dependent oxidoreductase [General function prediction only] Back     alignment and domain information
>PRK00312 pcm protein-L-isoaspartate O-methyltransferase; Reviewed Back     alignment and domain information
>PRK14121 tRNA (guanine-N(7)-)-methyltransferase; Provisional Back     alignment and domain information
>PF06325 PrmA: Ribosomal protein L11 methyltransferase (PrmA); InterPro: IPR010456 This family consists of several Ribosomal protein L11 methyltransferase sequences Back     alignment and domain information
>PRK13256 thiopurine S-methyltransferase; Reviewed Back     alignment and domain information
>PRK11805 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>PF01135 PCMT: Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT); InterPro: IPR000682 Protein-L-isoaspartate(D-aspartate) O-methyltransferase (2 Back     alignment and domain information
>KOG1541 consensus Predicted protein carboxyl methylase [General function prediction only] Back     alignment and domain information
>PF05724 TPMT: Thiopurine S-methyltransferase (TPMT); InterPro: IPR008854 This family consists of thiopurine S-methyltransferase proteins from both eukaryotes and prokaryotes Back     alignment and domain information
>TIGR00536 hemK_fam HemK family putative methylases Back     alignment and domain information
>PTZ00146 fibrillarin; Provisional Back     alignment and domain information
>PRK11088 rrmA 23S rRNA methyltransferase A; Provisional Back     alignment and domain information
>TIGR03438 probable methyltransferase Back     alignment and domain information
>PRK11188 rrmJ 23S rRNA methyltransferase J; Provisional Back     alignment and domain information
>PF03486 HI0933_like: HI0933-like protein; InterPro: IPR004792 This is a family of conserved hypothetical proteins that may include proteins with a dinucleotide-binding motif (Rossman fold), including oxidoreductases and dehydrogenases Back     alignment and domain information
>PRK10157 putative oxidoreductase FixC; Provisional Back     alignment and domain information
>PRK13943 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>PLN02232 ubiquinone biosynthesis methyltransferase Back     alignment and domain information
>COG0579 Predicted dehydrogenase [General function prediction only] Back     alignment and domain information
>PHA03411 putative methyltransferase; Provisional Back     alignment and domain information
>PRK14966 unknown domain/N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase fusion protein; Provisional Back     alignment and domain information
>TIGR03534 RF_mod_PrmC protein-(glutamine-N5) methyltransferase, release factor-specific Back     alignment and domain information
>KOG2361 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>PRK10901 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>PRK09328 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>PRK11728 hydroxyglutarate oxidase; Provisional Back     alignment and domain information
>smart00650 rADc Ribosomal RNA adenine dimethylases Back     alignment and domain information
>PLN02781 Probable caffeoyl-CoA O-methyltransferase Back     alignment and domain information
>PRK14904 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>PRK14903 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>COG2519 GCD14 tRNA(1-methyladenosine) methyltransferase and related methyltransferases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG1635 THI4 Ribulose 1,5-bisphosphate synthetase, converts PRPP to RuBP, flavoprotein [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK01544 bifunctional N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase/tRNA (m7G46) methyltransferase; Reviewed Back     alignment and domain information
>COG0644 FixC Dehydrogenases (flavoproteins) [Energy production and conversion] Back     alignment and domain information
>PRK14901 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>TIGR00563 rsmB ribosomal RNA small subunit methyltransferase RsmB Back     alignment and domain information
>PRK04457 spermidine synthase; Provisional Back     alignment and domain information
>PF06080 DUF938: Protein of unknown function (DUF938); InterPro: IPR010342 This family consists of several hypothetical proteins from both prokaryotes and eukaryotes Back     alignment and domain information
>TIGR00446 nop2p NOL1/NOP2/sun family putative RNA methylase Back     alignment and domain information
>PRK14902 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>TIGR03364 HpnW_proposed FAD dependent oxidoreductase TIGR03364 Back     alignment and domain information
>PF00891 Methyltransf_2: O-methyltransferase; InterPro: IPR001077 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>TIGR03704 PrmC_rel_meth putative protein-(glutamine-N5) methyltransferase, unknown substrate-specific Back     alignment and domain information
>PTZ00383 malate:quinone oxidoreductase; Provisional Back     alignment and domain information
>TIGR02032 GG-red-SF geranylgeranyl reductase family Back     alignment and domain information
>cd02440 AdoMet_MTases S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I; AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy) Back     alignment and domain information
>KOG3010 consensus Methyltransferase [General function prediction only] Back     alignment and domain information
>PF08704 GCD14: tRNA methyltransferase complex GCD14 subunit; InterPro: IPR014816 GCD14 is a subunit of the tRNA methyltransferase complex and is required for 1-methyladenosine modification and maturation of initiator methionyl-tRNA [] Back     alignment and domain information
>PF01596 Methyltransf_3: O-methyltransferase; InterPro: IPR002935 Members of this family are O-methyltransferases Back     alignment and domain information
>COG0654 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases [Coenzyme metabolism / Energy production and conversion] Back     alignment and domain information
>PRK10015 oxidoreductase; Provisional Back     alignment and domain information
>COG4122 Predicted O-methyltransferase [General function prediction only] Back     alignment and domain information
>PF05891 Methyltransf_PK: AdoMet dependent proline di-methyltransferase; InterPro: IPR008576 This family consists of several eukaryotic proteins of unknown function that are S-adenosyl-L-methionine-dependent methyltransferase-like Back     alignment and domain information
>TIGR00438 rrmJ cell division protein FtsJ Back     alignment and domain information
>PRK00811 spermidine synthase; Provisional Back     alignment and domain information
>COG2890 HemK Methylase of polypeptide chain release factors [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK15128 23S rRNA m(5)C1962 methyltransferase; Provisional Back     alignment and domain information
>PLN02476 O-methyltransferase Back     alignment and domain information
>TIGR01320 mal_quin_oxido malate:quinone-oxidoreductase Back     alignment and domain information
>PRK06847 hypothetical protein; Provisional Back     alignment and domain information
>PF02390 Methyltransf_4: Putative methyltransferase ; InterPro: IPR003358 This entry represents tRNA (guanine-N-7) methyltransferase (2 Back     alignment and domain information
>KOG2844 consensus Dimethylglycine dehydrogenase precursor [Amino acid transport and metabolism] Back     alignment and domain information
>PRK04176 ribulose-1,5-biphosphate synthetase; Provisional Back     alignment and domain information
>TIGR00292 thiazole biosynthesis enzyme Back     alignment and domain information
>PRK13168 rumA 23S rRNA m(5)U1939 methyltransferase; Reviewed Back     alignment and domain information
>PRK08773 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Validated Back     alignment and domain information
>PHA03412 putative methyltransferase; Provisional Back     alignment and domain information
>PRK05257 malate:quinone oxidoreductase; Validated Back     alignment and domain information
>TIGR00275 flavoprotein, HI0933 family Back     alignment and domain information
>PLN02172 flavin-containing monooxygenase FMO GS-OX Back     alignment and domain information
>PRK11101 glpA sn-glycerol-3-phosphate dehydrogenase subunit A; Provisional Back     alignment and domain information
>TIGR01988 Ubi-OHases Ubiquinone biosynthesis hydroxylase, UbiH/UbiF/VisC/COQ6 family Back     alignment and domain information
>KOG2904 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>PRK07588 hypothetical protein; Provisional Back     alignment and domain information
>PF13738 Pyr_redox_3: Pyridine nucleotide-disulphide oxidoreductase; PDB: 3D1C_A 4A9W_B 2YLX_A 2YM2_A 2YLW_A 2YLR_A 2YM1_A 2YLS_A 1W4X_A 2YLT_A Back     alignment and domain information
>PLN02366 spermidine synthase Back     alignment and domain information
>PRK11783 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisional Back     alignment and domain information
>TIGR03197 MnmC_Cterm tRNA U-34 5-methylaminomethyl-2-thiouridine biosynthesis protein MnmC, C-terminal domain Back     alignment and domain information
>PRK08163 salicylate hydroxylase; Provisional Back     alignment and domain information
>TIGR00417 speE spermidine synthase Back     alignment and domain information
>PRK03522 rumB 23S rRNA methyluridine methyltransferase; Reviewed Back     alignment and domain information
>PRK05714 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional Back     alignment and domain information
>PRK06753 hypothetical protein; Provisional Back     alignment and domain information
>PF00996 GDI: GDP dissociation inhibitor; InterPro: IPR018203 Rab proteins constitute a family of small GTPases that serve a regulatory role in vesicular membrane traffic [, ]; C-terminal geranylgeranylation is crucial for their membrane association and function Back     alignment and domain information
>KOG1269 consensus SAM-dependent methyltransferases [Lipid transport and metabolism; General function prediction only] Back     alignment and domain information
>TIGR01984 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase Back     alignment and domain information
>PRK13369 glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PF03291 Pox_MCEL: mRNA capping enzyme; InterPro: IPR004971 This is a family of viral mRNA capping enzymes Back     alignment and domain information
>PF05185 PRMT5: PRMT5 arginine-N-methyltransferase; InterPro: IPR007857 The human homologue of Saccharomyces cerevisiae Skb1 (Shk1 kinase-binding protein 1) is a protein methyltransferase [] Back     alignment and domain information
>TIGR02028 ChlP geranylgeranyl reductase Back     alignment and domain information
>PF01946 Thi4: Thi4 family; PDB: 1RP0_A 3FPZ_B 3JSK_K Back     alignment and domain information
>PRK07236 hypothetical protein; Provisional Back     alignment and domain information
>PRK12266 glpD glycerol-3-phosphate dehydrogenase; Reviewed Back     alignment and domain information
>PRK10909 rsmD 16S rRNA m(2)G966-methyltransferase; Provisional Back     alignment and domain information
>TIGR02023 BchP-ChlP geranylgeranyl reductase Back     alignment and domain information
>PLN02589 caffeoyl-CoA O-methyltransferase Back     alignment and domain information
>PRK13339 malate:quinone oxidoreductase; Reviewed Back     alignment and domain information
>PRK08274 tricarballylate dehydrogenase; Validated Back     alignment and domain information
>PRK11727 23S rRNA mA1618 methyltransferase; Provisional Back     alignment and domain information
>PRK05868 hypothetical protein; Validated Back     alignment and domain information
>PRK06834 hypothetical protein; Provisional Back     alignment and domain information
>PRK03612 spermidine synthase; Provisional Back     alignment and domain information
>PRK06184 hypothetical protein; Provisional Back     alignment and domain information
>PRK07333 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional Back     alignment and domain information
>PLN00093 geranylgeranyl diphosphate reductase; Provisional Back     alignment and domain information
>PRK07608 ubiquinone biosynthesis hydroxylase family protein; Provisional Back     alignment and domain information
>KOG1975 consensus mRNA cap methyltransferase [RNA processing and modification] Back     alignment and domain information
>TIGR03219 salicylate_mono salicylate 1-monooxygenase Back     alignment and domain information
>PRK01581 speE spermidine synthase; Validated Back     alignment and domain information
>PF06100 Strep_67kDa_ant: Streptococcal 67 kDa myosin-cross-reactive antigen like family ; InterPro: IPR010354 Members of this family are thought to have structural features in common with the beta chain of the class II antigens, as well as myosin, and may play an important role in the pathogenesis [] Back     alignment and domain information
>PRK08013 oxidoreductase; Provisional Back     alignment and domain information
>COG0220 Predicted S-adenosylmethionine-dependent methyltransferase [General function prediction only] Back     alignment and domain information
>PLN02672 methionine S-methyltransferase Back     alignment and domain information
>PRK07045 putative monooxygenase; Reviewed Back     alignment and domain information
>PTZ00338 dimethyladenosine transferase-like protein; Provisional Back     alignment and domain information
>PF01170 UPF0020: Putative RNA methylase family UPF0020; InterPro: IPR000241 This domain is probably a methylase Back     alignment and domain information
>PRK07190 hypothetical protein; Provisional Back     alignment and domain information
>PRK07364 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>PRK08849 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional Back     alignment and domain information
>KOG1499 consensus Protein arginine N-methyltransferase PRMT1 and related enzymes [Posttranslational modification, protein turnover, chaperones; Transcription; Signal transduction mechanisms] Back     alignment and domain information
>PRK08020 ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Reviewed Back     alignment and domain information
>PF10294 Methyltransf_16: Putative methyltransferase; InterPro: IPR019410 There are a number of unidentified genes that have a high probability of coding for methyltransferases Back     alignment and domain information
>TIGR02085 meth_trns_rumB 23S rRNA (uracil-5-)-methyltransferase RumB Back     alignment and domain information
>KOG1500 consensus Protein arginine N-methyltransferase CARM1 [Posttranslational modification, protein turnover, chaperones; Transcription] Back     alignment and domain information
>PRK09126 hypothetical protein; Provisional Back     alignment and domain information
>PF05219 DREV: DREV methyltransferase; InterPro: IPR007884 This family contains DREV protein homologues from several eukaryotes Back     alignment and domain information
>COG2263 Predicted RNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF12147 Methyltransf_20: Putative methyltransferase; InterPro: IPR022744 This C-terminal region is found in bacteria and eukaryotes and is approximately 110 amino acids in length Back     alignment and domain information
>TIGR01813 flavo_cyto_c flavocytochrome c Back     alignment and domain information
>PRK06475 salicylate hydroxylase; Provisional Back     alignment and domain information
>PRK07494 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional Back     alignment and domain information
>PF02475 Met_10: Met-10+ like-protein; InterPro: IPR003402 This entry represents the Trm5 family Back     alignment and domain information
>TIGR00479 rumA 23S rRNA (uracil-5-)-methyltransferase RumA Back     alignment and domain information
>PRK08850 2-octaprenyl-6-methoxyphenol hydroxylase; Validated Back     alignment and domain information
>KOG2852 consensus Possible oxidoreductase [General function prediction only] Back     alignment and domain information
>PRK14896 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 family protein; Provisional Back     alignment and domain information
>PRK06183 mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Validated Back     alignment and domain information
>PRK06617 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>PF05148 Methyltransf_8: Hypothetical methyltransferase; InterPro: IPR007823 This family consists of uncharacterised eukaryotic proteins which are related to S-adenosyl-L-methionine-dependent methyltransferases Back     alignment and domain information
>PRK09897 hypothetical protein; Provisional Back     alignment and domain information
>PRK06481 fumarate reductase flavoprotein subunit; Validated Back     alignment and domain information
>PRK00274 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 family protein; Reviewed Back     alignment and domain information
>PLN02463 lycopene beta cyclase Back     alignment and domain information
>COG0578 GlpA Glycerol-3-phosphate dehydrogenase [Energy production and conversion] Back     alignment and domain information
>PF00890 FAD_binding_2: FAD binding domain of the Pfam family Back     alignment and domain information
>PRK08244 hypothetical protein; Provisional Back     alignment and domain information
>PRK08243 4-hydroxybenzoate 3-monooxygenase; Validated Back     alignment and domain information
>PRK07538 hypothetical protein; Provisional Back     alignment and domain information
>PF13454 NAD_binding_9: FAD-NAD(P)-binding Back     alignment and domain information
>KOG2899 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>COG1041 Predicted DNA modification methylase [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG3045 consensus Predicted RNA methylase involved in rRNA processing [RNA processing and modification] Back     alignment and domain information
>COG2521 Predicted archaeal methyltransferase [General function prediction only] Back     alignment and domain information
>KOG2853 consensus Possible oxidoreductase [General function prediction only] Back     alignment and domain information
>PRK06126 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02360 pbenz_hydroxyl 4-hydroxybenzoate 3-monooxygenase Back     alignment and domain information
>PLN02464 glycerol-3-phosphate dehydrogenase Back     alignment and domain information
>PRK05732 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>PF01739 CheR: CheR methyltransferase, SAM binding domain; InterPro: IPR022642 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>PF01494 FAD_binding_3: FAD binding domain; InterPro: IPR002938 Monooxygenases incorporate one hydroxyl group into substrates and are found in many metabolic pathways Back     alignment and domain information
>PLN02661 Putative thiazole synthesis Back     alignment and domain information
>PRK08132 FAD-dependent oxidoreductase; Provisional Back     alignment and domain information
>COG1092 Predicted SAM-dependent methyltransferases [General function prediction only] Back     alignment and domain information
>PRK06116 glutathione reductase; Validated Back     alignment and domain information
>TIGR01424 gluta_reduc_2 glutathione-disulfide reductase, plant Back     alignment and domain information
>TIGR01790 carotene-cycl lycopene cyclase family protein Back     alignment and domain information
>PRK05249 soluble pyridine nucleotide transhydrogenase; Provisional Back     alignment and domain information
>TIGR00095 RNA methyltransferase, RsmD family Back     alignment and domain information
>TIGR01812 sdhA_frdA_Gneg succinate dehydrogenase or fumarate reductase, flavoprotein subunitGram-negative/mitochondrial subgroup Back     alignment and domain information
>KOG1399 consensus Flavin-containing monooxygenase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>TIGR01350 lipoamide_DH dihydrolipoamide dehydrogenase Back     alignment and domain information
>PF00743 FMO-like: Flavin-binding monooxygenase-like; InterPro: IPR020946 Flavin-containing monooxygenases (FMOs) constitute a family of xenobiotic-metabolising enzymes [] Back     alignment and domain information
>TIGR02352 thiamin_ThiO glycine oxidase ThiO Back     alignment and domain information
>PRK05192 tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA; Validated Back     alignment and domain information
>PRK06185 hypothetical protein; Provisional Back     alignment and domain information
>KOG2940 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>TIGR01292 TRX_reduct thioredoxin-disulfide reductase Back     alignment and domain information
>TIGR00755 ksgA dimethyladenosine transferase Back     alignment and domain information
>KOG2415 consensus Electron transfer flavoprotein ubiquinone oxidoreductase [Energy production and conversion] Back     alignment and domain information
>PRK07121 hypothetical protein; Validated Back     alignment and domain information
>PRK04148 hypothetical protein; Provisional Back     alignment and domain information
>PRK08401 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK07573 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK06416 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK12842 putative succinate dehydrogenase; Reviewed Back     alignment and domain information
>PRK11445 putative oxidoreductase; Provisional Back     alignment and domain information
>PLN02927 antheraxanthin epoxidase/zeaxanthin epoxidase Back     alignment and domain information
>TIGR01989 COQ6 Ubiquinone biosynthesis mono0xygenase COQ6 Back     alignment and domain information
>COG3963 Phospholipid N-methyltransferase [Lipid metabolism] Back     alignment and domain information
>TIGR01421 gluta_reduc_1 glutathione-disulfide reductase, animal/bacterial Back     alignment and domain information
>PRK12845 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>PLN02697 lycopene epsilon cyclase Back     alignment and domain information
>PRK01544 bifunctional N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase/tRNA (m7G46) methyltransferase; Reviewed Back     alignment and domain information
>KOG3191 consensus Predicted N6-DNA-methyltransferase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK05945 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>TIGR02485 CobZ_N-term precorrin 3B synthase CobZ Back     alignment and domain information
>TIGR03378 glycerol3P_GlpB glycerol-3-phosphate dehydrogenase, anaerobic, B subunit Back     alignment and domain information
>PRK07803 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PLN02507 glutathione reductase Back     alignment and domain information
>PF10672 Methyltrans_SAM: S-adenosylmethionine-dependent methyltransferase; InterPro: IPR019614 Members of this entry are S-adenosylmethionine-dependent methyltransferases from gamma-proteobacterial species Back     alignment and domain information
>KOG1661 consensus Protein-L-isoaspartate(D-aspartate) O-methyltransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10611 chemotaxis methyltransferase CheR; Provisional Back     alignment and domain information
>COG2072 TrkA Predicted flavoprotein involved in K+ transport [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR03140 AhpF alkyl hydroperoxide reductase, F subunit Back     alignment and domain information
>PF01134 GIDA: Glucose inhibited division protein A; InterPro: IPR002218 GidA is a tRNA modification enzyme found in bacteria and mitochondria Back     alignment and domain information
>PRK08010 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>PRK07804 L-aspartate oxidase; Provisional Back     alignment and domain information
>COG1249 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component, and related enzymes [Energy production and conversion] Back     alignment and domain information
>PRK06996 hypothetical protein; Provisional Back     alignment and domain information
>PRK06452 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PF05834 Lycopene_cycl: Lycopene cyclase protein; InterPro: IPR008671 This family consists of lycopene beta and epsilon cyclase proteins Back     alignment and domain information
>PRK11933 yebU rRNA (cytosine-C(5)-)-methyltransferase RsmF; Reviewed Back     alignment and domain information
>PRK12843 putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>COG0030 KsgA Dimethyladenosine transferase (rRNA methylation) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK05329 anaerobic glycerol-3-phosphate dehydrogenase subunit B; Validated Back     alignment and domain information
>PLN02823 spermine synthase Back     alignment and domain information
>PRK06134 putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>PRK06175 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK15317 alkyl hydroperoxide reductase subunit F; Provisional Back     alignment and domain information
>PRK04338 N(2),N(2)-dimethylguanosine tRNA methyltransferase; Provisional Back     alignment and domain information
>PRK06115 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK06263 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PF02527 GidB: rRNA small subunit methyltransferase G; InterPro: IPR003682 This entry represents a rRNA small subunit methyltransferase G Back     alignment and domain information
>PRK07818 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK08626 fumarate reductase flavoprotein subunit; Provisional Back     alignment and domain information
>KOG3178 consensus Hydroxyindole-O-methyltransferase and related SAM-dependent methyltransferases [General function prediction only] Back     alignment and domain information
>PF03602 Cons_hypoth95: Conserved hypothetical protein 95; InterPro: IPR004398 This entry contains Ribosomal RNA small subunit methyltransferase D as well as the putative rRNA methyltransferase YlbH Back     alignment and domain information
>TIGR00551 nadB L-aspartate oxidase Back     alignment and domain information
>PRK06069 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PTZ00139 Succinate dehydrogenase [ubiquinone] flavoprotein subunit; Provisional Back     alignment and domain information
>KOG0820 consensus Ribosomal RNA adenine dimethylase [RNA processing and modification] Back     alignment and domain information
>PRK08958 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>TIGR02053 MerA mercuric reductase Back     alignment and domain information
>PRK05976 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>TIGR00478 tly hemolysin TlyA family protein Back     alignment and domain information
>PRK07251 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>PF12831 FAD_oxidored: FAD dependent oxidoreductase; PDB: 3ADA_A 1VRQ_A 1X31_A 3AD9_A 3AD8_A 3AD7_A 2GAG_A 2GAH_A Back     alignment and domain information
>PRK14694 putative mercuric reductase; Provisional Back     alignment and domain information
>PRK09078 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK06370 mercuric reductase; Validated Back     alignment and domain information
>PRK12835 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>TIGR01811 sdhA_Bsu succinate dehydrogenase or fumarate reductase, flavoprotein subunit, Bacillus subtilis subgroup Back     alignment and domain information
>PRK06327 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PRK12844 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>KOG3420 consensus Predicted RNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PTZ00058 glutathione reductase; Provisional Back     alignment and domain information
>PLN00128 Succinate dehydrogenase [ubiquinone] flavoprotein subunit Back     alignment and domain information
>PRK06467 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK07057 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>COG2520 Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>KOG2614 consensus Kynurenine 3-monooxygenase and related flavoprotein monooxygenases [Energy production and conversion; General function prediction only] Back     alignment and domain information
>PRK00050 16S rRNA m(4)C1402 methyltranserfase; Provisional Back     alignment and domain information
>PRK07512 L-aspartate oxidase; Provisional Back     alignment and domain information
>PLN02985 squalene monooxygenase Back     alignment and domain information
>PRK12839 hypothetical protein; Provisional Back     alignment and domain information
>PF04820 Trp_halogenase: Tryptophan halogenase; InterPro: IPR006905 Tryptophan halogenase catalyses the chlorination of tryptophan to form 7-chlorotryptophan Back     alignment and domain information
>COG1352 CheR Methylase of chemotaxis methyl-accepting proteins [Cell motility and secretion / Signal transduction mechanisms] Back     alignment and domain information
>PRK12834 putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>PRK05031 tRNA (uracil-5-)-methyltransferase; Validated Back     alignment and domain information
>TIGR02143 trmA_only tRNA (uracil-5-)-methyltransferase Back     alignment and domain information
>COG0421 SpeE Spermidine synthase [Amino acid transport and metabolism] Back     alignment and domain information
>PF01234 NNMT_PNMT_TEMT: NNMT/PNMT/TEMT family; InterPro: IPR000940 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>PRK07395 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK13748 putative mercuric reductase; Provisional Back     alignment and domain information
>PF06039 Mqo: Malate:quinone oxidoreductase (Mqo); InterPro: IPR006231 The membrane-associated enzyme, malate:quinone-oxidoreductase, is an alternative to the better-known NAD-dependent malate dehydrogenase as part of the TCA cycle Back     alignment and domain information
>PF07942 N2227: N2227-like protein; InterPro: IPR012901 This family features sequences that are similar to a region of hypothetical yeast gene product N2227 (P53934 from SWISSPROT) Back     alignment and domain information
>COG3075 GlpB Anaerobic glycerol-3-phosphate dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>COG0492 TrxB Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK08205 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PTZ00367 squalene epoxidase; Provisional Back     alignment and domain information
>PRK09231 fumarate reductase flavoprotein subunit; Validated Back     alignment and domain information
>KOG1663 consensus O-methyltransferase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK06854 adenylylsulfate reductase subunit alpha; Validated Back     alignment and domain information
>PF09445 Methyltransf_15: RNA cap guanine-N2 methyltransferase; InterPro: IPR019012 RNA cap guanine-N2 methyltransferases such as Schizosaccharomyces pombe (Fission yeast) trimethylguanosine synthase (Tgs1) and Giardia lamblia (Giardia intestinalis) Tgs2, catalyse the methylation step(s) for the conversion of the 7-monomethylguanosine (m(7)G) caps of snRNAs and snoRNAs to a 2,2,7-trimethylguanosine (m(2,2,7)G) cap structure [, , ] Back     alignment and domain information
>PRK07843 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>PF00732 GMC_oxred_N: GMC oxidoreductase; InterPro: IPR000172 The glucose-methanol-choline (GMC) oxidoreductases are FAD flavoproteins oxidoreductases [, ] Back     alignment and domain information
>PRK12837 3-ketosteroid-delta-1-dehydrogenase; Provisional Back     alignment and domain information
>PRK14727 putative mercuric reductase; Provisional Back     alignment and domain information
>PRK08071 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK08641 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>COG0116 Predicted N6-adenine-specific DNA methylase [DNA replication, recombination, and repair] Back     alignment and domain information
>PTZ00052 thioredoxin reductase; Provisional Back     alignment and domain information
>KOG2404 consensus Fumarate reductase, flavoprotein subunit [Energy production and conversion] Back     alignment and domain information
>PF03141 Methyltransf_29: Putative S-adenosyl-L-methionine-dependent methyltransferase; InterPro: IPR004159 Members of this family of hypothetical plant proteins are putative methyltransferases Back     alignment and domain information
>PF02384 N6_Mtase: N-6 DNA Methylase; InterPro: IPR003356 This domain is fpound in N-6 adenine-specific DNA methylase (2 Back     alignment and domain information
>PLN02815 L-aspartate oxidase Back     alignment and domain information
>TIGR03143 AhpF_homolog putative alkyl hydroperoxide reductase F subunit Back     alignment and domain information
>TIGR01423 trypano_reduc trypanothione-disulfide reductase Back     alignment and domain information
>PRK08294 phenol 2-monooxygenase; Provisional Back     alignment and domain information
>COG0357 GidB Predicted S-adenosylmethionine-dependent methyltransferase involved in bacterial cell division [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK08275 putative oxidoreductase; Provisional Back     alignment and domain information
>TIGR01176 fum_red_Fp fumarate reductase, flavoprotein subunit Back     alignment and domain information
>PRK11783 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisional Back     alignment and domain information
>KOG1439 consensus RAB proteins geranylgeranyltransferase component A (RAB escort protein) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR01372 soxA sarcosine oxidase, alpha subunit family, heterotetrameric form Back     alignment and domain information
>PF01564 Spermine_synth: Spermine/spermidine synthase; InterPro: IPR001045 Synonym(s): Spermidine aminopropyltransferase A group of polyamine biosynthetic enzymes involved in the fifth (last) step in the biosynthesis of spermidine from arginine and methionine which includes; spermidine synthase (2 Back     alignment and domain information
>PRK06912 acoL dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PF08123 DOT1: Histone methylation protein DOT1 ; InterPro: IPR013110 The DOT1 domain regulates gene expression by methylating histone H3 [] Back     alignment and domain information
>PLN02546 glutathione reductase Back     alignment and domain information
>PRK06292 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>KOG2915 consensus tRNA(1-methyladenosine) methyltransferase, subunit GCD14 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK07845 flavoprotein disulfide reductase; Reviewed Back     alignment and domain information
>TIGR00136 gidA glucose-inhibited division protein A Back     alignment and domain information
>COG0742 N6-adenine-specific methylase [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR03439 methyl_EasF probable methyltransferase domain, EasF family Back     alignment and domain information
>PF00070 Pyr_redox: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR001327 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] Back     alignment and domain information
>COG2265 TrmA SAM-dependent methyltransferases related to tRNA (uracil-5-)-methyltransferase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PTZ00306 NADH-dependent fumarate reductase; Provisional Back     alignment and domain information
>PF07156 Prenylcys_lyase: Prenylcysteine lyase; InterPro: IPR010795 This entry represents a conserved region found in a group of prenylcysteine lyases (1 Back     alignment and domain information
>PF04816 DUF633: Family of unknown function (DUF633) ; InterPro: IPR006901 This is a family of uncharacterised bacterial proteins Back     alignment and domain information
>TIGR01438 TGR thioredoxin and glutathione reductase selenoprotein Back     alignment and domain information
>COG0144 Sun tRNA and rRNA cytosine-C5-methylases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK09077 L-aspartate oxidase; Provisional Back     alignment and domain information
>TIGR02462 pyranose_ox pyranose oxidase Back     alignment and domain information
>PRK12779 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Provisional Back     alignment and domain information
>KOG1335 consensus Dihydrolipoamide dehydrogenase [Energy production and conversion] Back     alignment and domain information
>COG1148 HdrA Heterodisulfide reductase, subunit A and related polyferredoxins [Energy production and conversion] Back     alignment and domain information
>PF01728 FtsJ: FtsJ-like methyltransferase; InterPro: IPR002877 RrmJ (FtsJ) is a well conserved heat shock protein present in prokaryotes, archaea, and eukaryotes Back     alignment and domain information
>TIGR03315 Se_ygfK putative selenate reductase, YgfK subunit Back     alignment and domain information
>PRK00536 speE spermidine synthase; Provisional Back     alignment and domain information
>COG4716 Myosin-crossreactive antigen [Function unknown] Back     alignment and domain information
>COG1252 Ndh NADH dehydrogenase, FAD-containing subunit [Energy production and conversion] Back     alignment and domain information
>TIGR02061 aprA adenosine phosphosulphate reductase, alpha subunit Back     alignment and domain information
>KOG1331 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>PRK09853 putative selenate reductase subunit YgfK; Provisional Back     alignment and domain information
>PF05958 tRNA_U5-meth_tr: tRNA (Uracil-5-)-methyltransferase; InterPro: IPR010280 This family consists of (uracil-5-)-methyltransferases 2 Back     alignment and domain information
>PRK12831 putative oxidoreductase; Provisional Back     alignment and domain information
>KOG2665 consensus Predicted FAD-dependent oxidoreductase [Function unknown] Back     alignment and domain information
>PF04672 Methyltransf_19: S-adenosyl methyltransferase; InterPro: IPR006764 This is a family of uncharacterised proteins Back     alignment and domain information
>COG3573 Predicted oxidoreductase [General function prediction only] Back     alignment and domain information
>PF00398 RrnaAD: Ribosomal RNA adenine dimethylase; InterPro: IPR001737 This family of proteins include rRNA adenine dimethylases (e Back     alignment and domain information
>COG5044 MRS6 RAB proteins geranylgeranyltransferase component A (RAB escort protein) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00308 TRM1 tRNA(guanine-26,N2-N2) methyltransferase Back     alignment and domain information
>PF09243 Rsm22: Mitochondrial small ribosomal subunit Rsm22; InterPro: IPR015324 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>PRK09564 coenzyme A disulfide reductase; Reviewed Back     alignment and domain information
>PLN02852 ferredoxin-NADP+ reductase Back     alignment and domain information
>PRK13512 coenzyme A disulfide reductase; Provisional Back     alignment and domain information
>COG4529 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF13679 Methyltransf_32: Methyltransferase domain Back     alignment and domain information
>PRK09754 phenylpropionate dioxygenase ferredoxin reductase subunit; Provisional Back     alignment and domain information
>PRK10742 putative methyltransferase; Provisional Back     alignment and domain information
>PRK12775 putative trifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta/ferritin domain-containing protein; Provisional Back     alignment and domain information
>PRK12769 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>PF03059 NAS: Nicotianamine synthase protein; InterPro: IPR004298 Nicotianamine synthase 2 Back     alignment and domain information
>PRK14989 nitrite reductase subunit NirD; Provisional Back     alignment and domain information
>PRK04965 NADH:flavorubredoxin oxidoreductase; Provisional Back     alignment and domain information
>COG0493 GltD NADPH-dependent glutamate synthase beta chain and related oxidoreductases [Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>COG0500 SmtA SAM-dependent methyltransferases [Secondary metabolites biosynthesis, transport, and catabolism / General function prediction only] Back     alignment and domain information
>COG4076 Predicted RNA methylase [General function prediction only] Back     alignment and domain information
>PF13578 Methyltransf_24: Methyltransferase domain; PDB: 3SSO_A 3SSN_C 3SSM_D Back     alignment and domain information
>PRK06567 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Validated Back     alignment and domain information
>PF01189 Nol1_Nop2_Fmu: NOL1/NOP2/sun family; InterPro: IPR001678 This domain is found in archaeal, bacterial and eukaryotic proteins Back     alignment and domain information
>TIGR01316 gltA glutamate synthase (NADPH), homotetrameric Back     alignment and domain information
>PRK05335 tRNA (uracil-5-)-methyltransferase Gid; Reviewed Back     alignment and domain information
>PRK12778 putative bifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta; Provisional Back     alignment and domain information
>PTZ00188 adrenodoxin reductase; Provisional Back     alignment and domain information
>PLN02668 indole-3-acetate carboxyl methyltransferase Back     alignment and domain information
>COG1053 SdhA Succinate dehydrogenase/fumarate reductase, flavoprotein subunit [Energy production and conversion] Back     alignment and domain information
>KOG2187 consensus tRNA uracil-5-methyltransferase and related tRNA-modifying enzymes [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK12814 putative NADPH-dependent glutamate synthase small subunit; Provisional Back     alignment and domain information
>PRK12810 gltD glutamate synthase subunit beta; Reviewed Back     alignment and domain information
>COG0029 NadB Aspartate oxidase [Coenzyme metabolism] Back     alignment and domain information
>KOG0399 consensus Glutamate synthase [Amino acid transport and metabolism] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query850
2fk7_A318 Crystal Structure Of Hma (Mmaa4) From Mycobacterium 5e-24
1kp9_A287 Crystal Structure Of Mycolic Acid Cyclopropane Synt 5e-24
1kpg_A287 Crystal Structure Of Mycolic Acid Cyclopropane Synt 9e-24
1tpy_A287 Structure Of The Cyclopropane Synthase Mmaa2 From M 2e-23
1l1e_A287 Crystal Structure Of Mycolic Acid Cyclopropane Synt 9e-21
1kpi_A302 Crystal Structure Of Mycolic Acid Cyclopropane Synt 2e-20
3rha_A482 The Crystal Structure Of Oxidoreductase From Arthro 1e-06
2yg6_A453 Structure-Based Redesign Of Cofactor Binding In Put 2e-06
4f84_A320 Structure Analysis Of Geranyl Diphosphate Methyltra 3e-06
2yg5_A453 Structure-Based Redesign Of Cofactor Binding In Put 5e-06
2yg3_A453 Structure-Based Redesign Of Cofactor Binding In Put 5e-06
2yg7_A453 Structure-Based Redesign Of Cofactor Binding In Put 5e-06
1sez_A504 Crystal Structure Of Protoporphyrinogen Ix Oxidase 1e-05
4e0v_A497 Structure Of L-Amino Acid Oxidase From The B. Jarar 6e-05
2z5y_A513 Crystal Structure Of Human Monoamine Oxidase A (G11 3e-04
2bxr_A527 Human Monoamine Oxidase A In Complex With Clorgylin 3e-04
2z5x_A513 Crystal Structure Of Human Monoamine Oxidase A With 3e-04
1reo_A486 L-Amino Acid Oxidase From Agkistrodon Halys Pallas 7e-04
3kve_A486 Structure Of Native L-Amino Acid Oxidase From Viper 9e-04
3bus_A273 Crystal Structure Of Rebm Length = 273 9e-04
>pdb|2FK7|A Chain A, Crystal Structure Of Hma (Mmaa4) From Mycobacterium Tuberculosis, Apo- Form Length = 318 Back     alignment and structure 
Iteration: 1

 Score =  110 bits (274), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 84/277 (30%), Positives = 124/277 (44%), Gaps = 40/277 (14%)
Query: 562 NISHHYDVSNELFSLFLGKSMMYSCAIFKSEYEDLDVAQMRKVSLLIEKARVNKGLDVLE 621
           +I  HYDVS++ F+LF   +  YSCA F+     L+ AQ  KV L ++K  +  G+ +L+
Sbjct: 37  DIQAHYDVSDDFFALFQDPTRTYSCAYFEPPELTLEEAQYAKVDLNLDKLDLKPGMTLLD 96
Query: 622 IGCGWGTLAIEIVKQTGCKYTGITLSEEQLKYTETKVKEAGLQDHIRLYLCDYRQMPEVK 681
           IGCGWGT     V++      G+TLS+ Q    E  +         ++ L  +    E  
Sbjct: 97  IGCGWGTTMRRAVERFDVNVIGLTLSKNQHARCEQVLASIDTNRSRQVLLQGWEDFAE-- 154
Query: 682 KYDTIISCEMIENVGHEYIEEFFGCCESXXXXXXXXXXQFSSVPDQCYD----GHRLS-- 735
             D I+S E  E+ GHE  ++FF  C +          Q SSV    Y+    G +LS  
Sbjct: 155 PVDRIVSIEAFEHFGHENYDDFFKRCFNIMPADGRMTVQ-SSVSYHPYEMAARGKKLSFE 213
Query: 736 ----PGFITEYVFPGGCLPSLNRITSAMTSSSRLCVEHLENIGI----------HFYQTL 781
                 FI   +FPGG LP           S+ + VEH E  G           H+ +TL
Sbjct: 214 TARFIKFIVTEIFPGGRLP-----------STEMMVEHGEKAGFTVPEPLSLRPHYIKTL 262
Query: 782 RCWRTNLMEKQSEILALGFNE------KFIRTWEYYF 812
           R W   L   + + + +   E      K++R  E+YF
Sbjct: 263 RIWGDTLQSNKDKAIEVTSEEVYNRYMKYLRGCEHYF 299
>pdb|1KP9|A Chain A, Crystal Structure Of Mycolic Acid Cyclopropane Synthase Cmaa1, Apo-Form Length = 287 Back     alignment and structure
>pdb|1KPG|A Chain A, Crystal Structure Of Mycolic Acid Cyclopropane Synthase Cmaa1 Complexed With Sah And Ctab Length = 287 Back     alignment and structure
>pdb|1TPY|A Chain A, Structure Of The Cyclopropane Synthase Mmaa2 From Mycobacterium Tuberculosis Length = 287 Back     alignment and structure
>pdb|1L1E|A Chain A, Crystal Structure Of Mycolic Acid Cyclopropane Synthase Pcaa Complexed With S-Adenosyl-L-Homocysteine Length = 287 Back     alignment and structure
>pdb|1KPI|A Chain A, Crystal Structure Of Mycolic Acid Cyclopropane Synthase Cmaa2 Complexed With Sah And Dddmab Length = 302 Back     alignment and structure
>pdb|3RHA|A Chain A, The Crystal Structure Of Oxidoreductase From Arthrobacter Aurescens Length = 482 Back     alignment and structure
>pdb|2YG6|A Chain A, Structure-Based Redesign Of Cofactor Binding In Putrescine Oxidase: P15i-A394c Double Mutant Length = 453 Back     alignment and structure
>pdb|4F84|A Chain A, Structure Analysis Of Geranyl Diphosphate Methyltransferase In Complex With Sam Length = 320 Back     alignment and structure
>pdb|2YG5|A Chain A, Structure-Based Redesign Of Cofactor Binding In Putrescine Oxidase: A394c Mutant Length = 453 Back     alignment and structure
>pdb|2YG3|A Chain A, Structure-Based Redesign Of Cofactor Binding In Putrescine Oxidase: Wild Type Enzyme Length = 453 Back     alignment and structure
>pdb|2YG7|A Chain A, Structure-Based Redesign Of Cofactor Binding In Putrescine Oxidase: A394c-A396t-Q431g Triple Mutant Length = 453 Back     alignment and structure
>pdb|1SEZ|A Chain A, Crystal Structure Of Protoporphyrinogen Ix Oxidase Length = 504 Back     alignment and structure
>pdb|4E0V|A Chain A, Structure Of L-Amino Acid Oxidase From The B. Jararacussu Venom Length = 497 Back     alignment and structure
>pdb|2Z5Y|A Chain A, Crystal Structure Of Human Monoamine Oxidase A (G110a) With Harmine Length = 513 Back     alignment and structure
>pdb|2BXR|A Chain A, Human Monoamine Oxidase A In Complex With Clorgyline, Crystal Form A Length = 527 Back     alignment and structure
>pdb|2Z5X|A Chain A, Crystal Structure Of Human Monoamine Oxidase A With Harmine Length = 513 Back     alignment and structure
>pdb|1REO|A Chain A, L-Amino Acid Oxidase From Agkistrodon Halys Pallas Length = 486 Back     alignment and structure
>pdb|3KVE|A Chain A, Structure Of Native L-Amino Acid Oxidase From Vipera Ammodytes Ammodytes: Stabilization Of The Quaternary Structure By Divalent Ions And Structural Changes In The Dynamic Active Site Length = 486 Back     alignment and structure
>pdb|3BUS|A Chain A, Crystal Structure Of Rebm Length = 273 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query850
2fk8_A318 Methoxy mycolic acid synthase 4; S-adenosylmethion 1e-122
1kpg_A287 CFA synthase;, cyclopropane-fatty-acyl-phospholipi 1e-117
3hem_A302 Cyclopropane-fatty-acyl-phospholipid synthase 2; p 1e-109
3vc1_A312 Geranyl diphosphate 2-C-methyltransferase; rossman 8e-64
2b9w_A424 Putative aminooxidase; isomerase, conjugated linol 1e-61
3ujc_A266 Phosphoethanolamine N-methyltransferase; parasite; 8e-50
3bus_A273 REBM, methyltransferase; rebeccamycin synthesis; H 4e-49
1nkv_A256 Hypothetical protein YJHP; structural genomics, PS 8e-48
2o57_A297 Putative sarcosine dimethylglycine methyltransfera 1e-38
3nks_A477 Protoporphyrinogen oxidase; FAD containing protein 2e-30
3nrn_A421 Uncharacterized protein PF1083; alpha-beta protein 1e-23
3i6d_A470 Protoporphyrinogen oxidase; protein-inhibitor comp 2e-22
3lov_A475 Protoporphyrinogen oxidase; structural genomics, J 2e-22
2ivd_A478 PPO, PPOX, protoporphyrinogen oxidase; porphyrin b 3e-21
1sez_A504 Protoporphyrinogen oxidase, mitochondrial; FAD-bin 4e-20
3f4k_A257 Putative methyltransferase; structural genomics, P 9e-20
3ocj_A305 Putative exported protein; structural genomics, PS 4e-18
3utf_A513 UDP-galactopyranose mutase; nucleotide binding, fl 1e-17
4dsg_A484 UDP-galactopyranose mutase; rossmann fold, flavin 2e-17
3k7m_X431 6-hydroxy-L-nicotine oxidase; enantiomeric substra 2e-17
2yg5_A453 Putrescine oxidase; oxidoreductase, flavin; HET: F 4e-17
3kkz_A267 Uncharacterized protein Q5LES9; putative methyltra 5e-16
3ka7_A425 Oxidoreductase; structural genomics, PSI-2, protei 1e-15
1s3e_A520 Amine oxidase [flavin-containing] B; human monoami 5e-15
2p8j_A209 S-adenosylmethionine-dependent methyltransferase; 3e-14
2jae_A489 L-amino acid oxidase; oxidoreductase, dimerisation 4e-14
3dtn_A234 Putative methyltransferase MM_2633; structural gen 1e-13
3dlc_A219 Putative S-adenosyl-L-methionine-dependent methylt 1e-13
1ve3_A227 Hypothetical protein PH0226; dimer, riken structur 3e-13
2iid_A498 L-amino-acid oxidase; flavoenzyme, FAD binding dom 6e-13
2vvm_A495 Monoamine oxidase N; FAD, peroxisome, flavoprotein 7e-13
3kr9_A225 SAM-dependent methyltransferase; class I rossmann- 7e-13
1wzn_A252 SAM-dependent methyltransferase; structural genomi 9e-13
3gnl_A244 Uncharacterized protein, DUF633, LMOF2365_1472; st 3e-12
2z3y_A662 Lysine-specific histone demethylase 1; chromatin, 6e-12
3jwh_A217 HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena 6e-12
2xag_A852 Lysine-specific histone demethylase 1; amine oxida 1e-11
3cc8_A230 Putative methyltransferase; structural genomics, j 1e-11
1y8c_A246 S-adenosylmethionine-dependent methyltransferase; 2e-11
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-11
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 8e-04
2aot_A292 HMT, histamine N-methyltransferase; classic methyl 4e-11
3g2m_A299 PCZA361.24; SAM-dependent methyltransferase, glyco 4e-11
3ofk_A216 Nodulation protein S; NODS, N-methyltransferase, S 4e-11
2e1m_A376 L-glutamate oxidase; L-amino acid oxidase, FAD, L- 5e-11
3jwg_A219 HEN1, methyltransferase type 12; 1.90A {Clostridiu 5e-11
2p7i_A250 Hypothetical protein; putative methyltransferase, 5e-11
1yvv_A336 Amine oxidase, flavin-containing; oxidoreductase, 6e-11
3d2l_A243 SAM-dependent methyltransferase; ZP_00538691.1, st 6e-11
1b37_A472 Protein (polyamine oxidase); flavin-dependent amin 8e-11
3hnr_A220 Probable methyltransferase BT9727_4108; structural 9e-11
3lec_A230 NADB-rossmann superfamily protein; PSI, MCSG, stru 1e-10
3bkx_A275 SAM-dependent methyltransferase; YP_807781.1, cycl 2e-10
3e23_A211 Uncharacterized protein RPA2492; alpha-beta protei 4e-10
3m70_A286 Tellurite resistance protein TEHB homolog; structu 4e-10
3mgg_A276 Methyltransferase; NYSGXRC, PSI-II, protein struct 8e-10
2bi7_A384 UDP-galactopyranose mutase; FAD, flavoprotein, iso 8e-10
3bxo_A239 N,N-dimethyltransferase; desosamine, sugar, carboh 2e-09
2xvm_A199 Tellurite resistance protein TEHB; antibiotic resi 2e-09
3gu3_A284 Methyltransferase; alpha-beta protein, structural 2e-09
1i8t_A367 UDP-galactopyranose mutase; rossman fold, FAD, con 4e-09
3dli_A240 Methyltransferase; PSI-II, NYSGXRC, structural gen 4e-09
2ex4_A241 Adrenal gland protein AD-003; methyltransferase, s 5e-09
3ou2_A218 SAM-dependent methyltransferase; O-methyltransfera 6e-09
3pfg_A263 N-methyltransferase; N,N-dimethyltransferase, SAM 9e-09
3ggd_A245 SAM-dependent methyltransferase; YP_325210.1, stru 1e-08
1o94_A729 Tmadh, trimethylamine dehydrogenase; electron tran 1e-08
1ps9_A671 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel 1e-08
3k30_A690 Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP bi 1e-08
3rp8_A407 Flavoprotein monooxygenase; FAD-binding protein, o 1e-08
3thr_A293 Glycine N-methyltransferase; GNMT, folate, methylt 1e-08
3sm3_A235 SAM-dependent methyltransferases; NESG, structural 1e-08
3g5l_A253 Putative S-adenosylmethionine dependent methyltran 1e-08
3hdq_A397 UDP-galactopyranose mutase; substrate and inhibito 2e-08
1rp0_A284 ARA6, thiazole biosynthetic enzyme; protein ligand 2e-08
2vou_A397 2,6-dihydroxypyridine hydroxylase; oxidoreductase, 2e-08
3htx_A950 HEN1; HEN1, small RNA methyltransferase, protein-R 2e-08
3l8d_A242 Methyltransferase; structural genomics, PSI, nysgr 3e-08
3uox_A545 Otemo; baeyer-villiger monooxygenase, oxidoreducta 5e-08
3e8s_A227 Putative SAM dependent methyltransferase; NP_74470 7e-08
1xtp_A254 LMAJ004091AAA; SGPP, structural genomics, PSI, pro 8e-08
1dus_A194 MJ0882; hypothetical protein, methanococcus jannas 9e-08
1rsg_A516 FMS1 protein; FAD binding motif, oxidoreductase; H 9e-08
3alj_A379 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; 9e-08
1w4x_A542 Phenylacetone monooxygenase; baeyer-villiger, FAD; 9e-08
4ap3_A549 Steroid monooxygenase; oxidoreductase, baeyer-vill 1e-07
3jsk_A344 Cypbp37 protein; octameric thiazole synthase, bios 1e-07
1ri5_A298 MRNA capping enzyme; methyltransferase, M7G, messe 1e-07
3iv6_A261 Putative Zn-dependent alcohol dehydrogenase; alpha 1e-07
3lcc_A235 Putative methyl chloride transferase; halide methy 2e-07
3h2b_A203 SAM-dependent methyltransferase; alpha-beta protei 2e-07
2gjc_A326 Thiazole biosynthetic enzyme, mitochondrial; gluta 3e-07
4a9w_A357 Monooxygenase; baeyer-villiger, FAD, oxidoreductas 3e-07
2vdc_G456 Glutamate synthase [NADPH] small chain; oxidoreduc 4e-07
2xdo_A398 TETX2 protein; tetracycline degradation, tigecycli 5e-07
3e1t_A512 Halogenase; flavoprotein; HET: FAD; 2.05A {Chondro 6e-07
3atr_A453 Conserved archaeal protein; saturating double bond 7e-07
2kw5_A202 SLR1183 protein; structural genomics, northeast st 8e-07
2gv8_A447 Monooxygenase; FMO, FAD, NADPH, cofactor complex, 9e-07
3cgg_A195 SAM-dependent methyltransferase; NP_600671.1, meth 1e-06
1ryi_A382 Glycine oxidase; flavoprotein, protein-inhibitor c 1e-06
3i3l_A591 Alkylhalidase CMLS; flavin-dependent halogenase, c 1e-06
3bkw_A243 MLL3908 protein, S-adenosylmethionine dependent me 2e-06
1xxl_A239 YCGJ protein; structural genomics, protein structu 2e-06
3cgv_A397 Geranylgeranyl reductase related protein; NP_39399 2e-06
3qj4_A342 Renalase; FAD/NAD(P)-binding rossmann fold superfa 3e-06
3dme_A369 Conserved exported protein; structural genomics, P 3e-06
1d5t_A433 Guanine nucleotide dissociation inhibitor; ultra-h 3e-06
3nix_A421 Flavoprotein/dehydrogenase; structural genomics, P 3e-06
2gag_A965 Heterotetrameric sarcosine oxidase alpha-subunit; 3e-06
2pxx_A215 Uncharacterized protein MGC2408; structural genomi 4e-06
3i9f_A170 Putative type 11 methyltransferase; structural gen 4e-06
1gte_A1025 Dihydropyrimidine dehydrogenase; electron transfer 5e-06
3nyc_A381 D-arginine dehydrogenase; FAD, imino-arginine, oxi 5e-06
3c96_A410 Flavin-containing monooxygenase; FAD, oxidoreducta 7e-06
3dh0_A219 SAM dependent methyltransferase; cystal structure, 8e-06
3fpf_A298 Mtnas, putative uncharacterized protein; thermonic 9e-06
3gwf_A540 Cyclohexanone monooxygenase; flavoprotein biocatal 1e-05
1k0i_A394 P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, h 1e-05
3eey_A197 Putative rRNA methylase; rRNA methylation, S-adeno 1e-05
1v0j_A399 UDP-galactopyranose mutase; flavoprotein, isomeras 1e-05
1qo8_A566 Flavocytochrome C3 fumarate reductase; oxidoreduct 1e-05
3ccf_A279 Cyclopropane-fatty-acyl-phospholipid synthase; YP_ 1e-05
3c4a_A381 Probable tryptophan hydroxylase VIOD; alpha-beta p 1e-05
1y0p_A571 Fumarate reductase flavoprotein subunit; flavocyto 2e-05
4at0_A510 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidore 2e-05
3lpm_A259 Putative methyltransferase; structural genomics, p 2e-05
1d4d_A572 Flavocytochrome C fumarate reductase; oxidoreducta 2e-05
3ayj_A721 Pro-enzyme of L-phenylalanine oxidase; amino acid 2e-05
2oln_A397 NIKD protein; flavoprotein, rossmann fold, oxidore 2e-05
1vl5_A260 Unknown conserved protein BH2331; putative methylt 2e-05
1nv8_A284 HEMK protein; class I adoMet-dependent methyltrans 2e-05
3axb_A448 Putative oxidoreductase; dinucleotide-binding fold 3e-05
3ihg_A535 RDME; flavoenzyme, anthracycline, polyketide biosy 3e-05
2bcg_G453 Secretory pathway GDP dissociation inhibitor; RABG 3e-05
1y56_B382 Sarcosine oxidase; dehydrogenase, protein-protein 3e-05
3g3e_A351 D-amino-acid oxidase; FAD, flavoprotein, oxidoredu 3e-05
2xve_A464 Flavin-containing monooxygenase; oxidoreductase; H 3e-05
3evz_A230 Methyltransferase; NYSGXRC, NEW YORK SGX research 4e-05
3ihm_A430 Styrene monooxygenase A; rossman fold, anti-parall 4e-05
2uzz_A372 N-methyl-L-tryptophan oxidase; N-methyltryptophan 4e-05
1c0p_A363 D-amino acid oxidase; alpha-beta-alpha motif, flav 4e-05
2gf3_A389 MSOX, monomeric sarcosine oxidase; flavoprotein ox 6e-05
2r0c_A549 REBC; flavin adenine dinucleotide, monooxygenase, 8e-05
2qa2_A499 CABE, polyketide oxygenase CABE; FAD, angucycline, 1e-04
1yb2_A275 Hypothetical protein TA0852; structural genomics, 1e-04
2qa1_A500 PGAE, polyketide oxygenase PGAE; FAD, angucycline, 1e-04
3p1w_A475 Rabgdi protein; GDI RAB, malaria, structural genom 1e-04
4dcm_A375 Ribosomal RNA large subunit methyltransferase G; 2 1e-04
1im8_A244 YECO; methyltransferase, adenosylhomocysteine, str 1e-04
3dmg_A381 Probable ribosomal RNA small subunit methyltransf; 2e-04
2p35_A259 Trans-aconitate 2-methyltransferase; SAM dependent 2e-04
2x3n_A399 Probable FAD-dependent monooxygenase; oxidoreducta 3e-04
3d1c_A369 Flavin-containing putative monooxygenase; NP_37310 5e-04
3g07_A292 7SK snRNA methylphosphate capping enzyme; structur 5e-04
3tm4_A373 TRNA (guanine N2-)-methyltransferase TRM14; rossma 5e-04
2yqz_A263 Hypothetical protein TTHA0223; RNA methyltransfera 5e-04
3v76_A417 Flavoprotein; structural genomics, PSI-biology, NE 7e-04
2gqf_A401 Hypothetical protein HI0933; structural genomics, 7e-04
3fmw_A570 Oxygenase; mithramycin, baeyer-villiger, flavin bi 7e-04
3tma_A354 Methyltransferase; thump domain; 2.05A {Thermus th 7e-04
3m33_A226 Uncharacterized protein; structural genomics, PSI- 8e-04
1cjc_A460 Protein (adrenodoxin reductase); flavoenzyme, MAD 9e-04
>2fk8_A Methoxy mycolic acid synthase 4; S-adenosylmethionine-dependent methyltransferase fold, trans; HET: SAM; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 2fk7_A* 3ha3_A* 3ha5_A* 3ha7_A* Length = 318 Back     alignment and structure
 Score =  369 bits (950), Expect = e-122
 Identities = 76/306 (24%), Positives = 124/306 (40%), Gaps = 13/306 (4%)

Query: 538 RSIASAKYYFRHISRKNTLAQARRNISHHYDVSNELFSLFLGKSMMYSCAIFKSEYEDLD 597
             +    +                +I  HYDVS++ F+LF   +  YSCA F+     L+
Sbjct: 13  GLVPRGSHMAEKPISPTKTRTRFEDIQAHYDVSDDFFALFQDPTRTYSCAYFEPPELTLE 72

Query: 598 VAQMRKVSLLIEKARVNKGLDVLEIGCGWGTLAIEIVKQTGCKYTGITLSEEQLKYTETK 657
            AQ  KV L ++K  +  G+ +L+IGCGWGT     V++      G+TLS+ Q    E  
Sbjct: 73  EAQYAKVDLNLDKLDLKPGMTLLDIGCGWGTTMRRAVERFDVNVIGLTLSKNQHARCEQV 132

Query: 658 VKEAGLQDHIRLYLCDYRQMPEVKKYDTIISCEMIENVGHEYIEEFFGCCESLLAEHGLL 717
           +         ++ L  +    E    D I+S E  E+ GHE  ++FF  C +++   G +
Sbjct: 133 LASIDTNRSRQVLLQGWEDFAE--PVDRIVSIEAFEHFGHENYDDFFKRCFNIMPADGRM 190

Query: 718 LLQFSSVPDQCYDGHRLSPG---------FITEYVFPGGCLPSLNRITSAMTSSSRLCVE 768
            +Q S          R             FI   +FPGG LPS   +       +   V 
Sbjct: 191 TVQSSVSYHPYEMAARGKKLSFETARFIKFIVTEIFPGGRLPSTEMMVEHG-EKAGFTVP 249

Query: 769 HLENIGIHFYQTLRCWRTNLMEKQSEILALGFNEKFIRTWEYYFDYCAAGFKSRTLGNYQ 828
              ++  H+ +TLR W   L   + + + +   E+    +  Y   C   F    L    
Sbjct: 250 EPLSLRPHYIKTLRIWGDTLQSNKDKAIEVTS-EEVYNRYMKYLRGCEHYFTDEMLDCSL 308

Query: 829 IVFSRP 834
           + + +P
Sbjct: 309 VTYLKP 314
>1kpg_A CFA synthase;, cyclopropane-fatty-acyl-phospholipid synthase 1; mixed alpha beta fold, structural genomics, PSI; HET: SAH 16A; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kp9_A* 1kph_A* 1tpy_A* 1l1e_A* Length = 287 Back     alignment and structure
>3hem_A Cyclopropane-fatty-acyl-phospholipid synthase 2; protein-ligand complex, cytoplasm, lipid synthesis, methyltransferase; HET: D22; 2.39A {Mycobacterium tuberculosis} PDB: 1kpi_A* Length = 302 Back     alignment and structure
>3vc1_A Geranyl diphosphate 2-C-methyltransferase; rossmann fold, methyltransferase fold, SAM-dependent methyltransferase; HET: SAH GST GOL; 1.82A {Streptomyces coelicolor} PDB: 3vc2_A* Length = 312 Back     alignment and structure
>2b9w_A Putative aminooxidase; isomerase, conjugated linoleic acid, FAD; HET: FAD 12P; 1.95A {Propionibacterium acnes} PDB: 2b9x_A* 2b9y_A* 2ba9_A* 2bab_A* 2bac_A* Length = 424 Back     alignment and structure
>3ujc_A Phosphoethanolamine N-methyltransferase; parasite; HET: PC; 1.19A {Plasmodium falciparum} PDB: 3uj9_A* 3uj6_A* 3uj7_A* 3uj8_A* 3uja_A 3ujb_A* 4fgz_A* 3ujd_A* Length = 266 Back     alignment and structure
>3bus_A REBM, methyltransferase; rebeccamycin synthesis; HET: SAH; 2.65A {Lechevalieria aerocolonigenes} Length = 273 Back     alignment and structure
>1nkv_A Hypothetical protein YJHP; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.90A {Escherichia coli} SCOP: c.66.1.21 Length = 256 Back     alignment and structure
>2o57_A Putative sarcosine dimethylglycine methyltransferase; structural genomics, protein structure initiative, PSI-2; 1.95A {Galdieria sulphuraria} SCOP: c.66.1.18 Length = 297 Back     alignment and structure
>3nks_A Protoporphyrinogen oxidase; FAD containing protein, PPO, variegate porphyria disease, VP oxidoreductase-oxidoreductase inhibitor complex; HET: ACJ FAD; 1.90A {Homo sapiens} Length = 477 Back     alignment and structure
>3nrn_A Uncharacterized protein PF1083; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: AMP; 2.10A {Pyrococcus furiosus} Length = 421 Back     alignment and structure
>3i6d_A Protoporphyrinogen oxidase; protein-inhibitor complex, cytoplasm, FAD, flavoprotein, oxidoreductase, porphyrin biosynthesis; HET: FAD ACJ; 2.90A {Bacillus subtilis} Length = 470 Back     alignment and structure
>3lov_A Protoporphyrinogen oxidase; structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: FAD; 2.06A {Exiguobacterium sibiricum} Length = 475 Back     alignment and structure
>2ivd_A PPO, PPOX, protoporphyrinogen oxidase; porphyrin biosynthesis, chlorophyll biosynthesis, oxidoreductase, HAEM biosynthesis, heme biosynthesis; HET: ACJ FAD TWN; 2.3A {Myxococcus xanthus} SCOP: c.3.1.2 d.16.1.5 PDB: 2ive_A* Length = 478 Back     alignment and structure
>1sez_A Protoporphyrinogen oxidase, mitochondrial; FAD-binding, para-hydroxy-benzoate-hydroxylase fold (PHBH- fold), monotopic membrane-binding domain; HET: FAD OMN TON; 2.90A {Nicotiana tabacum} SCOP: c.3.1.2 d.16.1.5 Length = 504 Back     alignment and structure
>3f4k_A Putative methyltransferase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacteroides thetaiotaomicron} PDB: 3t0i_A* 3svz_A* 3sxj_A* Length = 257 Back     alignment and structure
>3ocj_A Putative exported protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: PLM; 1.39A {Bordetella parapertussis} Length = 305 Back     alignment and structure
>3utf_A UDP-galactopyranose mutase; nucleotide binding, flavin adenine dinucleotide BIND isomerase; HET: FDA; 2.25A {Aspergillus fumigatus} PDB: 3ute_A* 3utg_A* 3uth_A* 3ukh_A* 3ukf_A* 3uka_A* 3ukl_A* 3ukk_A* 3ukq_A* 3ukp_A* Length = 513 Back     alignment and structure
>4dsg_A UDP-galactopyranose mutase; rossmann fold, flavin adenine dinucleotide, isomerase; HET: FAD UDP; 2.25A {Trypanosoma cruzi} PDB: 4dsh_A* Length = 484 Back     alignment and structure
>3k7m_X 6-hydroxy-L-nicotine oxidase; enantiomeric substrates, flavoenzymes, nicotine degradation, oxidoreductase; HET: FAD GP7; 1.95A {Arthrobacter nicotinovorans} PDB: 3k7q_X* 3ng7_X* 3ngc_X* 3nh3_X* 3nho_X* 3nk0_X* 3nk1_X* 3nk2_X* 3nn0_X* 3nn6_X* 3k7t_A* Length = 431 Back     alignment and structure
>2yg5_A Putrescine oxidase; oxidoreductase, flavin; HET: FAD; 1.90A {Rhodococcus erythropolis} PDB: 2yg6_A* 2yg3_A* 2yg4_A* 2yg7_A* 3rha_A* Length = 453 Back     alignment and structure
>3kkz_A Uncharacterized protein Q5LES9; putative methyltransferase, BFR250, NESG, structural genomics, PSI-2; HET: SAM; 1.68A {Bacteroides fragilis nctc 9343} PDB: 3e7p_A 3t7s_A* 3t7r_A* 3t7t_A* Length = 267 Back     alignment and structure
>3ka7_A Oxidoreductase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: FAD; 1.80A {Methanosarcina mazei} Length = 425 Back     alignment and structure
>1s3e_A Amine oxidase [flavin-containing] B; human monoamine oxidase, inhibitor binding, rasagiline, enantioselectivity, oxidoreductase; HET: FAD RHP; 1.60A {Homo sapiens} SCOP: c.3.1.2 d.16.1.5 PDB: 1gos_A* 1oj9_A* 1ojb_A* 1ojc_A* 1ojd_A* 1s2q_A* 1s2y_A* 1oja_A* 1s3b_A* 2bk3_A* 2byb_A* 2c64_A* 2c65_A* 2c66_A* 2c67_A* 2c70_A* 2v5z_A* 2v60_A* 2v61_A* 2vrl_A* ... Length = 520 Back     alignment and structure
>2p8j_A S-adenosylmethionine-dependent methyltransferase; NP_349143.1; HET: PGE GOL; 2.00A {Clostridium acetobutylicum} Length = 209 Back     alignment and structure
>2jae_A L-amino acid oxidase; oxidoreductase, dimerisation mode, hydride transfer mechanism, GR2-family, flavoenzyme, FAD containing; HET: FAD; 1.25A {Rhodococcus opacus} PDB: 2jb1_A* 2jb2_A* 2jb3_A* Length = 489 Back     alignment and structure
>3dtn_A Putative methyltransferase MM_2633; structural genomics, unknown function, PSI-2, protein structure initiative; 2.09A {Methanosarcina mazei} Length = 234 Back     alignment and structure
>3dlc_A Putative S-adenosyl-L-methionine-dependent methyltransferase; structural genomics, joint center for structural genomics; HET: MSE SAM; 1.15A {Methanococcus maripaludis} Length = 219 Back     alignment and structure
>1ve3_A Hypothetical protein PH0226; dimer, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function, NPPSFA; HET: SAM; 2.10A {Pyrococcus horikoshii} SCOP: c.66.1.43 Length = 227 Back     alignment and structure
>2iid_A L-amino-acid oxidase; flavoenzyme, FAD binding domain, reaction mechanism, sustrat binding, oxidoreductase; HET: NAG FUC PHE FAD; 1.80A {Calloselasma rhodostoma} SCOP: c.3.1.2 d.16.1.5 PDB: 1f8s_A* 1f8r_A* 1reo_A* 1tdk_A* 1tdn_A* 1tdo_A* 3kve_A* 4e0v_A* Length = 498 Back     alignment and structure
>2vvm_A Monoamine oxidase N; FAD, peroxisome, flavoprotein, oxidoreductase, enantioselectivity, directed evolution variant; HET: FAD; 1.85A {Aspergillus niger} PDB: 2vvl_A* 2vvl_G* Length = 495 Back     alignment and structure
>3kr9_A SAM-dependent methyltransferase; class I rossmann-like methyltransferase fold; 2.00A {Streptococcus pneumoniae} PDB: 3ku1_A* Length = 225 Back     alignment and structure
>1wzn_A SAM-dependent methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: SAH; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.43 Length = 252 Back     alignment and structure
>3gnl_A Uncharacterized protein, DUF633, LMOF2365_1472; structural genomics, PSI-2, protein structure initiative; 1.50A {Listeria monocytogenes str} Length = 244 Back     alignment and structure
>2z3y_A Lysine-specific histone demethylase 1; chromatin, nucleosome, transcription, LSD1, alternative splicing, chromatin regulator, coiled coil; HET: F2N; 2.25A {Homo sapiens} SCOP: a.4.1.18 c.3.1.2 d.16.1.5 PDB: 2ejr_A* 2z5u_A* 3abt_A* 3abu_A* 2y48_A* 2v1d_A* 2h94_A* 2iw5_A* 2uxn_A* 2uxx_A* 2hko_A* 2dw4_A* 2x0l_A* 2l3d_A Length = 662 Back     alignment and structure
>3jwh_A HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena variabilis} PDB: 3jwj_A Length = 217 Back     alignment and structure
>2xag_A Lysine-specific histone demethylase 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_A* 2xah_A* 2xaj_A* 2xaq_A* 2xas_A* 2com_A Length = 852 Back     alignment and structure
>3cc8_A Putative methyltransferase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS transferase; 1.64A {Bacillus cereus} Length = 230 Back     alignment and structure
>1y8c_A S-adenosylmethionine-dependent methyltransferase; structural genomics, protein structure initiative, PSI; 2.50A {Clostridium acetobutylicum} SCOP: c.66.1.43 Length = 246 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2aot_A HMT, histamine N-methyltransferase; classic methyltransferase fold, protein-drug complex; HET: CSO 2PM SAH; 1.90A {Homo sapiens} SCOP: c.66.1.19 PDB: 1jqd_A* 2aou_A* 2aov_A* 2aox_A* 1jqe_A* 2aow_A* Length = 292 Back     alignment and structure
>3g2m_A PCZA361.24; SAM-dependent methyltransferase, glycopeptide antibiotics biosynthesis, structural genomics; 2.00A {Amycolatopsis orientalis} PDB: 3g2o_A* 3g2p_A* 3g2q_A* Length = 299 Back     alignment and structure
>3ofk_A Nodulation protein S; NODS, N-methyltransferase, SAH, SAM, NOD factor, fixation, symbiosis, alpha/beta structure; HET: SAH; 1.85A {Bradyrhizobium SP} PDB: 3ofj_A* Length = 216 Back     alignment and structure
>2e1m_A L-glutamate oxidase; L-amino acid oxidase, FAD, L-GOX, flavo oxidoreductase; HET: FAD; 2.80A {Streptomyces SP} Length = 376 Back     alignment and structure
>3jwg_A HEN1, methyltransferase type 12; 1.90A {Clostridium thermocellum} PDB: 3jwi_A Length = 219 Back     alignment and structure
>2p7i_A Hypothetical protein; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; 1.74A {Pectobacterium atrosepticum SCRI1043} SCOP: c.66.1.41 PDB: 2p7h_A Length = 250 Back     alignment and structure
>3d2l_A SAM-dependent methyltransferase; ZP_00538691.1, structural G joint center for structural genomics, JCSG; HET: MSE; 1.90A {Exiguobacterium sibiricum 255-15} Length = 243 Back     alignment and structure
>1b37_A Protein (polyamine oxidase); flavin-dependent amine oxidase, oxidoreductase; HET: NAG FCA MAN FAD; 1.90A {Zea mays} SCOP: c.3.1.2 d.16.1.5 PDB: 1b5q_A* 1h81_A* 1h82_A* 1h83_A* 1h84_A* 1h86_A* 3kpf_A* 3ku9_A* 3l1r_A* Length = 472 Back     alignment and structure
>3hnr_A Probable methyltransferase BT9727_4108; structural genomics, PSI-2, protein structure initiative; 2.80A {Bacillus thuringiensis serovarkonkukian} Length = 220 Back     alignment and structure
>3lec_A NADB-rossmann superfamily protein; PSI, MCSG, structural genomics, midwest CENT structural genomics, protein structure initiative; 1.80A {Streptococcus agalactiae} Length = 230 Back     alignment and structure
>3bkx_A SAM-dependent methyltransferase; YP_807781.1, cyclopropane-fatty-acyl-phospholipid synthase-L protein, methyltransferase domain; 1.85A {Lactobacillus casei} Length = 275 Back     alignment and structure
>3e23_A Uncharacterized protein RPA2492; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAM; 1.60A {Rhodopseudomonas palustris} Length = 211 Back     alignment and structure
>3m70_A Tellurite resistance protein TEHB homolog; structural genomics, PSI-2, protein ST initiative; 1.95A {Haemophilus influenzae} Length = 286 Back     alignment and structure
>3mgg_A Methyltransferase; NYSGXRC, PSI-II, protein structure initiative, structural genomics, NEW YORK SGX research center for structural genomics; 1.86A {Methanosarcina mazei} Length = 276 Back     alignment and structure
>2bi7_A UDP-galactopyranose mutase; FAD, flavoprotein, isomerase, lipopolysaccharide biosynthesi; HET: FAD; 2.0A {Klebsiella pneumoniae} SCOP: c.4.1.3 d.16.1.7 PDB: 2bi8_A* 1wam_A* 3inr_A* 3gf4_A* 3int_A* 3kyb_A* Length = 384 Back     alignment and structure
>3bxo_A N,N-dimethyltransferase; desosamine, sugar, carbohydrate, antibiotic, SAM, adoMet; HET: SAM UPP; 2.00A {Streptomyces venezuelae} Length = 239 Back     alignment and structure
>2xvm_A Tellurite resistance protein TEHB; antibiotic resistance, transferase; HET: SAH; 1.48A {Escherichia coli} PDB: 2xva_A* 4dq0_A* 2i6g_A* Length = 199 Back     alignment and structure
>3gu3_A Methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; HET: SAH; 2.30A {Bacillus cereus} PDB: 2gh1_A Length = 284 Back     alignment and structure
>1i8t_A UDP-galactopyranose mutase; rossman fold, FAD, contractase, isomerase; HET: FAD; 2.40A {Escherichia coli} SCOP: c.4.1.3 d.16.1.7 Length = 367 Back     alignment and structure
>3dli_A Methyltransferase; PSI-II, NYSGXRC, structural genomics, protein structure initiative; 2.46A {Archaeoglobus fulgidus} Length = 240 Back     alignment and structure
>2ex4_A Adrenal gland protein AD-003; methyltransferase, structural genomics, SGC, structural genomics consortium; HET: SAH; 1.75A {Homo sapiens} SCOP: c.66.1.42 Length = 241 Back     alignment and structure
>3ou2_A SAM-dependent methyltransferase; O-methyltransferase, SAH; HET: SAH; 1.50A {Streptomyces luridus} PDB: 3ou6_A* 3ou7_A* Length = 218 Back     alignment and structure
>3pfg_A N-methyltransferase; N,N-dimethyltransferase, SAM binding, DTDP-linked sugar BIND transferase; HET: SAM TLO; 1.35A {Streptomyces fradiae} PDB: 3pfh_A* 3px3_A* 3px2_A* Length = 263 Back     alignment and structure
>3ggd_A SAM-dependent methyltransferase; YP_325210.1, structural GEN joint center for structural genomics, JCSG; HET: SAH; 2.11A {Anabaena variabilis atcc 29413} Length = 245 Back     alignment and structure
>1o94_A Tmadh, trimethylamine dehydrogenase; electron transport, protein complex; HET: FMN ADP AMP; 2.0A {Methylophilus methylotrophus} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 PDB: 1djn_A* 1o95_A* 2tmd_A* 1djq_A* Length = 729 Back     alignment and structure
>1ps9_A 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel, flavodoxin, flavin, electron transfer, hydride transfer, oxidoreductase; HET: FAD FMN NAP MDE; 2.20A {Escherichia coli} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 Length = 671 Back     alignment and structure
>3k30_A Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP binding site, oxidoreductase; HET: FMN ADP; 2.70A {Pimelobacter simplex} Length = 690 Back     alignment and structure
>3rp8_A Flavoprotein monooxygenase; FAD-binding protein, oxidoreductase; HET: FAD; 1.97A {Klebsiella pneumoniae} PDB: 3rp7_A* 3rp6_A* Length = 407 Back     alignment and structure
>3thr_A Glycine N-methyltransferase; GNMT, folate, methyltransferase binding, liver cytosol, transferase-transferase inhibitor C; HET: C2F TAM; 2.00A {Rattus norvegicus} PDB: 3ths_A* 1xva_A* 1d2c_A 1kia_A* 1nbh_A* 1bhj_A* 2idj_A 2idk_A* 1d2g_A 1d2h_A* 1nbi_A* 1r8x_A 1r8y_A 1r74_A* 2azt_A* Length = 293 Back     alignment and structure
>3sm3_A SAM-dependent methyltransferases; NESG, structural genomics, PSI-biology, protein structure in northeast structural genomics; 2.20A {Methanosarcina mazei} Length = 235 Back     alignment and structure
>3g5l_A Putative S-adenosylmethionine dependent methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.35A {Listeria monocytogenes str} Length = 253 Back     alignment and structure
>3hdq_A UDP-galactopyranose mutase; substrate and inhibitor, isomerase; HET: GDU FAD; 2.36A {Deinococcus radiodurans} PDB: 3hdy_A* 3he3_A* 3mj4_A* Length = 397 Back     alignment and structure
>1rp0_A ARA6, thiazole biosynthetic enzyme; protein ligand complex, biosynthetic protein; HET: AHZ HTO; 1.60A {Arabidopsis thaliana} SCOP: c.3.1.6 Length = 284 Back     alignment and structure
>2vou_A 2,6-dihydroxypyridine hydroxylase; oxidoreductase, aromatic hydroxylase, nicotine degradation, mono-oxygenase; HET: FAD; 2.6A {Arthrobacter nicotinovorans} SCOP: c.3.1.2 d.16.1.2 Length = 397 Back     alignment and structure
>3htx_A HEN1; HEN1, small RNA methyltransferase, protein-RNA complex; HET: SAH; 3.10A {Arabidopsis thaliana} Length = 950 Back     alignment and structure
>3l8d_A Methyltransferase; structural genomics, PSI, nysgrc, protein structure initiative, NEW YORK SGX research center for structural genomics; 1.70A {Bacillus thuringiensis} Length = 242 Back     alignment and structure
>3uox_A Otemo; baeyer-villiger monooxygenase, oxidoreductase; HET: FAD; 1.96A {Pseudomonas putida} PDB: 3uov_A* 3uoy_A* 3uoz_A* 3up4_A* 3up5_A* Length = 545 Back     alignment and structure
>3e8s_A Putative SAM dependent methyltransferase; NP_744700.1, structural genomics, joint center for structural genom JCSG; HET: SAH; 2.10A {Pseudomonas putida KT2440} Length = 227 Back     alignment and structure
>1xtp_A LMAJ004091AAA; SGPP, structural genomics, PSI, protein structure initiative dependent methyltransferase; HET: SAI; 1.94A {Leishmania major} SCOP: c.66.1.42 Length = 254 Back     alignment and structure
>1dus_A MJ0882; hypothetical protein, methanococcus jannaschii, structural genomics, BSGC structure funded by NIH; 1.80A {Methanocaldococcus jannaschii} SCOP: c.66.1.4 Length = 194 Back     alignment and structure
>1rsg_A FMS1 protein; FAD binding motif, oxidoreductase; HET: FAD; 1.90A {Saccharomyces cerevisiae} PDB: 1z6l_A* 3bi2_A* 3bi4_A* 3bi5_A* 3bnm_B* 3bnu_B* 3cn8_B* 3cnd_B* 3cnp_B* 3cns_A* 3cnt_B* 1yy5_A* 1xpq_A* Length = 516 Back     alignment and structure
>3alj_A 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; alpha/beta fold, oxidoreductase; HET: FAD; 1.48A {Mesorhizobium loti} PDB: 3alh_A* 3ali_A* 3gmb_A* 3gmc_A* 3alk_A* 3alm_A* 3all_A* Length = 379 Back     alignment and structure
>1w4x_A Phenylacetone monooxygenase; baeyer-villiger, FAD; HET: FAD; 1.7A {Thermobifida fusca} SCOP: c.3.1.5 c.3.1.5 PDB: 2ylr_A* 2yls_A* 2ylt_A* 2ym1_A* 2ylw_A* 2ym2_A* 2ylx_A* 2ylz_A* Length = 542 Back     alignment and structure
>4ap3_A Steroid monooxygenase; oxidoreductase, baeyer-villiger; HET: FAD NAP; 2.39A {Rhodococcus rhodochrous} PDB: 4aox_A* 4aos_A* 4ap1_A* Length = 549 Back     alignment and structure
>3jsk_A Cypbp37 protein; octameric thiazole synthase, biosynthetic protein; HET: AHZ; 2.70A {Neurospora crassa} Length = 344 Back     alignment and structure
>1ri5_A MRNA capping enzyme; methyltransferase, M7G, messenger RNA CAP, structural genomics, PSI, protein structure initiative; 2.10A {Encephalitozoon cuniculi} SCOP: c.66.1.34 PDB: 1ri2_A* 1ri3_A* 1ri1_A* 1ri4_A 1z3c_A* 2hv9_A* Length = 298 Back     alignment and structure
>3iv6_A Putative Zn-dependent alcohol dehydrogenase; alpha/beta fold, rossmann-fold, structural genomics, PSI-2, structure initiative; HET: SAM; 2.70A {Rhodobacter sphaeroides} Length = 261 Back     alignment and structure
>3lcc_A Putative methyl chloride transferase; halide methyltransferase; HET: SAH; 1.80A {Arabidopsis thaliana} Length = 235 Back     alignment and structure
>3h2b_A SAM-dependent methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAH; 2.00A {Corynebacterium glutamicum atcc 13032} Length = 203 Back     alignment and structure
>2gjc_A Thiazole biosynthetic enzyme, mitochondrial; glutathione reductase type II family, thiazole synthase, mitochondria DNA repair; HET: AHZ; 1.82A {Saccharomyces cerevisiae} SCOP: c.3.1.6 PDB: 3fpz_A* Length = 326 Back     alignment and structure
>4a9w_A Monooxygenase; baeyer-villiger, FAD, oxidoreductase; HET: FAD; 2.72A {Stenotrophomonas maltophilia} Length = 357 Back     alignment and structure
>2vdc_G Glutamate synthase [NADPH] small chain; oxidoreductase, amidotransferase, ammonia assimilation, iron, zymogen; HET: OMT FMN AKG FAD; 9.50A {Azospirillum brasilense} Length = 456 Back     alignment and structure
>2xdo_A TETX2 protein; tetracycline degradation, tigecycline, flavin, bacteroides F oxidoreductase; HET: FAD; 2.09A {Bacteroides thetaiotaomicron} PDB: 2y6q_A* 2xyo_A* 2y6r_A* 3p9u_A* Length = 398 Back     alignment and structure
>3e1t_A Halogenase; flavoprotein; HET: FAD; 2.05A {Chondromyces crocatus} Length = 512 Back     alignment and structure
>3atr_A Conserved archaeal protein; saturating double bonds, archaeal membrane precursor, like 2 geranylgeranylglyceryl phosphate; HET: FDA; 1.80A {Sulfolobus acidocaldarius} PDB: 3atq_A* Length = 453 Back     alignment and structure
>2kw5_A SLR1183 protein; structural genomics, northeast structural genomics consortium (NESG), PSI-2, protein structure initiative, unknown function; NMR {Synechocystis} PDB: 3mer_A Length = 202 Back     alignment and structure
>2gv8_A Monooxygenase; FMO, FAD, NADPH, cofactor complex, PSI, structura genomics, protein structure initiative; HET: FAD NDP; 2.10A {Schizosaccharomyces pombe} SCOP: c.3.1.5 c.3.1.5 PDB: 2gvc_A* 1vqw_A* Length = 447 Back     alignment and structure
>3cgg_A SAM-dependent methyltransferase; NP_600671.1, methyltransferase domain, structural genomics; HET: NHE CIT; 2.00A {Corynebacterium glutamicum atcc 13032} Length = 195 Back     alignment and structure
>1ryi_A Glycine oxidase; flavoprotein, protein-inhibitor complex, oxidoreductase; HET: FAD; 1.80A {Bacillus subtilis} SCOP: c.3.1.2 d.16.1.3 PDB: 3if9_A* 1ng4_A* 1ng3_A* Length = 382 Back     alignment and structure
>3i3l_A Alkylhalidase CMLS; flavin-dependent halogenase, chloramphenicol biosynthesis, halogenation reaction, structural genomics; HET: FAD; 2.20A {Streptomyces venezuelae} Length = 591 Back     alignment and structure
>3bkw_A MLL3908 protein, S-adenosylmethionine dependent methyltransferase; NP_104914.1; HET: MSE; 1.60A {Mesorhizobium loti} Length = 243 Back     alignment and structure
>1xxl_A YCGJ protein; structural genomics, protein structure initiative, PSI, NEW YORK SGX research center for structural genomics, nysgxrc; 2.10A {Bacillus subtilis} SCOP: c.66.1.41 PDB: 2glu_A* Length = 239 Back     alignment and structure
>3qj4_A Renalase; FAD/NAD(P)-binding rossmann fold superfamily, flavin contain oxidoreductase, monoamine oxidase, NAD, extracellular, oxidoreductase; HET: FAD; 2.50A {Homo sapiens} Length = 342 Back     alignment and structure
>3dme_A Conserved exported protein; structural genomics, PSI-2, PROT structure initiative, northeast structural genomics consort NESG; HET: FAD TLA; 1.70A {Bordetella pertussis} Length = 369 Back     alignment and structure
>1d5t_A Guanine nucleotide dissociation inhibitor; ultra-high resolution, hydrolase inhibitor; 1.04A {Bos taurus} SCOP: c.3.1.3 d.16.1.6 PDB: 1lv0_A* 1gnd_A Length = 433 Back     alignment and structure
>3nix_A Flavoprotein/dehydrogenase; structural genomics, PSI-2, NES protein structure initiative, northeast structural genomics consortium; HET: FAD; 2.60A {Cytophaga hutchinsonii} Length = 421 Back     alignment and structure
>2gag_A Heterotetrameric sarcosine oxidase alpha-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_A* 1x31_A* 1vrq_A* 3ad7_A* 3ad8_A* 3ad9_A* 3ada_A* Length = 965 Back     alignment and structure
>2pxx_A Uncharacterized protein MGC2408; structural genomics consortium, SGC, methyltransferase, LOC84291, transferase; HET: SAH; 1.30A {Homo sapiens} Length = 215 Back     alignment and structure
>3i9f_A Putative type 11 methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.50A {Sulfolobus solfataricus} Length = 170 Back     alignment and structure
>1gte_A Dihydropyrimidine dehydrogenase; electron transfer, flavin, iron-sulfur clusters, pyrimidine catabolism, 5-fluorouracil degradation, oxidoreductase; HET: FMN FAD; 1.65A {Sus scrofa} SCOP: a.1.2.2 c.1.4.1 c.3.1.1 c.4.1.1 d.58.1.5 PDB: 1gt8_A* 1gth_A* 1h7w_A* 1h7x_A* Length = 1025 Back     alignment and structure
>3nyc_A D-arginine dehydrogenase; FAD, imino-arginine, oxidoreductas; HET: FAD IAR; 1.06A {Pseudomonas aeruginosa} PDB: 3nye_A* 3nyf_A* 3sm8_A* Length = 381 Back     alignment and structure
>3c96_A Flavin-containing monooxygenase; FAD, oxidoreductase, PF01266, NESG, PAR240, structural genomics, PSI-2; HET: FAD; 1.90A {Pseudomonas aeruginosa PAO1} SCOP: c.3.1.2 d.16.1.2 PDB: 2rgj_A* Length = 410 Back     alignment and structure
>3dh0_A SAM dependent methyltransferase; cystal structure, PSI-2, NYSGXRC, structural genomics, protein structure initiative; HET: SAM; 2.72A {Aquifex aeolicus} Length = 219 Back     alignment and structure
>3fpf_A Mtnas, putative uncharacterized protein; thermonicotianamine, nicotianamine, biosynthetic protein; HET: TNA MTA; 1.66A {Methanothermobacter thermautotrophicusorganism_taxid} PDB: 3fpe_A* 3fph_A* 3fpg_A* 3fpj_A* 3o31_A* Length = 298 Back     alignment and structure
>3gwf_A Cyclohexanone monooxygenase; flavoprotein biocatalysis baeyer-villiger oxidation green CH monooxygenase, oxidoreductase; HET: FAD NAP; 2.20A {Rhodococcus SP} PDB: 3gwd_A* 3ucl_A* Length = 540 Back     alignment and structure
>1k0i_A P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, hydrolase; HET: FAD PHB; 1.80A {Pseudomonas aeruginosa} SCOP: c.3.1.2 d.16.1.2 PDB: 1k0j_A* 1k0l_A* 1doc_A* 1d7l_A* 1dod_A* 1doe_A* 1ius_A* 1iut_A* 1iuu_A* 1iuv_A* 1iuw_A* 1iux_A* 1pxb_A* 1pxc_A* 1dob_A* 1ykj_A* 1pxa_A* 1pbe_A* 1pdh_A* 1phh_A* ... Length = 394 Back     alignment and structure
>3eey_A Putative rRNA methylase; rRNA methylation, S-adenosyl-methionine, structural genomics structure initiative, PSI; HET: SAM; 2.20A {Clostridium thermocellum atcc 27405} Length = 197 Back     alignment and structure
>1v0j_A UDP-galactopyranose mutase; flavoprotein, isomerase; HET: FAD BCN; 2.25A {Mycobacterium tuberculosis} Length = 399 Back     alignment and structure
>1qo8_A Flavocytochrome C3 fumarate reductase; oxidoreductase; HET: HEM FAD; 2.15A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 Length = 566 Back     alignment and structure
>3ccf_A Cyclopropane-fatty-acyl-phospholipid synthase; YP_321342.1, putative methyltransferase; 1.90A {Anabaena variabilis atcc 29413} Length = 279 Back     alignment and structure
>3c4a_A Probable tryptophan hydroxylase VIOD; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.30A {Chromobacterium violaceum atcc 12472} Length = 381 Back     alignment and structure
>1y0p_A Fumarate reductase flavoprotein subunit; flavocytochrome, mesaconate, oxidoreductase; HET: HEM FAD; 1.50A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1qjd_A* 2b7s_A* 1jry_A* 2b7r_A* 1ksu_A* 1jrz_A* 1jrx_A* 1m64_A* 1p2h_A* 1p2e_A* 1kss_A* 1e39_A* 1q9i_A* 1lj1_A* Length = 571 Back     alignment and structure
>4at0_A 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidoreductase, dehydogenase, steroid catabolism; HET: FAD; 1.60A {Rhodococcus jostii} PDB: 4at2_A* Length = 510 Back     alignment and structure
>3lpm_A Putative methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium, nysgxrc; 2.40A {Listeria monocytogenes} Length = 259 Back     alignment and structure
>1d4d_A Flavocytochrome C fumarate reductase; oxidoreductase; HET: HEM FAD; 2.50A {Shewanella oneidensis} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1d4e_A* 1d4c_A* Length = 572 Back     alignment and structure
>3ayj_A Pro-enzyme of L-phenylalanine oxidase; amino acid oxidase, flavoenzyme, L- binding, oxidoreductase; HET: FAD PHE; 1.10A {Pseudomonas} PDB: 2yr4_A* 2yr6_A* 3ayi_A* 2yr5_A* 3ayl_A* Length = 721 Back     alignment and structure
>2oln_A NIKD protein; flavoprotein, rossmann fold, oxidoreductase; HET: FAD; 1.15A {Streptomyces tendae} PDB: 2olo_A* 3hzl_A* 2q6u_A* Length = 397 Back     alignment and structure
>1vl5_A Unknown conserved protein BH2331; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; HET: MSE; 1.95A {Bacillus halodurans} SCOP: c.66.1.41 Length = 260 Back     alignment and structure
>1nv8_A HEMK protein; class I adoMet-dependent methyltransferase; HET: SAM MEQ; 2.20A {Thermotoga maritima} SCOP: c.66.1.30 PDB: 1nv9_A* 1vq1_A* 1sg9_A* Length = 284 Back     alignment and structure
>3axb_A Putative oxidoreductase; dinucleotide-binding fold; HET: FAD; 1.92A {Aeropyrum pernix} PDB: 3vqr_A* Length = 448 Back     alignment and structure
>3ihg_A RDME; flavoenzyme, anthracycline, polyketide biosynthesis, merohedral twinning, enzyme mechanism, hydroxylase, flavoprotein; HET: FAD VAK; 2.49A {Streptomyces purpurascens} Length = 535 Back     alignment and structure
>2bcg_G Secretory pathway GDP dissociation inhibitor; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.3.1.3 c.3.1.3 d.16.1.6 PDB: 1ukv_G* 3cpi_G 3cph_G 3cpj_G* Length = 453 Back     alignment and structure
>1y56_B Sarcosine oxidase; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} Length = 382 Back     alignment and structure
>3g3e_A D-amino-acid oxidase; FAD, flavoprotein, oxidoreductase, PER; HET: FAD G3E; 2.20A {Homo sapiens} PDB: 3cuk_A* 2e48_A* 2e49_A* 2e4a_A* 2e82_A* 2du8_A* 1ve9_A* 1dao_A* 1ddo_A* 1kif_A* 1an9_A* 1evi_A* Length = 351 Back     alignment and structure
>2xve_A Flavin-containing monooxygenase; oxidoreductase; HET: FAD; 1.99A {Methylophaga aminisulfidivorans} PDB: 2xvf_A* 2xvh_A* 2xvi_A* 2xvj_A* 2xlt_A* 2vqb_A* 2vq7_A* 2xlu_A* 2xlp_A* 2xls_A* 2xlr_A* Length = 464 Back     alignment and structure
>3evz_A Methyltransferase; NYSGXRC, NEW YORK SGX research CE structural genomics, protein structure initiative, pyrococc furiosus, PSI-2; 2.20A {Pyrococcus furiosus} Length = 230 Back     alignment and structure
>3ihm_A Styrene monooxygenase A; rossman fold, anti-parallel beta strands, dimer, cavity, oxidoreductase; 2.30A {Pseudomonas putida} Length = 430 Back     alignment and structure
>2uzz_A N-methyl-L-tryptophan oxidase; N-methyltryptophan oxidase (MTOX), oxidative demethylation of N-methyl-L-tryptophan, FAD, flavoenzyme; HET: FAD; 3.2A {Escherichia coli} Length = 372 Back     alignment and structure
>1c0p_A D-amino acid oxidase; alpha-beta-alpha motif, flavin containing protein, oxidoreductase; HET: FAD; 1.20A {Rhodosporidium toruloides} SCOP: c.4.1.2 d.16.1.3 PDB: 1c0i_A* 1c0l_A* 1c0k_A* Length = 363 Back     alignment and structure
>2gf3_A MSOX, monomeric sarcosine oxidase; flavoprotein oxidase, inhibitor 2-furoic acid, oxidoreductas; HET: FAD; 1.30A {Bacillus SP} SCOP: c.3.1.2 d.16.1.3 PDB: 1el7_A* 1el8_A* 1el9_A* 1eli_A* 1l9e_A* 2a89_A* 2gb0_A* 1el5_A* 3qse_A* 3qsm_A* 3qss_A* 3bhk_A* 3bhf_A* 3m12_A* 3m13_A* 3m0o_A* 1l9c_A* 1l9d_A* 1zov_A* Length = 389 Back     alignment and structure
>2r0c_A REBC; flavin adenine dinucleotide, monooxygenase, oxidoreductase; HET: FAD; 1.80A {Lechevalieria aerocolonigenes} PDB: 2r0g_A* 2r0p_A* 3ept_A* Length = 549 Back     alignment and structure
>2qa2_A CABE, polyketide oxygenase CABE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 2.70A {Streptomyces} Length = 499 Back     alignment and structure
>1yb2_A Hypothetical protein TA0852; structural genomics, methyltransferase, thermoplasma acidoph midwest center for structural genomics, MCSG; 2.01A {Thermoplasma acidophilum} SCOP: c.66.1.13 Length = 275 Back     alignment and structure
>2qa1_A PGAE, polyketide oxygenase PGAE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 1.80A {Streptomyces} Length = 500 Back     alignment and structure
>3p1w_A Rabgdi protein; GDI RAB, malaria, structural genomics consortium, SGC, trans PF10_0345, protein transport; 1.85A {Plasmodium falciparum 3D7} Length = 475 Back     alignment and structure
>4dcm_A Ribosomal RNA large subunit methyltransferase G; 23S rRNA (guanine1835-N2)-methyltransferase; HET: SAM; 2.30A {Escherichia coli} Length = 375 Back     alignment and structure
>1im8_A YECO; methyltransferase, adenosylhomocysteine, structural genomics hypothetical protein, structure 2 function project, S2F, TR; HET: SAI; 2.20A {Haemophilus influenzae RD} SCOP: c.66.1.14 Length = 244 Back     alignment and structure
>3dmg_A Probable ribosomal RNA small subunit methyltransf; monomethyltranserase, 16S rRNA methyltransferase, N2 G1207 methyltransferase; HET: SAH; 1.55A {Thermus thermophilus} PDB: 3dmf_A* 3dmh_A* 2zul_A* 2zwv_A* Length = 381 Back     alignment and structure
>2p35_A Trans-aconitate 2-methyltransferase; SAM dependent methyltrans agrobacterium tumefaciens, structural genomics, PSI-2; HET: SAH; 1.95A {Agrobacterium tumefaciens str} Length = 259 Back     alignment and structure
>2x3n_A Probable FAD-dependent monooxygenase; oxidoreductase; HET: FAD; 1.75A {Pseudomonas aeruginosa} Length = 399 Back     alignment and structure
>3d1c_A Flavin-containing putative monooxygenase; NP_373108.1, struc genomics, joint center for structural genomics, JCSG; HET: FAD UNL; 2.40A {Staphylococcus aureus} Length = 369 Back     alignment and structure
>3g07_A 7SK snRNA methylphosphate capping enzyme; structural genomics consortium (SGC), methyltransferase, phosphoprotein, S-adenosyl-L-methionine; HET: SAM; 2.65A {Homo sapiens} Length = 292 Back     alignment and structure
>3tm4_A TRNA (guanine N2-)-methyltransferase TRM14; rossmann fold, thump domain, tRNA methyltransferase; HET: SAM; 1.95A {Pyrococcus furiosus} PDB: 3tlj_A* 3tm5_A* Length = 373 Back     alignment and structure
>2yqz_A Hypothetical protein TTHA0223; RNA methyltransferase, SAM, structural genomics, NPPSFA; HET: SAM; 1.80A {Thermus thermophilus} PDB: 2yr0_A Length = 263 Back     alignment and structure
>3v76_A Flavoprotein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: FDA; 2.51A {Sinorhizobium meliloti} Length = 417 Back     alignment and structure
>2gqf_A Hypothetical protein HI0933; structural genomics, FAD-utilizing protein, flavoprotein, PS protein structure initiative; HET: FAD; 2.70A {Haemophilus influenzae} SCOP: c.3.1.8 e.74.1.1 Length = 401 Back     alignment and structure
>3fmw_A Oxygenase; mithramycin, baeyer-villiger, flavin binding protein, oxidoreductase; HET: FAD; 2.89A {Streptomyces argillaceus} Length = 570 Back     alignment and structure
>3tma_A Methyltransferase; thump domain; 2.05A {Thermus thermophilus} Length = 354 Back     alignment and structure
>3m33_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, MCSG, midwest center for structural genomics; 2.19A {Deinococcus radiodurans} Length = 226 Back     alignment and structure
>1cjc_A Protein (adrenodoxin reductase); flavoenzyme, MAD analysis, electron transferase, oxidoreductase; HET: FAD; 1.70A {Bos taurus} SCOP: c.3.1.1 c.4.1.1 PDB: 1e1k_A* 1e1l_A* 1e1m_A* 1e1n_A* 1e6e_A* Length = 460 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query850
3hem_A302 Cyclopropane-fatty-acyl-phospholipid synthase 2; p 100.0
1kpg_A287 CFA synthase;, cyclopropane-fatty-acyl-phospholipi 100.0
2fk8_A318 Methoxy mycolic acid synthase 4; S-adenosylmethion 100.0
3nks_A477 Protoporphyrinogen oxidase; FAD containing protein 100.0
3bus_A273 REBM, methyltransferase; rebeccamycin synthesis; H 100.0
3i6d_A470 Protoporphyrinogen oxidase; protein-inhibitor comp 100.0
2ivd_A478 PPO, PPOX, protoporphyrinogen oxidase; porphyrin b 100.0
3lov_A475 Protoporphyrinogen oxidase; structural genomics, J 100.0
3ka7_A425 Oxidoreductase; structural genomics, PSI-2, protei 99.98
4gde_A513 UDP-galactopyranose mutase; flavin adenine dinucle 99.97
2b9w_A424 Putative aminooxidase; isomerase, conjugated linol 99.97
2o57_A297 Putative sarcosine dimethylglycine methyltransfera 99.97
2vvm_A495 Monoamine oxidase N; FAD, peroxisome, flavoprotein 99.97
1sez_A504 Protoporphyrinogen oxidase, mitochondrial; FAD-bin 99.97
3nrn_A421 Uncharacterized protein PF1083; alpha-beta protein 99.97
1s3e_A520 Amine oxidase [flavin-containing] B; human monoami 99.97
2yg5_A453 Putrescine oxidase; oxidoreductase, flavin; HET: F 99.96
4dgk_A501 Phytoene dehydrogenase; the FAD/NAD(P)-binding ros 99.96
4dsg_A484 UDP-galactopyranose mutase; rossmann fold, flavin 99.96
3vc1_A312 Geranyl diphosphate 2-C-methyltransferase; rossman 99.95
2bi7_A384 UDP-galactopyranose mutase; FAD, flavoprotein, iso 99.94
1i8t_A367 UDP-galactopyranose mutase; rossman fold, FAD, con 99.94
3k7m_X431 6-hydroxy-L-nicotine oxidase; enantiomeric substra 99.94
1v0j_A399 UDP-galactopyranose mutase; flavoprotein, isomeras 99.94
1rsg_A516 FMS1 protein; FAD binding motif, oxidoreductase; H 99.94
1b37_A472 Protein (polyamine oxidase); flavin-dependent amin 99.94
2jae_A489 L-amino acid oxidase; oxidoreductase, dimerisation 99.93
3ujc_A266 Phosphoethanolamine N-methyltransferase; parasite; 99.93
2iid_A498 L-amino-acid oxidase; flavoenzyme, FAD binding dom 99.93
4gut_A776 Lysine-specific histone demethylase 1B; histone de 99.92
3bkx_A275 SAM-dependent methyltransferase; YP_807781.1, cycl 99.92
3kkz_A267 Uncharacterized protein Q5LES9; putative methyltra 99.91
3qj4_A342 Renalase; FAD/NAD(P)-binding rossmann fold superfa 99.91
2xag_A852 Lysine-specific histone demethylase 1; amine oxida 99.91
2z3y_A662 Lysine-specific histone demethylase 1; chromatin, 99.91
1dl5_A317 Protein-L-isoaspartate O-methyltransferase; isoasp 99.9
3ayj_A721 Pro-enzyme of L-phenylalanine oxidase; amino acid 99.88
2bcg_G453 Secretory pathway GDP dissociation inhibitor; RABG 99.88
3hdq_A397 UDP-galactopyranose mutase; substrate and inhibito 99.87
4htf_A285 S-adenosylmethionine-dependent methyltransferase; 99.87
3dli_A240 Methyltransferase; PSI-II, NYSGXRC, structural gen 99.86
1yvv_A336 Amine oxidase, flavin-containing; oxidoreductase, 99.86
3f4k_A257 Putative methyltransferase; structural genomics, P 99.84
1nkv_A256 Hypothetical protein YJHP; structural genomics, PS 99.84
1vl5_A260 Unknown conserved protein BH2331; putative methylt 99.81
1d5t_A433 Guanine nucleotide dissociation inhibitor; ultra-h 99.81
3p1w_A475 Rabgdi protein; GDI RAB, malaria, structural genom 99.8
3mgg_A276 Methyltransferase; NYSGXRC, PSI-II, protein struct 99.8
4gek_A261 TRNA (CMO5U34)-methyltransferase; structural genom 99.8
1pjz_A203 Thiopurine S-methyltransferase; polymorphism, S-ad 99.79
3iv6_A261 Putative Zn-dependent alcohol dehydrogenase; alpha 99.79
3ou2_A218 SAM-dependent methyltransferase; O-methyltransfera 99.79
2e1m_A376 L-glutamate oxidase; L-amino acid oxidase, FAD, L- 99.78
1xxl_A239 YCGJ protein; structural genomics, protein structu 99.78
1ri5_A298 MRNA capping enzyme; methyltransferase, M7G, messe 99.77
3dtn_A234 Putative methyltransferase MM_2633; structural gen 99.76
3h2b_A203 SAM-dependent methyltransferase; alpha-beta protei 99.76
3hnr_A220 Probable methyltransferase BT9727_4108; structural 99.76
3dh0_A219 SAM dependent methyltransferase; cystal structure, 99.76
3lcc_A235 Putative methyl chloride transferase; halide methy 99.76
3p2e_A225 16S rRNA methylase; methyltransferase, transferase 99.75
3fpf_A298 Mtnas, putative uncharacterized protein; thermonic 99.75
3ocj_A305 Putative exported protein; structural genomics, PS 99.75
3dlc_A219 Putative S-adenosyl-L-methionine-dependent methylt 99.74
3jwg_A219 HEN1, methyltransferase type 12; 1.90A {Clostridiu 99.74
3g2m_A299 PCZA361.24; SAM-dependent methyltransferase, glyco 99.74
3jwh_A217 HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena 99.73
4fsd_A383 Arsenic methyltransferase; rossmann fold; 1.75A {C 99.73
2yqz_A263 Hypothetical protein TTHA0223; RNA methyltransfera 99.73
3e23_A211 Uncharacterized protein RPA2492; alpha-beta protei 99.73
1xtp_A254 LMAJ004091AAA; SGPP, structural genomics, PSI, pro 99.73
2ex4_A241 Adrenal gland protein AD-003; methyltransferase, s 99.73
2p7i_A250 Hypothetical protein; putative methyltransferase, 99.72
2gb4_A252 Thiopurine S-methyltransferase; 18204406, thiopuri 99.72
2xvm_A199 Tellurite resistance protein TEHB; antibiotic resi 99.72
2p35_A259 Trans-aconitate 2-methyltransferase; SAM dependent 99.72
3g5l_A253 Putative S-adenosylmethionine dependent methyltran 99.72
3ccf_A279 Cyclopropane-fatty-acyl-phospholipid synthase; YP_ 99.71
2r3s_A335 Uncharacterized protein; methyltransferase domain, 99.71
3l8d_A242 Methyltransferase; structural genomics, PSI, nysgr 99.71
2y1w_A348 Histone-arginine methyltransferase CARM1; histone 99.7
3i53_A332 O-methyltransferase; CO-complex, rossmann-like fol 99.69
2g72_A289 Phenylethanolamine N-methyltransferase; HET: SAM F 99.69
3pfg_A263 N-methyltransferase; N,N-dimethyltransferase, SAM 99.69
3ege_A261 Putative methyltransferase from antibiotic biosyn 99.69
3gwz_A369 MMCR; methyltransferase, mitomycin, S-adenosyl met 99.69
4e2x_A416 TCAB9; kijanose, tetronitrose, tetradeoxy sugar, s 99.69
3e8s_A227 Putative SAM dependent methyltransferase; NP_74470 99.69
3m70_A286 Tellurite resistance protein TEHB homolog; structu 99.69
2a14_A263 Indolethylamine N-methyltransferase; SGC,INMT, str 99.68
1zx0_A236 Guanidinoacetate N-methyltransferase; structural g 99.68
3gu3_A284 Methyltransferase; alpha-beta protein, structural 99.68
1ve3_A227 Hypothetical protein PH0226; dimer, riken structur 99.68
3mcz_A352 O-methyltransferase; adomet_mtases, S-adenosylmeth 99.68
3i9f_A170 Putative type 11 methyltransferase; structural gen 99.67
3b3j_A480 Histone-arginine methyltransferase CARM1; protein 99.67
3bgv_A313 MRNA CAP guanine-N7 methyltransferase; alternative 99.67
1y8c_A246 S-adenosylmethionine-dependent methyltransferase; 99.67
3mq2_A218 16S rRNA methyltransferase; methyltranferase, ribo 99.67
1qzz_A374 RDMB, aclacinomycin-10-hydroxylase; anthracycline, 99.67
3sm3_A235 SAM-dependent methyltransferases; NESG, structural 99.67
3g5t_A299 Trans-aconitate 3-methyltransferase; structural ge 99.67
2p8j_A209 S-adenosylmethionine-dependent methyltransferase; 99.67
2kw5_A202 SLR1183 protein; structural genomics, northeast st 99.66
3ofk_A216 Nodulation protein S; NODS, N-methyltransferase, S 99.66
3bkw_A243 MLL3908 protein, S-adenosylmethionine dependent me 99.66
3dp7_A363 SAM-dependent methyltransferase; structural genomi 99.66
3grz_A205 L11 mtase, ribosomal protein L11 methyltransferase 99.66
3cc8_A230 Putative methyltransferase; structural genomics, j 99.66
1x19_A359 CRTF-related protein; methyltransferase, bacterioc 99.65
3bxo_A239 N,N-dimethyltransferase; desosamine, sugar, carboh 99.65
1tw3_A360 COMT, carminomycin 4-O-methyltransferase; anthracy 99.65
4hg2_A257 Methyltransferase type 11; structural genomics, PS 99.65
3mti_A185 RRNA methylase; SAM-dependent, PSI, MCSG, structur 99.64
2ip2_A334 Probable phenazine-specific methyltransferase; pyo 99.64
3dxy_A218 TRNA (guanine-N(7)-)-methyltransferase; rossmann f 99.64
3njr_A204 Precorrin-6Y methylase; methyltransferase, decarbo 99.64
3d2l_A243 SAM-dependent methyltransferase; ZP_00538691.1, st 99.63
2i62_A265 Nicotinamide N-methyltransferase; structural genom 99.63
3lst_A348 CALO1 methyltransferase; calicheamicin, enediyne, 99.63
2aot_A292 HMT, histamine N-methyltransferase; classic methyl 99.63
2vdw_A302 Vaccinia virus capping enzyme D1 subunit; nucleoti 99.63
3cgg_A195 SAM-dependent methyltransferase; NP_600671.1, meth 99.62
1wzn_A252 SAM-dependent methyltransferase; structural genomi 99.62
3thr_A293 Glycine N-methyltransferase; GNMT, folate, methylt 99.62
3nyc_A381 D-arginine dehydrogenase; FAD, imino-arginine, oxi 99.62
3hm2_A178 Precorrin-6Y C5,15-methyltransferase; alpha-beta-s 99.62
3e05_A204 Precorrin-6Y C5,15-methyltransferase (decarboxyla; 99.61
3lbf_A210 Protein-L-isoaspartate O-methyltransferase; modifi 99.61
3evz_A230 Methyltransferase; NYSGXRC, NEW YORK SGX research 99.6
3orh_A236 Guanidinoacetate N-methyltransferase; structura ge 99.6
3fzg_A200 16S rRNA methylase; methyltransferase, plasmid, tr 99.6
3g07_A292 7SK snRNA methylphosphate capping enzyme; structur 99.6
1dus_A194 MJ0882; hypothetical protein, methanococcus jannas 99.59
3uwp_A438 Histone-lysine N-methyltransferase, H3 lysine-79; 99.59
3p9n_A189 Possible methyltransferase (methylase); RV2966C, a 99.59
2gs9_A211 Hypothetical protein TT1324; methyl transferase, s 99.59
2avn_A260 Ubiquinone/menaquinone biosynthesis methyltransfe 99.59
3eey_A197 Putative rRNA methylase; rRNA methylation, S-adeno 99.58
3ggd_A245 SAM-dependent methyltransferase; YP_325210.1, stru 99.58
4df3_A233 Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; 99.58
1yub_A245 Ermam, rRNA methyltransferase; MLS antibiotics; NM 99.58
1vlm_A219 SAM-dependent methyltransferase; possible histamin 99.58
4a6d_A353 Hydroxyindole O-methyltransferase; melatonin, circ 99.57
3htx_A950 HEN1; HEN1, small RNA methyltransferase, protein-R 99.57
2nxc_A254 L11 mtase, ribosomal protein L11 methyltransferase 99.57
3reo_A368 (ISO)eugenol O-methyltransferase; directed evoluti 99.56
3ps9_A676 TRNA 5-methylaminomethyl-2-thiouridine biosynthes 99.56
1xdz_A240 Methyltransferase GIDB; MCSG, protein structure in 99.56
2qe6_A274 Uncharacterized protein TFU_2867; putative methylt 99.56
3pvc_A689 TRNA 5-methylaminomethyl-2-thiouridine biosynthes 99.56
2esr_A177 Methyltransferase; structural genomics, hypothetic 99.56
3p9c_A364 Caffeic acid O-methyltransferase; S-adenosylmethio 99.55
4dcm_A375 Ribosomal RNA large subunit methyltransferase G; 2 99.55
3dje_A438 Fructosyl amine: oxygen oxidoreductase; fructosyl- 99.54
3dr5_A221 Putative O-methyltransferase; Q8NRD3, CGL1119, PF0 99.54
3lpm_A259 Putative methyltransferase; structural genomics, p 99.54
3ntv_A232 MW1564 protein; rossmann fold, putative methyltran 99.54
2h00_A254 Methyltransferase 10 domain containing protein; st 99.53
2pxx_A215 Uncharacterized protein MGC2408; structural genomi 99.53
2yxe_A215 Protein-L-isoaspartate O-methyltransferase; rossma 99.53
1ryi_A382 Glycine oxidase; flavoprotein, protein-inhibitor c 99.53
2fca_A213 TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bac 99.53
2ift_A201 Putative methylase HI0767; NESG, Y767_haein, struc 99.53
1fp1_D372 Isoliquiritigenin 2'-O-methyltransferase; protein- 99.52
2fhp_A187 Methylase, putative; alpha-beta-alpha sandwich, st 99.52
3dmg_A381 Probable ribosomal RNA small subunit methyltransf; 99.52
3kr9_A225 SAM-dependent methyltransferase; class I rossmann- 99.52
3r0q_C376 Probable protein arginine N-methyltransferase 4.2; 99.52
3lec_A230 NADB-rossmann superfamily protein; PSI, MCSG, stru 99.52
1vg0_A650 RAB proteins geranylgeranyltransferase component A 99.52
2uzz_A372 N-methyl-L-tryptophan oxidase; N-methyltryptophan 99.52
2frn_A278 Hypothetical protein PH0793; structural genomics, 99.52
1vbf_A231 231AA long hypothetical protein-L-isoaspartate O- 99.52
2fyt_A340 Protein arginine N-methyltransferase 3; structural 99.52
3u81_A221 Catechol O-methyltransferase; neurotransmitter deg 99.52
3q7e_A349 Protein arginine N-methyltransferase 1; HET: SAH; 99.52
1l3i_A192 Precorrin-6Y methyltransferase/putative decarboxyl 99.52
1u2z_A433 Histone-lysine N-methyltransferase, H3 lysine-79 s 99.51
3gdh_A241 Trimethylguanosine synthase homolog; M7G, CAP, dim 99.51
1yzh_A214 TRNA (guanine-N(7)-)-methyltransferase; alpha-beta 99.51
3kkj_A336 Amine oxidase, flavin-containing; oxidoreductase, 99.51
3g89_A249 Ribosomal RNA small subunit methyltransferase G; 1 99.51
2yxd_A183 Probable cobalt-precorrin-6Y C(15)-methyltransfer 99.5
1y56_B382 Sarcosine oxidase; dehydrogenase, protein-protein 99.5
3gnl_A244 Uncharacterized protein, DUF633, LMOF2365_1472; st 99.49
1jsx_A207 Glucose-inhibited division protein B; methyltransf 99.49
3m33_A226 Uncharacterized protein; structural genomics, PSI- 99.49
1g6q_1328 HnRNP arginine N-methyltransferase; SAM-binding do 99.49
4azs_A 569 Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15 99.48
2ozv_A260 Hypothetical protein ATU0636; structural genomics, 99.48
3id6_C232 Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; 99.48
1o9g_A250 RRNA methyltransferase; antibiotic resistance, Se- 99.48
1nt2_A210 Fibrillarin-like PRE-rRNA processing protein; adeM 99.48
3bzb_A281 Uncharacterized protein; RED ALGA, protein structu 99.48
3mb5_A255 SAM-dependent methyltransferase; RNA methyltransfe 99.48
2b3t_A276 Protein methyltransferase HEMK; translation termin 99.48
1yb2_A275 Hypothetical protein TA0852; structural genomics, 99.48
2gag_B405 Heterotetrameric sarcosine oxidase beta-subunit; f 99.48
1fbn_A230 MJ fibrillarin homologue; MJ proteins, ribosomal R 99.48
3tfw_A248 Putative O-methyltransferase; PSI-biology, nysgrc, 99.47
3duw_A223 OMT, O-methyltransferase, putative; alternating of 99.47
2fpo_A202 Methylase YHHF; structural genomics, putative meth 99.47
3dme_A369 Conserved exported protein; structural genomics, P 99.47
1jg1_A235 PIMT;, protein-L-isoaspartate O-methyltransferase; 99.47
2gpy_A233 O-methyltransferase; structural genomics, PSI, pro 99.47
2oln_A397 NIKD protein; flavoprotein, rossmann fold, oxidore 99.46
2gf3_A389 MSOX, monomeric sarcosine oxidase; flavoprotein ox 99.46
3q87_B170 N6 adenine specific DNA methylase; SAM-methyltrans 99.46
3ckk_A235 TRNA (guanine-N(7)-)-methyltransferase; mettl1, S- 99.46
2pjd_A343 Ribosomal RNA small subunit methyltransferase C; g 99.46
2pwy_A258 TRNA (adenine-N(1)-)-methyltransferase; mtase, ado 99.46
1ws6_A171 Methyltransferase; structural genomics, riken stru 99.45
3tr6_A225 O-methyltransferase; cellular processes; HET: SAH; 99.45
3r3h_A242 O-methyltransferase, SAM-dependent; structural gen 99.45
1fp2_A352 Isoflavone O-methyltransferase; protein-product co 99.45
1ixk_A315 Methyltransferase; open beta sheet; 1.90A {Pyrococ 99.45
1nv8_A284 HEMK protein; class I adoMet-dependent methyltrans 99.44
4hc4_A376 Protein arginine N-methyltransferase 6; HRMT1L6, S 99.44
3giw_A277 Protein of unknown function DUF574; rossmann-fold 99.44
1i1n_A226 Protein-L-isoaspartate O-methyltransferase; S-aden 99.43
3k6r_A278 Putative transferase PH0793; structural genomics, 99.43
3ajd_A274 Putative methyltransferase MJ0026; tRNA, M5C, ross 99.43
2igt_A332 SAM dependent methyltransferase; alpha-beta sandwi 99.42
4dzr_A215 Protein-(glutamine-N5) methyltransferase, release 99.42
1o54_A277 SAM-dependent O-methyltransferase; TM0748, structu 99.42
3c3p_A210 Methyltransferase; NP_951602.1, structural genomic 99.42
1sui_A247 Caffeoyl-COA O-methyltransferase; rossmann fold, p 99.42
2ipx_A233 RRNA 2'-O-methyltransferase fibrillarin; FBL, stru 99.41
2zfu_A215 Nucleomethylin, cerebral protein 1; nucleolar prot 99.41
2yvl_A248 TRMI protein, hypothetical protein; tRNA, methyltr 99.41
1i9g_A280 Hypothetical protein RV2118C; mtase, adoMet, cryst 99.4
2hnk_A239 SAM-dependent O-methyltransferase; modified rossma 99.4
1r18_A227 Protein-L-isoaspartate(D-aspartate)-O-methyltrans; 99.4
1af7_A274 Chemotaxis receptor methyltransferase CHER; chemot 99.4
3hp7_A291 Hemolysin, putative; structural genomics, APC64019 99.4
2pbf_A227 Protein-L-isoaspartate O-methyltransferase beta-A 99.4
1zg3_A358 Isoflavanone 4'-O-methyltransferase; rossman fold, 99.39
1g8a_A227 Fibrillarin-like PRE-rRNA processing protein; rRNA 99.38
3c3y_A237 Pfomt, O-methyltransferase; plant secondary metabo 99.38
3tma_A354 Methyltransferase; thump domain; 2.05A {Thermus th 99.38
3a27_A272 TYW2, uncharacterized protein MJ1557; wybutosine m 99.38
2vdv_E246 TRNA (guanine-N(7)-)-methyltransferase; S-adenosyl 99.37
3cbg_A232 O-methyltransferase; cyanobacterium; HET: SAH FER 99.36
3axb_A448 Putative oxidoreductase; dinucleotide-binding fold 99.36
2avd_A229 Catechol-O-methyltransferase; structural genomics, 99.35
2plw_A201 Ribosomal RNA methyltransferase, putative; malaria 99.35
2bm8_A236 Cephalosporin hydroxylase CMCI; cephamycin biosynt 99.35
2b25_A336 Hypothetical protein; structural genomics, methyl 99.34
3bwc_A304 Spermidine synthase; SAM, SGPP, structura genomics 99.33
1p91_A269 Ribosomal RNA large subunit methyltransferase A; R 99.33
3adn_A294 Spermidine synthase; aminopropyltransferase, polya 99.32
1wy7_A207 Hypothetical protein PH1948; seven-stranded beta s 99.32
1zq9_A285 Probable dimethyladenosine transferase; SGC, struc 99.32
3sso_A419 Methyltransferase; macrolide, natural product, ros 99.31
2ld4_A176 Anamorsin; methyltransferase-like fold, alpha/beta 99.31
2yxl_A450 PH0851 protein, 450AA long hypothetical FMU protei 99.31
3opn_A232 Putative hemolysin; structural genomics, PSI-2, pr 99.31
3tm4_A373 TRNA (guanine N2-)-methyltransferase TRM14; rossma 99.3
1ej0_A180 FTSJ; methyltransferase, adoMet, adenosyl methioni 99.3
3lcv_B281 Sisomicin-gentamicin resistance methylase SGM; ant 99.3
3m6w_A 464 RRNA methylase; rRNA methyltransferase, 5-methylcy 99.29
3dou_A191 Ribosomal RNA large subunit methyltransferase J; c 99.29
3m4x_A456 NOL1/NOP2/SUN family protein; mtase domain, PUA do 99.29
3v76_A417 Flavoprotein; structural genomics, PSI-biology, NE 99.28
3gjy_A317 Spermidine synthase; APC62791, structural genomics 99.28
2b78_A385 Hypothetical protein SMU.776; structure genomics, 99.27
1pj5_A830 N,N-dimethylglycine oxidase; channelling, FAD bind 99.27
1xj5_A334 Spermidine synthase 1; structural genomics, protei 99.27
2frx_A 479 Hypothetical protein YEBU; rossmann-type S-adenosy 99.27
2o07_A304 Spermidine synthase; structural genomics, structur 99.26
1ne2_A200 Hypothetical protein TA1320; structural genomics, 99.26
2wa2_A276 Non-structural protein 5; transferase, S-adenosyl- 99.26
2oxt_A265 Nucleoside-2'-O-methyltransferase; flavivirus, vir 99.26
2qm3_A373 Predicted methyltransferase; putative methyltransf 99.25
1sqg_A429 SUN protein, FMU protein; rossmann-fold, mixed bet 99.25
1uir_A314 Polyamine aminopropyltransferase; spermidien synth 99.25
2pt6_A321 Spermidine synthase; transferase, structural genom 99.24
2b2c_A314 Spermidine synthase; beta-alpha, transferase; 2.50 99.24
4dmg_A393 Putative uncharacterized protein TTHA1493; rRNA, m 99.23
3frh_A253 16S rRNA methylase; methyltransferase domain, heli 99.23
2i7c_A283 Spermidine synthase; transferase, structural genom 99.23
2as0_A396 Hypothetical protein PH1915; RNA methyltransferase 99.23
1mjf_A281 Spermidine synthase; spermidine synthetase, struct 99.22
3c0k_A396 UPF0064 protein YCCW; PUA domain, adoMet dependent 99.22
1inl_A296 Spermidine synthase; beta-barrel, rossman fold, st 99.21
2yx1_A336 Hypothetical protein MJ0883; methyl transferase, t 99.2
1iy9_A275 Spermidine synthase; rossmann fold, structural gen 99.2
2h1r_A299 Dimethyladenosine transferase, putative; SGC toron 99.2
2f8l_A344 Hypothetical protein LMO1582; structural genomics, 99.19
1wxx_A382 TT1595, hypothetical protein TTHA1280; thermus the 99.19
3v97_A703 Ribosomal RNA large subunit methyltransferase L; Y 99.19
2nyu_A196 Putative ribosomal RNA methyltransferase 2; SAM, s 99.18
3k0b_A393 Predicted N6-adenine-specific DNA methylase; methy 99.17
3ldu_A385 Putative methylase; structural genomics, PSI-2, pr 99.16
2jjq_A425 Uncharacterized RNA methyltransferase pyrab10780; 99.15
2okc_A445 Type I restriction enzyme stysji M protein; NP_813 99.14
3gru_A295 Dimethyladenosine transferase; rossman fold, ribos 99.14
3ldg_A384 Putative uncharacterized protein SMU.472; YPSC, me 99.13
1uwv_A433 23S rRNA (uracil-5-)-methyltransferase RUMA; RNA m 99.13
2p41_A305 Type II methyltransferase; vizier, viral enzymes i 99.12
2i0z_A447 NAD(FAD)-utilizing dehydrogenases; structural geno 99.1
1qam_A244 ERMC' methyltransferase; rRNA methyltransferase ER 99.09
2cmg_A262 Spermidine synthase; transferase, putrescine amino 99.07
2gqf_A401 Hypothetical protein HI0933; structural genomics, 99.07
3cgv_A397 Geranylgeranyl reductase related protein; NP_39399 99.07
3rp8_A407 Flavoprotein monooxygenase; FAD-binding protein, o 99.07
2xyq_A290 Putative 2'-O-methyl transferase; transferase-vira 99.07
2b9e_A309 NOL1/NOP2/SUN domain family, member 5 isoform 2; m 99.06
3da1_A561 Glycerol-3-phosphate dehydrogenase; NESG BHR167 Q9 99.05
3b5i_A374 S-adenosyl-L-methionine:salicylic acid carboxyl me 99.05
2vou_A397 2,6-dihydroxypyridine hydroxylase; oxidoreductase, 99.04
2ih2_A 421 Modification methylase TAQI; DNA, DNA methyltransf 99.03
3nlc_A549 Uncharacterized protein VP0956; FAD-binding protei 99.02
2qa2_A499 CABE, polyketide oxygenase CABE; FAD, angucycline, 98.98
2r6z_A258 UPF0341 protein in RSP 3' region; alpha-beta prote 98.98
2qa1_A500 PGAE, polyketide oxygenase PGAE; FAD, angucycline, 98.98
3tqs_A255 Ribosomal RNA small subunit methyltransferase A; p 98.98
3fut_A271 Dimethyladenosine transferase; methyltransferase, 98.98
2x3n_A399 Probable FAD-dependent monooxygenase; oxidoreducta 98.98
4hb9_A412 Similarities with probable monooxygenase; flavin, 98.97
3nix_A421 Flavoprotein/dehydrogenase; structural genomics, P 98.96
3alj_A379 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; 98.95
3bt7_A369 TRNA (uracil-5-)-methyltransferase; methyluridine, 98.94
4gqb_A637 Protein arginine N-methyltransferase 5; TIM barrel 98.94
1y0p_A571 Fumarate reductase flavoprotein subunit; flavocyto 98.93
3i3l_A591 Alkylhalidase CMLS; flavin-dependent halogenase, c 98.93
2rgh_A571 Alpha-glycerophosphate oxidase; flavoprotein oxida 98.93
3ihg_A535 RDME; flavoenzyme, anthracycline, polyketide biosy 98.93
2dul_A378 N(2),N(2)-dimethylguanosine tRNA methyltransferas; 98.92
3fmw_A570 Oxygenase; mithramycin, baeyer-villiger, flavin bi 98.92
4at0_A510 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidore 98.91
2xdo_A398 TETX2 protein; tetracycline degradation, tigecycli 98.91
1qo8_A566 Flavocytochrome C3 fumarate reductase; oxidoreduct 98.91
1k0i_A394 P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, h 98.9
3gwf_A540 Cyclohexanone monooxygenase; flavoprotein biocatal 98.9
3axs_A 392 Probable N(2),N(2)-dimethylguanosine tRNA methylt 98.9
2qcu_A501 Aerobic glycerol-3-phosphate dehydrogenase; glycer 98.89
1m6y_A301 S-adenosyl-methyltransferase MRAW; SAM-dependent m 98.89
4ap3_A549 Steroid monooxygenase; oxidoreductase, baeyer-vill 98.89
2qfm_A364 Spermine synthase; spermidine aminopropyltransfera 98.88
4a9w_A357 Monooxygenase; baeyer-villiger, FAD, oxidoreductas 98.88
1rp0_A284 ARA6, thiazole biosynthetic enzyme; protein ligand 98.86
3cvo_A202 Methyltransferase-like protein of unknown functio; 98.85
3itj_A338 Thioredoxin reductase 1; disulfide B flavoprotein, 98.85
3o0h_A484 Glutathione reductase; ssgcid, structur genomics, 98.83
3f8d_A323 Thioredoxin reductase (TRXB-3); redox protein, nuc 98.83
3oz2_A397 Digeranylgeranylglycerophospholipid reductase; str 98.83
3c96_A410 Flavin-containing monooxygenase; FAD, oxidoreducta 98.83
3e1t_A512 Halogenase; flavoprotein; HET: FAD; 2.05A {Chondro 98.82
2zbw_A335 Thioredoxin reductase; redox protein, oxidoreducta 98.82
3c4n_A405 Uncharacterized protein DR_0571; alpha-beta protei 98.81
2ar0_A541 M.ecoki, type I restriction enzyme ecoki M protein 98.81
3lzw_A332 Ferredoxin--NADP reductase 2; ferredoxin reductase 98.81
2oyr_A258 UPF0341 protein YHIQ; alpha-beta protein, structur 98.8
1d4d_A572 Flavocytochrome C fumarate reductase; oxidoreducta 98.8
2gv8_A447 Monooxygenase; FMO, FAD, NADPH, cofactor complex, 98.8
2efj_A384 3,7-dimethylxanthine methyltransferase; SAM-depend 98.8
3oc4_A452 Oxidoreductase, pyridine nucleotide-disulfide FAM; 98.79
3uzu_A279 Ribosomal RNA small subunit methyltransferase A; s 98.78
3atr_A453 Conserved archaeal protein; saturating double bond 98.78
3fg2_P404 Putative rubredoxin reductase; ferredoxin reductas 98.77
3lxd_A415 FAD-dependent pyridine nucleotide-disulphide oxido 98.77
3ua3_A745 Protein arginine N-methyltransferase 5; TIM-barrel 98.77
3ab1_A360 Ferredoxin--NADP reductase; oxidoreductase, electr 98.77
1w4x_A542 Phenylacetone monooxygenase; baeyer-villiger, FAD; 98.77
3v97_A 703 Ribosomal RNA large subunit methyltransferase L; Y 98.77
2aqj_A538 Tryptophan halogenase, pRNA; flavin-dependent halo 98.76
3ftd_A249 Dimethyladenosine transferase; KSGA, rossmann-like 98.76
3d1c_A369 Flavin-containing putative monooxygenase; NP_37310 98.75
2bry_A497 NEDD9 interacting protein with calponin homology a 98.75
4dna_A463 Probable glutathione reductase; structural genomic 98.74
3uox_A545 Otemo; baeyer-villiger monooxygenase, oxidoreducta 98.74
2h88_A621 Succinate dehydrogenase flavoprotein subunit; comp 98.74
3khk_A544 Type I restriction-modification system methylation 98.73
1qyr_A252 KSGA, high level kasugamycin resistance protein, S 98.73
2wdq_A588 Succinate dehydrogenase flavoprotein subunit; succ 98.73
2bs2_A660 Quinol-fumarate reductase flavoprotein subunit A; 98.73
1xdi_A499 RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno fun 98.72
2weu_A511 Tryptophan 5-halogenase; regioselectivity, antifun 98.72
3jsk_A344 Cypbp37 protein; octameric thiazole synthase, bios 98.71
2e4g_A550 Tryptophan halogenase; flavin-binding, rebeccamyci 98.7
3ll7_A410 Putative methyltransferase; methytransferase, stru 98.7
1trb_A320 Thioredoxin reductase; oxidoreductase(flavoenzyme) 98.69
2xve_A464 Flavin-containing monooxygenase; oxidoreductase; H 98.69
2pyx_A526 Tryptophan halogenase; structural genomics, JOI fo 98.69
3iwa_A472 FAD-dependent pyridine nucleotide-disulphide oxido 98.68
1ges_A450 Glutathione reductase; oxidoreductase(flavoenzyme) 98.68
1mo9_A523 ORF3; nucleotide binding motifs, nucleotide bindin 98.68
2r0c_A549 REBC; flavin adenine dinucleotide, monooxygenase, 98.65
2gmh_A584 Electron transfer flavoprotein-ubiquinone oxidored 98.65
2q0l_A311 TRXR, thioredoxin reductase; bacterial thiredoxin 98.65
2ywl_A180 Thioredoxin reductase related protein; uncharacter 98.63
2gjc_A326 Thiazole biosynthetic enzyme, mitochondrial; gluta 98.63
2zxi_A637 TRNA uridine 5-carboxymethylaminomethyl modificat 98.63
2cul_A232 Glucose-inhibited division protein A-related PROT 98.63
2q7v_A325 Thioredoxin reductase; rossman fold, FAD, flavopro 98.62
2qae_A468 Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystin 98.61
4fk1_A304 Putative thioredoxin reductase; structural genomic 98.61
2yqu_A455 2-oxoglutarate dehydrogenase E3 component; lipoami 98.6
3urh_A491 Dihydrolipoyl dehydrogenase; PSI-biology, structur 98.6
3evf_A277 RNA-directed RNA polymerase NS5; NS5 methyltransfe 98.6
2v3a_A384 Rubredoxin reductase; alkane degradation, NADH oxi 98.59
1m6e_X359 S-adenosyl-L-methionnine:salicylic acid carboxyl m 98.59
3lkd_A542 Type I restriction-modification system methyltrans 98.59
1fec_A490 Trypanothione reductase; redox-active center, oxid 98.59
1chu_A540 Protein (L-aspartate oxidase); flavoenzyme, NAD bi 98.59
3fbs_A297 Oxidoreductase; structural genomics, PSI2, MCSG, p 98.58
2r9z_A463 Glutathione amide reductase; NAD, FAD, substrate s 98.58
3ef6_A410 Toluene 1,2-dioxygenase system ferredoxin--NAD(+) 98.58
3ces_A651 MNMG, tRNA uridine 5-carboxymethylaminomethyl modi 98.57
3ics_A588 Coenzyme A-disulfide reductase; pyridine nucleotid 98.57
1vdc_A333 NTR, NADPH dependent thioredoxin reductase; hypoth 98.56
3lad_A476 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 98.56
1kf6_A602 Fumarate reductase flavoprotein; respiration, fuma 98.56
3k30_A690 Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP bi 98.56
2hqm_A479 GR, grase, glutathione reductase; glutathione redu 98.56
3cty_A319 Thioredoxin reductase; FAD, oxidoreductase, flavin 98.55
1fl2_A310 Alkyl hydroperoxide reductase subunit F; reactive 98.54
2wpf_A495 Trypanothione reductase; oxidoreductase, trypanoso 98.54
1dxl_A470 Dihydrolipoamide dehydrogenase; oxidoreductase, mu 98.54
3r9u_A315 Thioredoxin reductase; structural genomics, center 98.54
2dkh_A639 3-hydroxybenzoate hydroxylase; flavoprotein, monoo 98.54
1zk7_A467 HGII, reductase, mercuric reductase; mercuric ION 98.54
2e5v_A472 L-aspartate oxidase; archaea, oxidoreductase; HET: 98.53
3s5w_A463 L-ornithine 5-monooxygenase; class B flavin depend 98.52
1zmd_A474 Dihydrolipoyl dehydrogenase; lipoamide dehydrogena 98.5
3ntd_A565 FAD-dependent pyridine nucleotide-disulphide oxido 98.5
1onf_A500 GR, grase, glutathione reductase; oxidoreductase; 98.48
3h8l_A409 NADH oxidase; membrane protein, complete form, ros 98.48
2qy6_A257 UPF0209 protein YFCK; structural genomics, unknown 98.47
3o4f_A294 Spermidine synthase; aminopropyltransferase, polya 98.47
1y56_A493 Hypothetical protein PH1363; dehydrogenase, protei 98.46
2cdu_A452 NADPH oxidase; flavoenzyme, oxidoreductase; HET: F 98.46
3cp8_A641 TRNA uridine 5-carboxymethylaminomethyl modificati 98.45
4b1b_A542 TRXR, thioredoxin reductase; oxidoreductase, FAD, 98.44
2a8x_A464 Dihydrolipoyl dehydrogenase, E3 component of alpha 98.44
3dgz_A488 Thioredoxin reductase 2; oxidoreductase, rossmann, 98.42
3dk9_A478 Grase, GR, glutathione reductase; flavoenzyme, nic 98.41
3ic9_A492 Dihydrolipoamide dehydrogenase; APC62701, colwelli 98.4
1hyu_A521 AHPF, alkyl hydroperoxide reductase subunit F; thi 98.4
1q1r_A431 Putidaredoxin reductase; glutathione reductase fol 98.4
3dgh_A483 TRXR-1, thioredoxin reductase 1, mitochondrial; ox 98.38
3klj_A385 NAD(FAD)-dependent dehydrogenase, NIRB-family (N- 98.38
3gcz_A282 Polyprotein; flavivirus, RNA capping, methyltransf 98.38
3fpz_A326 Thiazole biosynthetic enzyme; FAD, mitochondrion, 98.35
2a87_A335 TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TL 98.35
3l8k_A466 Dihydrolipoyl dehydrogenase; redox-active center, 98.34
4fzv_A359 Putative methyltransferase NSUN4; mterf fold, meth 98.34
1ojt_A482 Surface protein; redox-active center, glycolysis, 98.33
1jnr_A643 Adenylylsulfate reductase; oxidoreductase; HET: FA 98.32
1wg8_A285 Predicted S-adenosylmethionine-dependent methyltra 98.31
2wk1_A282 NOVP; transferase, O-methyltransferase, novobiocin 98.3
3s1s_A 878 Restriction endonuclease bpusi; PD--(D/E)XK cataly 98.29
1ebd_A455 E3BD, dihydrolipoamide dehydrogenase; redox-active 98.27
3kd9_A449 Coenzyme A disulfide reductase; PSI-II, NYSGXRC, o 98.27
1pn0_A665 Phenol 2-monooxygenase; two dimers, TLS refinement 98.26
3vrd_B401 FCCB subunit, flavocytochrome C flavin subunit; su 98.26
1nhp_A447 NADH peroxidase; oxidoreductase (H2O2(A)); HET: FA 98.22
3gyx_A662 Adenylylsulfate reductase; oxidoreductase; HET: FA 98.21
3cgb_A480 Pyridine nucleotide-disulfide oxidoreductase, CLA; 98.19
3lkz_A321 Non-structural protein 5; flavivirus, methyltransf 98.19
3qfa_A519 Thioredoxin reductase 1, cytoplasmic; protein-prot 98.18
3sx6_A437 Sulfide-quinone reductase, putative; sulfide:quino 98.13
2k4m_A153 TR8_protein, UPF0146 protein MTH_1000; alpha+beta, 98.12
4gcm_A312 TRXR, thioredoxin reductase; FAD/NAD-linked reduct 98.11
3g3e_A351 D-amino-acid oxidase; FAD, flavoprotein, oxidoredu 98.1
3c6k_A381 Spermine synthase; spermidine aminopropyltransfera 98.09
1xhc_A367 NADH oxidase /nitrite reductase; southe collaborat 98.08
2bc0_A490 NADH oxidase; flavoprotein, pyridine nucleotide di 98.07
3p8z_A267 Mtase, non-structural protein 5; methyltransferase 98.06
4auk_A375 Ribosomal RNA large subunit methyltransferase M; Y 98.04
2eq6_A464 Pyruvate dehydrogenase complex, dihydrolipoamide d 98.03
3hyw_A430 Sulfide-quinone reductase; monotopic membrane prot 98.03
1c0p_A363 D-amino acid oxidase; alpha-beta-alpha motif, flav 98.02
4b63_A501 L-ornithine N5 monooxygenase; oxidoreductase, side 98.02
3ufb_A530 Type I restriction-modification system methyltran 98.01
2vdc_G456 Glutamate synthase [NADPH] small chain; oxidoreduc 98.0
3eld_A300 Methyltransferase; flavivirus, RNA capping, guanyl 97.99
4eqs_A437 Coenzyme A disulfide reductase; oxidoreductase; HE 97.98
4a5l_A314 Thioredoxin reductase; oxidoreductase, redox metab 97.96
2px2_A269 Genome polyprotein [contains: capsid protein C (co 97.94
3c4a_A381 Probable tryptophan hydroxylase VIOD; alpha-beta p 97.92
4g6h_A502 Rotenone-insensitive NADH-ubiquinone oxidoreducta 97.91
1nhp_A447 NADH peroxidase; oxidoreductase (H2O2(A)); HET: FA 97.9
3qvp_A583 Glucose oxidase; oxidoreductase; HET: NAG BMA MAN 97.87
1v59_A478 Dihydrolipoamide dehydrogenase; 2-oxoacid dehydrog 97.86
1ebd_A455 E3BD, dihydrolipoamide dehydrogenase; redox-active 97.85
2gqw_A408 Ferredoxin reductase; flavoprotein, oxidoreductase 97.8
3ihm_A430 Styrene monooxygenase A; rossman fold, anti-parall 97.8
1o94_A729 Tmadh, trimethylamine dehydrogenase; electron tran 97.79
2zig_A297 TTHA0409, putative modification methylase; methylt 97.78
1ojt_A482 Surface protein; redox-active center, glycolysis, 97.77
3g5s_A443 Methylenetetrahydrofolate--tRNA-(uracil-5-)- methy 97.76
1lvl_A458 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 97.73
1v59_A478 Dihydrolipoamide dehydrogenase; 2-oxoacid dehydrog 97.72
2bc0_A490 NADH oxidase; flavoprotein, pyridine nucleotide di 97.65
1lvl_A458 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 97.65
3fim_B566 ARYL-alcohol oxidase; AAO, lignin degradation, oxi 97.62
1ps9_A671 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel 97.61
>3hem_A Cyclopropane-fatty-acyl-phospholipid synthase 2; protein-ligand complex, cytoplasm, lipid synthesis, methyltransferase; HET: D22; 2.39A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kpi_A* Back     alignment and structure
Probab=100.00  E-value=1.3e-47  Score=410.83  Aligned_cols=275  Identities=28%  Similarity=0.470  Sum_probs=254.5

Q ss_pred             chHHHHHhhhhccCCChHHHHHhcCCCcceeecccCCCCCCHHHHHHHHHHHHHHHcCCCCCCeEEEEccCccHHHHHHH
Q 038410          555 TLAQARRNISHHYDVSNELFSLFLGKSMMYSCAIFKSEYEDLDVAQMRKVSLLIEKARVNKGLDVLEIGCGWGTLAIEIV  634 (850)
Q Consensus       555 ~~~~~~~~i~~~Yd~~~~~~~~~l~~~~~ys~~~~~~~~~~l~~aq~~~~~~~~~~l~~~~~~~vLDiGcG~G~~~~~la  634 (850)
                      ..+..+++|++|||++|+||+.|++++|+|||++|..+..+++++|.++++.++++++++++.+|||||||+|.++..++
T Consensus        12 ~~~~~~~~i~~~Yd~~~~~y~~~l~~~~~y~~~~~~~~~~~l~~a~~~~~~~~~~~~~~~~~~~vLDiGcG~G~~~~~la   91 (302)
T 3hem_A           12 QLKPPVEAVRSHYDKSNEFFKLWLDPSMTYSCAYFERPDMTLEEAQYAKRKLALDKLNLEPGMTLLDIGCGWGSTMRHAV   91 (302)
T ss_dssp             CCCCCHHHHHHHHTSCHHHHHHHSCTTCCCSCCCCSSTTCCHHHHHHHHHHHHHHTTCCCTTCEEEEETCTTSHHHHHHH
T ss_pred             cccchHHHHHHhcCCCHHHHHHhcCCCCceeeEEecCCCCCHHHHHHHHHHHHHHHcCCCCcCEEEEeeccCcHHHHHHH
Confidence            34567899999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HhcCCEEEEEeCCHHHHHHHHHHHHHcCCCCCEEEEEcccCCCCCCCCccEEEEecchhhh-------ChhhHHHHHHHH
Q 038410          635 KQTGCKYTGITLSEEQLKYTETKVKEAGLQDHIRLYLCDYRQMPEVKKYDTIISCEMIENV-------GHEYIEEFFGCC  707 (850)
Q Consensus       635 ~~~~~~v~gid~s~~~~~~a~~~~~~~gl~~~v~~~~~D~~~~~~~~~fD~v~s~~~~~~~-------~~~~~~~~~~~~  707 (850)
                      ++.+++|+|+|+|+++++.|+++++..+++++++++++|+.++  +++||+|+++.+++|+       +.+++..+++++
T Consensus        92 ~~~~~~v~gvD~s~~~~~~a~~~~~~~~~~~~v~~~~~d~~~~--~~~fD~v~~~~~~~~~~d~~~~~~~~~~~~~l~~~  169 (302)
T 3hem_A           92 AEYDVNVIGLTLSENQYAHDKAMFDEVDSPRRKEVRIQGWEEF--DEPVDRIVSLGAFEHFADGAGDAGFERYDTFFKKF  169 (302)
T ss_dssp             HHHCCEEEEEECCHHHHHHHHHHHHHSCCSSCEEEEECCGGGC--CCCCSEEEEESCGGGTTCCSSCCCTTHHHHHHHHH
T ss_pred             HhCCCEEEEEECCHHHHHHHHHHHHhcCCCCceEEEECCHHHc--CCCccEEEEcchHHhcCccccccchhHHHHHHHHH
Confidence            9867999999999999999999999999998999999999988  4899999999999999       657889999999


Q ss_pred             HhccccCeEEEEEEecCCCCcCCCCcCc---------cccccccccCCCCCCCHHHHHHHHhcCCceEEEEeeecCCcHH
Q 038410          708 ESLLAEHGLLLLQFSSVPDQCYDGHRLS---------PGFITEYVFPGGCLPSLNRITSAMTSSSRLCVEHLENIGIHFY  778 (850)
Q Consensus       708 ~r~LkpgG~~~~~~~~~~~~~~~~~~~~---------~~~~~~~i~p~~~~~~~~~~~~~~~~~~gf~v~~~~~~~~~y~  778 (850)
                      .++|||||++++++++.+..........         .+|+.+|+||++.+|+..++.+.+++ +||+++++++++.||.
T Consensus       170 ~~~LkpgG~l~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~p~~~~~s~~~~~~~l~~-aGf~~~~~~~~~~~y~  248 (302)
T 3hem_A          170 YNLTPDDGRMLLHTITIPDKEEAQELGLTSPMSLLRFIKFILTEIFPGGRLPRISQVDYYSSN-AGWKVERYHRIGANYV  248 (302)
T ss_dssp             HHSSCTTCEEEEEEEECCCHHHHHHHTCCCCHHHHHHHHHHHHHTCTTCCCCCHHHHHHHHHH-HTCEEEEEEECGGGHH
T ss_pred             HHhcCCCcEEEEEEEeccCccchhhccccccccccchHHHHHHhcCCCCCCCCHHHHHHHHHh-CCcEEEEEEeCchhHH
Confidence            9999999999999998765432111111         27899999999999999999988886 7999999999999999


Q ss_pred             HHHHHHHHHHHhcHHHHHhccCCHHHHHHHHHHHHHHHHHhccCcceEEEEEEEe
Q 038410          779 QTLRCWRTNLMEKQSEILALGFNEKFIRTWEYYFDYCAAGFKSRTLGNYQIVFSR  833 (850)
Q Consensus       779 ~tl~~w~~~~~~~~~~~~~~~~~~~~~r~w~~yl~~~~~~f~~~~~~~~q~~~~~  833 (850)
                      +|+..|.++|.++++++.++ ++++|.|+|++||++|+++|+.|.++++|++++|
T Consensus       249 ~tl~~w~~~~~~~~~~~~~~-~~~~~~~~w~~yl~~~~~~f~~~~~~~~q~~~~~  302 (302)
T 3hem_A          249 PTLNAWADALQAHKDEAIAL-KGQETCDIYMHYLRGCSDLFRDKYTDVCQFTLVK  302 (302)
T ss_dssp             HHHHHHHHHHHHTHHHHHHH-HCHHHHHHHHHHHHHHHHHHHTTSSEEEEEEEEC
T ss_pred             HHHHHHHHHHHHhHHHHHHH-hCHHHHHHHHHHHHHHHHHHhCCCCeEEEEEEEC
Confidence            99999999999999999998 9999999999999999999999999999999987
>1kpg_A CFA synthase;, cyclopropane-fatty-acyl-phospholipid synthase 1; mixed alpha beta fold, structural genomics, PSI; HET: SAH 16A; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kp9_A* 1kph_A* 1tpy_A* 1l1e_A* Back     alignment and structure
>2fk8_A Methoxy mycolic acid synthase 4; S-adenosylmethionine-dependent methyltransferase fold, trans; HET: SAM; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 2fk7_A* 3ha3_A* 3ha5_A* 3ha7_A* Back     alignment and structure
>3nks_A Protoporphyrinogen oxidase; FAD containing protein, PPO, variegate porphyria disease, VP oxidoreductase-oxidoreductase inhibitor complex; HET: ACJ FAD; 1.90A {Homo sapiens} Back     alignment and structure
>3bus_A REBM, methyltransferase; rebeccamycin synthesis; HET: SAH; 2.65A {Lechevalieria aerocolonigenes} Back     alignment and structure
>3i6d_A Protoporphyrinogen oxidase; protein-inhibitor complex, cytoplasm, FAD, flavoprotein, oxidoreductase, porphyrin biosynthesis; HET: FAD ACJ; 2.90A {Bacillus subtilis} Back     alignment and structure
>2ivd_A PPO, PPOX, protoporphyrinogen oxidase; porphyrin biosynthesis, chlorophyll biosynthesis, oxidoreductase, HAEM biosynthesis, heme biosynthesis; HET: ACJ FAD TWN; 2.3A {Myxococcus xanthus} SCOP: c.3.1.2 d.16.1.5 PDB: 2ive_A* Back     alignment and structure
>3lov_A Protoporphyrinogen oxidase; structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: FAD; 2.06A {Exiguobacterium sibiricum} Back     alignment and structure
>3ka7_A Oxidoreductase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: FAD; 1.80A {Methanosarcina mazei} Back     alignment and structure
>4gde_A UDP-galactopyranose mutase; flavin adenine dinucleotide binding, nucleotide binding, MUT isomerase; HET: FDA; 2.20A {Aspergillus fumigatus} PDB: 3ute_A* 3utg_A* 3uth_A* 4gdc_A* 4gdd_A* 3utf_A* 3ukh_A* 3ukf_A* 3uka_A* 3ukl_A* 3ukk_A* 3ukq_A* 3ukp_A* Back     alignment and structure
>2b9w_A Putative aminooxidase; isomerase, conjugated linoleic acid, FAD; HET: FAD 12P; 1.95A {Propionibacterium acnes} PDB: 2b9x_A* 2b9y_A* 2ba9_A* 2bab_A* 2bac_A* Back     alignment and structure
>2o57_A Putative sarcosine dimethylglycine methyltransferase; structural genomics, protein structure initiative, PSI-2; 1.95A {Galdieria sulphuraria} SCOP: c.66.1.18 Back     alignment and structure
>2vvm_A Monoamine oxidase N; FAD, peroxisome, flavoprotein, oxidoreductase, enantioselectivity, directed evolution variant; HET: FAD; 1.85A {Aspergillus niger} PDB: 2vvl_A* 2vvl_G* Back     alignment and structure
>1sez_A Protoporphyrinogen oxidase, mitochondrial; FAD-binding, para-hydroxy-benzoate-hydroxylase fold (PHBH- fold), monotopic membrane-binding domain; HET: FAD OMN TON; 2.90A {Nicotiana tabacum} SCOP: c.3.1.2 d.16.1.5 Back     alignment and structure
>3nrn_A Uncharacterized protein PF1083; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: AMP; 2.10A {Pyrococcus furiosus} Back     alignment and structure
>1s3e_A Amine oxidase [flavin-containing] B; human monoamine oxidase, inhibitor binding, rasagiline, enantioselectivity, oxidoreductase; HET: FAD RHP; 1.60A {Homo sapiens} SCOP: c.3.1.2 d.16.1.5 PDB: 1gos_A* 1oj9_A* 1ojb_A* 1ojc_A* 1ojd_A* 1s2q_A* 1s2y_A* 1oja_A* 1s3b_A* 2bk3_A* 2byb_A* 2c64_A* 2c65_A* 2c66_A* 2c67_A* 2c70_A* 2v5z_A* 2v60_A* 2v61_A* 2vrl_A* ... Back     alignment and structure
>2yg5_A Putrescine oxidase; oxidoreductase, flavin; HET: FAD; 1.90A {Rhodococcus erythropolis} PDB: 2yg6_A* 2yg3_A* 2yg4_A* 2yg7_A* 3rha_A* Back     alignment and structure
>4dgk_A Phytoene dehydrogenase; the FAD/NAD(P)-binding rossmann fold, oxidoreductase; 2.35A {Pantoea ananatis} Back     alignment and structure
>4dsg_A UDP-galactopyranose mutase; rossmann fold, flavin adenine dinucleotide, isomerase; HET: FAD UDP; 2.25A {Trypanosoma cruzi} PDB: 4dsh_A* Back     alignment and structure
>3vc1_A Geranyl diphosphate 2-C-methyltransferase; rossmann fold, methyltransferase fold, SAM-dependent methyltransferase; HET: SAH GST GOL; 1.82A {Streptomyces coelicolor} PDB: 3vc2_A* 4f84_A* 4f85_A 4f86_A* Back     alignment and structure
>2bi7_A UDP-galactopyranose mutase; FAD, flavoprotein, isomerase, lipopolysaccharide biosynthesi; HET: FAD; 2.0A {Klebsiella pneumoniae} SCOP: c.4.1.3 d.16.1.7 PDB: 2bi8_A* 1wam_A* 3inr_A* 3gf4_A* 3int_A* 3kyb_A* Back     alignment and structure
>1i8t_A UDP-galactopyranose mutase; rossman fold, FAD, contractase, isomerase; HET: FAD; 2.40A {Escherichia coli} SCOP: c.4.1.3 d.16.1.7 Back     alignment and structure
>3k7m_X 6-hydroxy-L-nicotine oxidase; enantiomeric substrates, flavoenzymes, nicotine degradation, oxidoreductase; HET: FAD GP7; 1.95A {Arthrobacter nicotinovorans} PDB: 3k7q_X* 3ng7_X* 3ngc_X* 3nh3_X* 3nho_X* 3nk0_X* 3nk1_X* 3nk2_X* 3nn0_X* 3nn6_X* 3k7t_A* Back     alignment and structure
>1v0j_A UDP-galactopyranose mutase; flavoprotein, isomerase; HET: FAD BCN; 2.25A {Mycobacterium tuberculosis} Back     alignment and structure
>1rsg_A FMS1 protein; FAD binding motif, oxidoreductase; HET: FAD; 1.90A {Saccharomyces cerevisiae} PDB: 1z6l_A* 3bi2_A* 3bi4_A* 3bi5_A* 3bnm_B* 3bnu_B* 3cn8_B* 3cnd_B* 3cnp_B* 3cns_A* 3cnt_B* 1yy5_A* 1xpq_A* Back     alignment and structure
>1b37_A Protein (polyamine oxidase); flavin-dependent amine oxidase, oxidoreductase; HET: NAG FCA MAN FAD; 1.90A {Zea mays} SCOP: c.3.1.2 d.16.1.5 PDB: 1b5q_A* 1h81_A* 1h82_A* 1h83_A* 1h84_A* 1h86_A* 3kpf_A* 3ku9_A* 3l1r_A* Back     alignment and structure
>2jae_A L-amino acid oxidase; oxidoreductase, dimerisation mode, hydride transfer mechanism, GR2-family, flavoenzyme, FAD containing; HET: FAD; 1.25A {Rhodococcus opacus} PDB: 2jb1_A* 2jb2_A* 2jb3_A* Back     alignment and structure
>3ujc_A Phosphoethanolamine N-methyltransferase; parasite; HET: PC; 1.19A {Plasmodium falciparum} PDB: 3uj9_A* 3uj6_A* 3uj7_A* 3uj8_A* 3uja_A 3ujb_A* 4fgz_A* 3ujd_A* Back     alignment and structure
>2iid_A L-amino-acid oxidase; flavoenzyme, FAD binding domain, reaction mechanism, sustrat binding, oxidoreductase; HET: NAG FUC PHE FAD; 1.80A {Calloselasma rhodostoma} SCOP: c.3.1.2 d.16.1.5 PDB: 1f8s_A* 1f8r_A* 1reo_A* 1tdk_A* 1tdn_A* 1tdo_A* 3kve_A* 4e0v_A* Back     alignment and structure
>4gut_A Lysine-specific histone demethylase 1B; histone demethylase; HET: FAD PGE; 2.00A {Homo sapiens} PDB: 4gur_A* 4gus_A* 4guu_A* 4fwe_A* 4fwf_A* 4fwj_A* 4gu1_A* Back     alignment and structure
>3bkx_A SAM-dependent methyltransferase; YP_807781.1, cyclopropane-fatty-acyl-phospholipid synthase-L protein, methyltransferase domain; 1.85A {Lactobacillus casei} Back     alignment and structure
>3kkz_A Uncharacterized protein Q5LES9; putative methyltransferase, BFR250, NESG, structural genomics, PSI-2; HET: SAM; 1.68A {Bacteroides fragilis nctc 9343} PDB: 3e7p_A 3t7s_A* 3t7r_A* 3t7t_A* Back     alignment and structure
>3qj4_A Renalase; FAD/NAD(P)-binding rossmann fold superfamily, flavin contain oxidoreductase, monoamine oxidase, NAD, extracellular, oxidoreductase; HET: FAD; 2.50A {Homo sapiens} Back     alignment and structure
>2xag_A Lysine-specific histone demethylase 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_A* 2xah_A* 2xaj_A* 2xaq_A* 2xas_A* 2com_A Back     alignment and structure
>2z3y_A Lysine-specific histone demethylase 1; chromatin, nucleosome, transcription, LSD1, alternative splicing, chromatin regulator, coiled coil; HET: F2N; 2.25A {Homo sapiens} SCOP: a.4.1.18 c.3.1.2 d.16.1.5 PDB: 2ejr_A* 2z5u_A* 3abt_A* 3abu_A* 2y48_A* 2v1d_A* 2h94_A* 2iw5_A* 2uxn_A* 2uxx_A* 2hko_A* 2dw4_A* 2x0l_A* 2l3d_A Back     alignment and structure
>1dl5_A Protein-L-isoaspartate O-methyltransferase; isoaspartyl residues, protein repair, deamidation, post-translational modification; HET: SAH; 1.80A {Thermotoga maritima} SCOP: c.66.1.7 d.197.1.1 Back     alignment and structure
>3ayj_A Pro-enzyme of L-phenylalanine oxidase; amino acid oxidase, flavoenzyme, L- binding, oxidoreductase; HET: FAD PHE; 1.10A {Pseudomonas} PDB: 2yr4_A* 2yr6_A* 3ayi_A* 2yr5_A* 3ayl_A* Back     alignment and structure
>2bcg_G Secretory pathway GDP dissociation inhibitor; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.3.1.3 c.3.1.3 d.16.1.6 PDB: 1ukv_G* 3cpi_G 3cph_G 3cpj_G* Back     alignment and structure
>3hdq_A UDP-galactopyranose mutase; substrate and inhibitor, isomerase; HET: GDU FAD; 2.36A {Deinococcus radiodurans} PDB: 3hdy_A* 3he3_A* 3mj4_A* Back     alignment and structure
>4htf_A S-adenosylmethionine-dependent methyltransferase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE SAM; 1.60A {Escherichia coli} Back     alignment and structure
>3dli_A Methyltransferase; PSI-II, NYSGXRC, structural genomics, protein structure initiative; 2.46A {Archaeoglobus fulgidus} Back     alignment and structure
>3f4k_A Putative methyltransferase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacteroides thetaiotaomicron} PDB: 3t0i_A* 3svz_A* 3sxj_A* Back     alignment and structure
>1nkv_A Hypothetical protein YJHP; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.90A {Escherichia coli} SCOP: c.66.1.21 Back     alignment and structure
>1vl5_A Unknown conserved protein BH2331; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; HET: MSE; 1.95A {Bacillus halodurans} SCOP: c.66.1.41 Back     alignment and structure
>1d5t_A Guanine nucleotide dissociation inhibitor; ultra-high resolution, hydrolase inhibitor; 1.04A {Bos taurus} SCOP: c.3.1.3 d.16.1.6 PDB: 1lv0_A* 1gnd_A Back     alignment and structure
>3p1w_A Rabgdi protein; GDI RAB, malaria, structural genomics consortium, SGC, trans PF10_0345, protein transport; 1.85A {Plasmodium falciparum 3D7} Back     alignment and structure
>3mgg_A Methyltransferase; NYSGXRC, PSI-II, protein structure initiative, structural genomics, NEW YORK SGX research center for structural genomics; 1.86A {Methanosarcina mazei} Back     alignment and structure
>4gek_A TRNA (CMO5U34)-methyltransferase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, rossmann fold; HET: GEK; 1.50A {Escherichia coli} PDB: 1im8_A* Back     alignment and structure
>1pjz_A Thiopurine S-methyltransferase; polymorphism, S-adenosylmethionine, drug metabolism; NMR {Pseudomonas syringae PV} SCOP: c.66.1.36 Back     alignment and structure
>3iv6_A Putative Zn-dependent alcohol dehydrogenase; alpha/beta fold, rossmann-fold, structural genomics, PSI-2, structure initiative; HET: SAM; 2.70A {Rhodobacter sphaeroides} Back     alignment and structure
>3ou2_A SAM-dependent methyltransferase; O-methyltransferase, SAH; HET: SAH; 1.50A {Streptomyces luridus} PDB: 3ou6_A* 3ou7_A* Back     alignment and structure
>2e1m_A L-glutamate oxidase; L-amino acid oxidase, FAD, L-GOX, flavo oxidoreductase; HET: FAD; 2.80A {Streptomyces SP} Back     alignment and structure
>1xxl_A YCGJ protein; structural genomics, protein structure initiative, PSI, NEW YORK SGX research center for structural genomics, nysgxrc; 2.10A {Bacillus subtilis} SCOP: c.66.1.41 PDB: 2glu_A* Back     alignment and structure
>1ri5_A MRNA capping enzyme; methyltransferase, M7G, messenger RNA CAP, structural genomics, PSI, protein structure initiative; 2.10A {Encephalitozoon cuniculi} SCOP: c.66.1.34 PDB: 1ri2_A* 1ri3_A* 1ri1_A* 1ri4_A 1z3c_A* 2hv9_A* Back     alignment and structure
>3dtn_A Putative methyltransferase MM_2633; structural genomics, unknown function, PSI-2, protein structure initiative; 2.09A {Methanosarcina mazei} Back     alignment and structure
>3h2b_A SAM-dependent methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAH; 2.00A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3hnr_A Probable methyltransferase BT9727_4108; structural genomics, PSI-2, protein structure initiative; 2.80A {Bacillus thuringiensis serovarkonkukian} Back     alignment and structure
>3dh0_A SAM dependent methyltransferase; cystal structure, PSI-2, NYSGXRC, structural genomics, protein structure initiative; HET: SAM; 2.72A {Aquifex aeolicus} Back     alignment and structure
>3lcc_A Putative methyl chloride transferase; halide methyltransferase; HET: SAH; 1.80A {Arabidopsis thaliana} Back     alignment and structure
>3p2e_A 16S rRNA methylase; methyltransferase, transferase, NPMA; HET: SAH; 1.68A {Escherichia coli} PDB: 3p2i_A 3p2k_A* 3pb3_A* 3mte_A* Back     alignment and structure
>3fpf_A Mtnas, putative uncharacterized protein; thermonicotianamine, nicotianamine, biosynthetic protein; HET: TNA MTA; 1.66A {Methanothermobacter thermautotrophicusorganism_taxid} PDB: 3fpe_A* 3fph_A* 3fpg_A* 3fpj_A* 3o31_A* Back     alignment and structure
>3ocj_A Putative exported protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: PLM; 1.39A {Bordetella parapertussis} Back     alignment and structure
>3dlc_A Putative S-adenosyl-L-methionine-dependent methyltransferase; structural genomics, joint center for structural genomics; HET: MSE SAM; 1.15A {Methanococcus maripaludis} Back     alignment and structure
>3jwg_A HEN1, methyltransferase type 12; 1.90A {Clostridium thermocellum} PDB: 3jwi_A Back     alignment and structure
>3g2m_A PCZA361.24; SAM-dependent methyltransferase, glycopeptide antibiotics biosynthesis, structural genomics; 2.00A {Amycolatopsis orientalis} PDB: 3g2o_A* 3g2p_A* 3g2q_A* Back     alignment and structure
>3jwh_A HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena variabilis} PDB: 3jwj_A Back     alignment and structure
>4fsd_A Arsenic methyltransferase; rossmann fold; 1.75A {Cyanidioschyzon SP} PDB: 4fr0_A* 4fs8_A 3p7e_A 3qnh_A 3qhu_A Back     alignment and structure
>2yqz_A Hypothetical protein TTHA0223; RNA methyltransferase, SAM, structural genomics, NPPSFA; HET: SAM; 1.80A {Thermus thermophilus} PDB: 2yr0_A Back     alignment and structure
>3e23_A Uncharacterized protein RPA2492; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAM; 1.60A {Rhodopseudomonas palustris} Back     alignment and structure
>1xtp_A LMAJ004091AAA; SGPP, structural genomics, PSI, protein structure initiative dependent methyltransferase; HET: SAI; 1.94A {Leishmania major} SCOP: c.66.1.42 Back     alignment and structure
>2ex4_A Adrenal gland protein AD-003; methyltransferase, structural genomics, SGC, structural genomics consortium; HET: SAH; 1.75A {Homo sapiens} SCOP: c.66.1.42 Back     alignment and structure
>2p7i_A Hypothetical protein; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; 1.74A {Pectobacterium atrosepticum SCRI1043} SCOP: c.66.1.41 PDB: 2p7h_A Back     alignment and structure
>2gb4_A Thiopurine S-methyltransferase; 18204406, thiopurine methyltransferase, structural genomics, PSI, protein structure initiative; HET: SAH; 1.25A {Mus musculus} PDB: 3bgi_A* 3bgd_A* 2bzg_A* 2h11_A* Back     alignment and structure
>2xvm_A Tellurite resistance protein TEHB; antibiotic resistance, transferase; HET: SAH; 1.48A {Escherichia coli} PDB: 2xva_A* 4dq0_A* 2i6g_A* Back     alignment and structure
>2p35_A Trans-aconitate 2-methyltransferase; SAM dependent methyltrans agrobacterium tumefaciens, structural genomics, PSI-2; HET: SAH; 1.95A {Agrobacterium tumefaciens str} Back     alignment and structure
>3g5l_A Putative S-adenosylmethionine dependent methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.35A {Listeria monocytogenes str} Back     alignment and structure
>3ccf_A Cyclopropane-fatty-acyl-phospholipid synthase; YP_321342.1, putative methyltransferase; 1.90A {Anabaena variabilis atcc 29413} Back     alignment and structure
>2r3s_A Uncharacterized protein; methyltransferase domain, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE; 2.15A {Nostoc punctiforme} Back     alignment and structure
>3l8d_A Methyltransferase; structural genomics, PSI, nysgrc, protein structure initiative, NEW YORK SGX research center for STRU genomics; 1.70A {Bacillus thuringiensis} Back     alignment and structure
>2y1w_A Histone-arginine methyltransferase CARM1; histone modification; HET: SFG 849; 2.10A {Homo sapiens} PDB: 2y1x_A* 3b3f_A* 3b3g_A 2v74_B* 2v7e_A Back     alignment and structure
>3i53_A O-methyltransferase; CO-complex, rossmann-like fold; HET: SAH; 2.08A {Streptomyces carzinostaticus subsp} PDB: 3i58_A* 3i5u_A* 3i64_A* Back     alignment and structure
>2g72_A Phenylethanolamine N-methyltransferase; HET: SAM F21; 2.00A {Homo sapiens} SCOP: c.66.1.15 PDB: 1yz3_A* 2an4_A* 2an5_A* 2g70_A* 2g71_A* 2an3_A* 2g8n_A* 2ony_A* 3hcb_A* 3hcc_A* 3hcd_A* 3hcf_A* 3kpj_A* 3kpu_A* 3kpv_A* 3kpw_A* 3kpy_A* 3kqm_A* 3kqo_A* 3kqp_A* ... Back     alignment and structure
>3pfg_A N-methyltransferase; N,N-dimethyltransferase, SAM binding, DTDP-linked sugar BIND transferase; HET: SAM TLO; 1.35A {Streptomyces fradiae} PDB: 3pfh_A* 3px3_A* 3px2_A* Back     alignment and structure
>3ege_A Putative methyltransferase from antibiotic biosyn pathway; YP_324569.1, putative methyltransferase from antibiotic BIOS pathway; 2.40A {Anabaena variabilis atcc 29413} Back     alignment and structure
>3gwz_A MMCR; methyltransferase, mitomycin, S-adenosyl methionine, transferase; HET: MSE SAH; 1.91A {Streptomyces lavendulae} PDB: 3gxo_A* Back     alignment and structure
>4e2x_A TCAB9; kijanose, tetronitrose, tetradeoxy sugar, sugar methylation, transferase; HET: SAH TYD; 1.40A {Micromonospora chalcea} PDB: 3ndi_A* 3ndj_A* 4e32_A* 4e33_A* 4e2y_A* 4e31_A* 4e2w_A* 4e2z_A* 4e30_A* Back     alignment and structure
>3e8s_A Putative SAM dependent methyltransferase; NP_744700.1, structural genomics, joint center for structural genom JCSG; HET: SAH; 2.10A {Pseudomonas putida KT2440} Back     alignment and structure
>3m70_A Tellurite resistance protein TEHB homolog; structural genomics, PSI-2, protein ST initiative; 1.95A {Haemophilus influenzae} Back     alignment and structure
>2a14_A Indolethylamine N-methyltransferase; SGC,INMT, structural genomics, structural genomics consortium; HET: SAH; 1.70A {Homo sapiens} SCOP: c.66.1.15 Back     alignment and structure
>1zx0_A Guanidinoacetate N-methyltransferase; structural genomics, structural genomics consortium; HET: SAH; 1.86A {Homo sapiens} PDB: 3orh_A* 1xcj_A* 1xcl_A* 1p1c_A* 1p1b_A* 1khh_A* Back     alignment and structure
>3gu3_A Methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; HET: SAH; 2.30A {Bacillus cereus} SCOP: c.66.1.49 PDB: 2gh1_A Back     alignment and structure
>1ve3_A Hypothetical protein PH0226; dimer, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function, NPPSFA; HET: SAM; 2.10A {Pyrococcus horikoshii} SCOP: c.66.1.43 Back     alignment and structure
>3mcz_A O-methyltransferase; adomet_mtases, S-adenosylmethionine-dependent methyltransfer structural genomics, PSI-2; HET: MSE; 1.90A {Burkholderia thailandensis} Back     alignment and structure
>3i9f_A Putative type 11 methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.50A {Sulfolobus solfataricus} Back     alignment and structure
>3b3j_A Histone-arginine methyltransferase CARM1; protein arginine methyltransferase 4, APO catalytic domain, regulator, mRNA processing; 2.55A {Rattus norvegicus} Back     alignment and structure
>3bgv_A MRNA CAP guanine-N7 methyltransferase; alternative splicing, mRNA capping, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: SAH; 2.30A {Homo sapiens} PDB: 3epp_A* Back     alignment and structure
>1y8c_A S-adenosylmethionine-dependent methyltransferase; structural genomics, protein structure initiative, PSI; 2.50A {Clostridium acetobutylicum} SCOP: c.66.1.43 Back     alignment and structure
>3mq2_A 16S rRNA methyltransferase; methyltranferase, ribosomal, antibiotic resistance, aminoglycoside, S-adenosyl-L-methionine; HET: SAH; 1.69A {Streptomyces SP} Back     alignment and structure
>1qzz_A RDMB, aclacinomycin-10-hydroxylase; anthracycline, methyltransferase, polyketide, tailoring enzymes, structural proteomics in E spine; HET: SAM; 2.10A {Streptomyces purpurascens} SCOP: a.4.5.29 c.66.1.12 PDB: 1r00_A* 1xds_A* 1xdu_A* Back     alignment and structure
>3sm3_A SAM-dependent methyltransferases; NESG, structural genomics, PSI-biology, protein structure in northeast structural genomics; 2.20A {Methanosarcina mazei} Back     alignment and structure
>3g5t_A Trans-aconitate 3-methyltransferase; structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; HET: MSE SAH T8N; 1.12A {Saccharomyces cerevisiae} Back     alignment and structure
>2p8j_A S-adenosylmethionine-dependent methyltransferase; NP_349143.1; HET: PGE GOL; 2.00A {Clostridium acetobutylicum} Back     alignment and structure
>2kw5_A SLR1183 protein; structural genomics, northeast structural genomics consortium (NESG), PSI-2, protein structure initiative, unknown function; NMR {Synechocystis} PDB: 3mer_A Back     alignment and structure
>3ofk_A Nodulation protein S; NODS, N-methyltransferase, SAH, SAM, NOD factor, fixation, symbiosis, alpha/beta structure; HET: SAH; 1.85A {Bradyrhizobium SP} PDB: 3ofj_A* Back     alignment and structure
>3bkw_A MLL3908 protein, S-adenosylmethionine dependent methyltransferase; NP_104914.1; HET: MSE; 1.60A {Mesorhizobium loti} Back     alignment and structure
>3dp7_A SAM-dependent methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research; 2.33A {Bacteroides vulgatus} Back     alignment and structure
>3grz_A L11 mtase, ribosomal protein L11 methyltransferase; methylase, SAM-binding domain, PSI-2, nysgxrc; 2.00A {Lactobacillus delbrueckii subsp} Back     alignment and structure
>3cc8_A Putative methyltransferase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS transferase; 1.64A {Bacillus cereus} Back     alignment and structure
>1x19_A CRTF-related protein; methyltransferase, bacteriochllochlorophyll, BCHU, SAM, SAH, adenosylmethyonine, S-adenosylhomocysteine, ADO-Met; 2.27A {Chlorobium tepidum} PDB: 1x1a_A* 1x1b_A* 1x1c_A* 1x1d_A* Back     alignment and structure
>3bxo_A N,N-dimethyltransferase; desosamine, sugar, carbohydrate, antibiotic, SAM, adoMet; HET: SAM UPP; 2.00A {Streptomyces venezuelae} Back     alignment and structure
>1tw3_A COMT, carminomycin 4-O-methyltransferase; anthracycline, methylate, tailoring enzyme, polyketide, S-adenosyl-L-homocystein; HET: SAH ERT; 2.35A {Streptomyces peucetius} SCOP: a.4.5.29 c.66.1.12 PDB: 1tw2_A* Back     alignment and structure
>4hg2_A Methyltransferase type 11; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MES; 1.60A {Anaeromyxobacter dehalogenans} Back     alignment and structure
>3mti_A RRNA methylase; SAM-dependent, PSI, MCSG, structural genomics, midwest cente structural genomics, protein structure initiative; 1.95A {Streptococcus thermophilus} PDB: 3lby_A* Back     alignment and structure
>2ip2_A Probable phenazine-specific methyltransferase; pyocyanin, phenazine-1-carboxy PHZM; 1.80A {Pseudomonas aeruginosa} Back     alignment and structure
>3dxy_A TRNA (guanine-N(7)-)-methyltransferase; rossmann fold methyltransferase, tRNA modification, S-adenosyl-L-methionine, TR processing; HET: SAM; 1.50A {Escherichia coli} PDB: 3dxx_A* 3dxz_A* Back     alignment and structure
>3njr_A Precorrin-6Y methylase; methyltransferase, decarboxylase, transferase; HET: SAH PG4; 2.70A {Rhodobacter capsulatus} Back     alignment and structure
>3d2l_A SAM-dependent methyltransferase; ZP_00538691.1, structural G joint center for structural genomics, JCSG; HET: MSE; 1.90A {Exiguobacterium sibiricum 255-15} Back     alignment and structure
>2i62_A Nicotinamide N-methyltransferase; structural genomics, structural genomics consortium, SGC; HET: SAH; 1.80A {Mus musculus} PDB: 2iip_A* 3rod_A* Back     alignment and structure
>3lst_A CALO1 methyltransferase; calicheamicin, enediyne, SAH, STRU genomics, PSI-2, protein structure initiative; HET: SAH; 2.40A {Micromonospora echinospora} Back     alignment and structure
>2aot_A HMT, histamine N-methyltransferase; classic methyltransferase fold, protein-drug complex; HET: CSO 2PM SAH; 1.90A {Homo sapiens} SCOP: c.66.1.19 PDB: 1jqd_A* 2aou_A* 2aov_A* 2aox_A* 1jqe_A* 2aow_A* Back     alignment and structure
>2vdw_A Vaccinia virus capping enzyme D1 subunit; nucleotidyltransferase, S-adenosyl-L-methionine, RNA metabolism, mRNA processing, methyltransferase, poxvirus; HET: SAH; 2.70A {Vaccinia virus} Back     alignment and structure
>3cgg_A SAM-dependent methyltransferase; NP_600671.1, methyltransferase domain, structural genomics; HET: NHE CIT; 2.00A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>1wzn_A SAM-dependent methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: SAH; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.43 Back     alignment and structure
>3thr_A Glycine N-methyltransferase; GNMT, folate, methyltransferase binding, liver cytosol, transferase-transferase inhibitor C; HET: C2F TAM; 2.00A {Rattus norvegicus} SCOP: c.66.1.5 PDB: 3ths_A* 1xva_A* 1d2c_A 1kia_A* 1nbh_A* 1bhj_A* 2idj_A 2idk_A* 1d2g_A 1d2h_A* 1nbi_A* 1r8x_A 1r8y_A 1r74_A* 2azt_A* Back     alignment and structure
>3nyc_A D-arginine dehydrogenase; FAD, imino-arginine, oxidoreductas; HET: FAD IAR; 1.06A {Pseudomonas aeruginosa} PDB: 3nye_A* 3nyf_A* 3sm8_A* Back     alignment and structure
>3hm2_A Precorrin-6Y C5,15-methyltransferase; alpha-beta-sandwich, structural genomics, PSI-2, protein structure initiative; 2.21A {Corynebacterium diphtheriae} Back     alignment and structure
>3e05_A Precorrin-6Y C5,15-methyltransferase (decarboxyla; porphyrin metabolism, S-adenosyl-methionine; 1.80A {Geobacter metallireducens} SCOP: c.66.1.0 Back     alignment and structure
>3lbf_A Protein-L-isoaspartate O-methyltransferase; modified rossman-type fold, S-adenosyl-L- methionine; HET: SAH; 1.80A {Escherichia coli} Back     alignment and structure
>3evz_A Methyltransferase; NYSGXRC, NEW YORK SGX research CE structural genomics, protein structure initiative, pyrococc furiosus, PSI-2; 2.20A {Pyrococcus furiosus} Back     alignment and structure
>3orh_A Guanidinoacetate N-methyltransferase; structura genomics, structural genomics consortium, SGC; HET: SAH; 1.86A {Homo sapiens} PDB: 1xcj_A* 1xcl_A* 1p1c_A* 1p1b_A* 1khh_A* Back     alignment and structure
>3fzg_A 16S rRNA methylase; methyltransferase, plasmid, transferase; HET: SAM; 2.00A {Escherichia coli} Back     alignment and structure
>3g07_A 7SK snRNA methylphosphate capping enzyme; structural genomics consortium (SGC), methyltransferase, phosphoprotein, S-adenosyl-L-methionine; HET: SAM; 2.65A {Homo sapiens} Back     alignment and structure
>1dus_A MJ0882; hypothetical protein, methanococcus jannaschii, structural genomics, BSGC structure funded by NIH; 1.80A {Methanocaldococcus jannaschii} SCOP: c.66.1.4 Back     alignment and structure
>3uwp_A Histone-lysine N-methyltransferase, H3 lysine-79; epigenetics, tubercidin, structu genomics, structural genomics consortium, SGC; HET: 5ID; 2.05A {Homo sapiens} PDB: 4eqz_A* 3sx0_A* 4er0_A* 4er7_A* 1nw3_A* 4er6_A* 4er5_A* 3qow_A* 3qox_A* 4ek9_A* 4ekg_A* 4eki_A* 4er3_A* 3sr4_A* Back     alignment and structure
>3p9n_A Possible methyltransferase (methylase); RV2966C, adoMet binding, RNA methylase, RSMD, SAM-fold, RNA methyltransferase; 1.90A {Mycobacterium tuberculosis} Back     alignment and structure
>2gs9_A Hypothetical protein TT1324; methyl transferase, structural genomics, NPPSFA, national PR protein structural and functional analyses; HET: SAH; 2.60A {Thermus thermophilus} Back     alignment and structure
>2avn_A Ubiquinone/menaquinone biosynthesis methyltransfe related protein; ubiquinone/menaquinone biosynthesis methyltransferase-relate protein; HET: SAI; 2.35A {Thermotoga maritima} SCOP: c.66.1.41 Back     alignment and structure
>3eey_A Putative rRNA methylase; rRNA methylation, S-adenosyl-methionine, structural genomics structure initiative, PSI; HET: SAM; 2.20A {Clostridium thermocellum atcc 27405} Back     alignment and structure
>3ggd_A SAM-dependent methyltransferase; YP_325210.1, structural GEN joint center for structural genomics, JCSG; HET: SAH; 2.11A {Anabaena variabilis atcc 29413} Back     alignment and structure
>4df3_A Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; NADP rossmann superfamily, S-adenosyl-L-M (SAM) binding, nucleolus; HET: SAM; 1.73A {Aeropyrum pernix} Back     alignment and structure
>1yub_A Ermam, rRNA methyltransferase; MLS antibiotics; NMR {Streptococcus pneumoniae} SCOP: c.66.1.24 Back     alignment and structure
>1vlm_A SAM-dependent methyltransferase; possible histamine methyltransferase, structural genomics, JCSG, protein struc initiative, PSI; 2.20A {Thermotoga maritima} SCOP: c.66.1.41 Back     alignment and structure
>4a6d_A Hydroxyindole O-methyltransferase; melatonin, circadian clock; HET: SAM; 2.40A {Homo sapiens} PDB: 4a6e_A* Back     alignment and structure
>3htx_A HEN1; HEN1, small RNA methyltransferase, protein-RNA complex; HET: SAH; 3.10A {Arabidopsis thaliana} Back     alignment and structure
>2nxc_A L11 mtase, ribosomal protein L11 methyltransferase; transferase S-adenosly-L-methionine dependent methyltransfer posttranslational modification; 1.59A {Thermus thermophilus} SCOP: c.66.1.39 PDB: 1ufk_A 2nxe_A* 2nxj_A 2nxn_A 2zbp_A* 2zbq_A* 2zbr_A* 3cjq_A* 3cjr_A* 3cju_A* 3egv_A* 3cjt_A* Back     alignment and structure
>3reo_A (ISO)eugenol O-methyltransferase; directed evolution, saturation mutagenesis, regioselectivity transferase; HET: SAH EUG; 1.90A {Clarkia breweri} PDB: 3tky_A* 1kyz_A* 1kyw_A* Back     alignment and structure
>3ps9_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; rossmann fold, oxidase, methyl transferase, FAD; HET: FAD SAM; 2.54A {Escherichia coli} PDB: 3awi_A* Back     alignment and structure
>1xdz_A Methyltransferase GIDB; MCSG, protein structure initiative, structural genomics, methyltransferase fold, PSI; 1.60A {Bacillus subtilis} SCOP: c.66.1.20 Back     alignment and structure
>2qe6_A Uncharacterized protein TFU_2867; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; HET: NEP SAM; 1.95A {Thermobifida fusca} Back     alignment and structure
>3pvc_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; structural genomics, PSI-biology; HET: FAD; 2.31A {Yersinia pestis} PDB: 3sgl_A* Back     alignment and structure
>2esr_A Methyltransferase; structural genomics, hypothetical protein, streptococcus PYO PSI, protein structure initiative; HET: GLC; 1.80A {Streptococcus pyogenes} SCOP: c.66.1.46 Back     alignment and structure
>3p9c_A Caffeic acid O-methyltransferase; S-adenosylmethionine dependent O-methyltransferase; HET: SAH; 1.80A {Lolium perenne} PDB: 3p9i_A* 3p9k_A* Back     alignment and structure
>4dcm_A Ribosomal RNA large subunit methyltransferase G; 23S rRNA (guanine1835-N2)-methyltransferase; HET: SAM; 2.30A {Escherichia coli} Back     alignment and structure
>3dje_A Fructosyl amine: oxygen oxidoreductase; fructosyl-amino acid, amadoriase, deglycation, fructosamine oxidase; HET: MSE FAD FSA EPE; 1.60A {Aspergillus fumigatus} PDB: 3djd_A* Back     alignment and structure
>3dr5_A Putative O-methyltransferase; Q8NRD3, CGL1119, PF01596, CGR117, NESG, structural genomics, PSI-2, protein structure initiative; 2.25A {Corynebacterium glutamicum} Back     alignment and structure
>3lpm_A Putative methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium, nysgxrc; 2.40A {Listeria monocytogenes} Back     alignment and structure
>3ntv_A MW1564 protein; rossmann fold, putative methyltransferase, transferase; HET: MSE; 1.55A {Staphylococcus aureus} Back     alignment and structure
>2h00_A Methyltransferase 10 domain containing protein; structural genomics, structural genomics consortium, SGC; HET: SAH; 2.00A {Homo sapiens} SCOP: c.66.1.54 Back     alignment and structure
>2pxx_A Uncharacterized protein MGC2408; structural genomics consortium, SGC, methyltransferase, LOC84291, transferase; HET: SAH; 1.30A {Homo sapiens} Back     alignment and structure
>2yxe_A Protein-L-isoaspartate O-methyltransferase; rossman-type fold, alpha/beta/alpha sandwich structure, STRU genomics, NPPSFA; 2.00A {Methanocaldococcus jannaschii} Back     alignment and structure
>1ryi_A Glycine oxidase; flavoprotein, protein-inhibitor complex, oxidoreductase; HET: FAD; 1.80A {Bacillus subtilis} SCOP: c.3.1.2 d.16.1.3 PDB: 3if9_A* 1ng4_A* 1ng3_A* Back     alignment and structure
>2fca_A TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bacillus subtilis} SCOP: c.66.1.53 Back     alignment and structure
>2ift_A Putative methylase HI0767; NESG, Y767_haein, structural genomics, PSI-2, protein structure initiative; 2.30A {Haemophilus influenzae} SCOP: c.66.1.46 Back     alignment and structure
>1fp1_D Isoliquiritigenin 2'-O-methyltransferase; protein-substrate, protein-product complex; HET: SAH HCC; 1.82A {Medicago sativa} SCOP: a.4.5.29 c.66.1.12 PDB: 1fpq_A* Back     alignment and structure
>2fhp_A Methylase, putative; alpha-beta-alpha sandwich, structural genomics, PSI, protein structure initiative; HET: MSE; 1.60A {Enterococcus faecalis} SCOP: c.66.1.46 Back     alignment and structure
>3dmg_A Probable ribosomal RNA small subunit methyltransf; monomethyltranserase, 16S rRNA methyltransferase, N2 G1207 methyltransferase; HET: SAH; 1.55A {Thermus thermophilus} PDB: 3dmf_A* 3dmh_A* 2zul_A* 2zwv_A* Back     alignment and structure
>3kr9_A SAM-dependent methyltransferase; class I rossmann-like methyltransferase fold; 2.00A {Streptococcus pneumoniae} PDB: 3ku1_A* Back     alignment and structure
>3r0q_C Probable protein arginine N-methyltransferase 4.2; arginine methyltransferase, methylation; HET: SAH; 2.61A {Arabidopsis thaliana} Back     alignment and structure
>3lec_A NADB-rossmann superfamily protein; PSI, MCSG, structural genomics, midwest CENT structural genomics, protein structure initiative; 1.80A {Streptococcus agalactiae} Back     alignment and structure
>1vg0_A RAB proteins geranylgeranyltransferase component A 1; RAB prenylation, post-translational modification, protein binding/protein transport complex; HET: GER GDP PG4; 2.20A {Rattus norvegicus} SCOP: c.3.1.3 d.16.1.6 PDB: 1vg9_A* 1ltx_R* Back     alignment and structure
>2uzz_A N-methyl-L-tryptophan oxidase; N-methyltryptophan oxidase (MTOX), oxidative demethylation of N-methyl-L-tryptophan, FAD, flavoenzyme; HET: FAD; 3.2A {Escherichia coli} Back     alignment and structure
>2frn_A Hypothetical protein PH0793; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 2.10A {Pyrococcus horikoshii OT3} PDB: 3k6r_A 3a25_A* 3a26_A* Back     alignment and structure
>1vbf_A 231AA long hypothetical protein-L-isoaspartate O- methyltransferase; trimeric coiled coil assembly; 2.80A {Sulfolobus tokodaii} SCOP: c.66.1.7 Back     alignment and structure
>2fyt_A Protein arginine N-methyltransferase 3; structural genomics, structural genomics consortium, SGC; HET: SAH; 2.00A {Homo sapiens} SCOP: c.66.1.6 PDB: 3smq_A* 1f3l_A* Back     alignment and structure
>3u81_A Catechol O-methyltransferase; neurotransmitter degradation, transferase transferase inhibitor complex; HET: SAH; 1.13A {Rattus norvegicus} SCOP: c.66.1.1 PDB: 3nwe_A* 3oe5_A* 3ozr_A* 3oe4_A* 3ozt_A* 3ozs_A* 3r6t_A* 3hvi_A* 1jr4_A* 1vid_A* 1h1d_A* 2cl5_A* 3hvh_A* 3hvj_A* 3hvk_A* 3nw9_A* 3nwb_A* 3s68_A* 2zlb_A 2zth_A* ... Back     alignment and structure
>3q7e_A Protein arginine N-methyltransferase 1; HET: SAH; 2.20A {Rattus norvegicus} PDB: 1orh_A* 1ori_A* 1or8_A* Back     alignment and structure
>1l3i_A Precorrin-6Y methyltransferase/putative decarboxylase; structural genomics, beta barrel, rossmann fold, tetramer; HET: SAH; 1.95A {Methanothermobacterthermautotrophicus} SCOP: c.66.1.22 PDB: 1kxz_A 1l3b_A 1f38_A 1l3c_A* Back     alignment and structure
>1u2z_A Histone-lysine N-methyltransferase, H3 lysine-79 specific; histone methyltransferase, nucleosome; HET: SAH; 2.20A {Saccharomyces cerevisiae} SCOP: c.66.1.31 Back     alignment and structure
>3gdh_A Trimethylguanosine synthase homolog; M7G, CAP, dimethyltransferase, usnRNA, snoRNA, telomerase, cytoplasm, methyltransferase, nucleus; HET: MGP SAH; 2.00A {Homo sapiens} PDB: 3egi_A* Back     alignment and structure
>1yzh_A TRNA (guanine-N(7)-)-methyltransferase; alpha-beta-alpha sandwich, S-adenosylmeth dependent, structural genomics, PSI; 2.02A {Streptococcus pneumoniae} SCOP: c.66.1.53 Back     alignment and structure
>3kkj_A Amine oxidase, flavin-containing; oxidoreductase, PSR10, Q888A4, X-RAY, structure, PSI, protein structure initiative; HET: FAD; 2.50A {Pseudomonas syringae PV} Back     alignment and structure
>3g89_A Ribosomal RNA small subunit methyltransferase G; 16S rRNA methyltransferase, translation, cytoplasm, rRNA processing; HET: HIC SAM AMP; 1.50A {Thermus thermophilus} PDB: 3g88_A* 3g8a_A* 3g8b_A* Back     alignment and structure
>2yxd_A Probable cobalt-precorrin-6Y C(15)-methyltransfer [decarboxylating]; alpha and beta protein (A/B) class; HET: MES; 2.30A {Methanocaldococcus jannaschii} Back     alignment and structure
>1y56_B Sarcosine oxidase; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} Back     alignment and structure
>3gnl_A Uncharacterized protein, DUF633, LMOF2365_1472; structural genomics, PSI-2, protein structure initiative; 1.50A {Listeria monocytogenes str} Back     alignment and structure
>1jsx_A Glucose-inhibited division protein B; methyltransferase fold, structural genomics, PSI, protein structure initiative; 2.40A {Escherichia coli} SCOP: c.66.1.20 Back     alignment and structure
>3m33_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, MCSG, midwest center for structural genomics; 2.19A {Deinococcus radiodurans} Back     alignment and structure
>1g6q_1 HnRNP arginine N-methyltransferase; SAM-binding domain, beta-barrel, mixed alpha-beta, hexamer; 2.90A {Saccharomyces cerevisiae} SCOP: c.66.1.6 Back     alignment and structure
>4azs_A Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15A {Escherichia coli} PDB: 4azt_A* 4azv_A* 4azw_A* Back     alignment and structure
>2ozv_A Hypothetical protein ATU0636; structural genomics, predicted transferase, predicted O-methyltransferase, PFAM PF05175; HET: MSE; 1.70A {Agrobacterium tumefaciens str} Back     alignment and structure
>3id6_C Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; C/D guide RNA, 2'-O-methylation, coiled-coil, methyltransfer binding, rRNA processing; HET: SAM; 2.60A {Sulfolobus solfataricus} SCOP: c.66.1.0 PDB: 3id5_B* 3pla_E* Back     alignment and structure
>1o9g_A RRNA methyltransferase; antibiotic resistance, Se-MAD; 1.5A {Streptomyces viridochromogenes} SCOP: c.66.1.29 PDB: 1o9h_A Back     alignment and structure
>1nt2_A Fibrillarin-like PRE-rRNA processing protein; adeMet, binding motif, RNA binding protein; HET: SAM; 2.90A {Archaeoglobus fulgidus} SCOP: c.66.1.3 Back     alignment and structure
>3bzb_A Uncharacterized protein; RED ALGA, protein structure initiat center for eukaryotic structural genomics, CESG, structural genomics; 2.79A {Cyanidioschyzon merolae} Back     alignment and structure
>3mb5_A SAM-dependent methyltransferase; RNA methyltransferase, M1A, TRMI, intermolecular contacts, R specificity, tetramer, disulfide bond; HET: SAM; 1.60A {Pyrococcus abyssi} PDB: 3lga_A* 3lhd_C* Back     alignment and structure
>2b3t_A Protein methyltransferase HEMK; translation termination, methylation, conformational changes; HET: SAH; 3.10A {Escherichia coli} SCOP: c.66.1.30 PDB: 1t43_A* Back     alignment and structure
>1yb2_A Hypothetical protein TA0852; structural genomics, methyltransferase, thermoplasma acidoph midwest center for structural genomics, MCSG; 2.01A {Thermoplasma acidophilum} SCOP: c.66.1.13 Back     alignment and structure
>2gag_B Heterotetrameric sarcosine oxidase beta-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_B* 1x31_B* 1vrq_B* 3ad7_B* 3ad8_B* 3ad9_B* 3ada_B* Back     alignment and structure
>1fbn_A MJ fibrillarin homologue; MJ proteins, ribosomal RNA processing, snoRNP, structural genomics, BSGC structure funded by NIH; 1.60A {Methanocaldococcus jannaschii} SCOP: c.66.1.3 PDB: 1g8s_A Back     alignment and structure
>3tfw_A Putative O-methyltransferase; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium; 1.88A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3duw_A OMT, O-methyltransferase, putative; alternating of alpha and beta with complex SAH; HET: SAH; 1.20A {Bacillus cereus} PDB: 3dul_A* Back     alignment and structure
>2fpo_A Methylase YHHF; structural genomics, putative methyltransferase, PSI, protei structure initiative; HET: MSE; 2.05A {Escherichia coli} SCOP: c.66.1.46 Back     alignment and structure
>3dme_A Conserved exported protein; structural genomics, PSI-2, PROT structure initiative, northeast structural genomics consort NESG; HET: FAD TLA; 1.70A {Bordetella pertussis} Back     alignment and structure
>1jg1_A PIMT;, protein-L-isoaspartate O-methyltransferase; rossmann methyltransferase, protein repair isomerization; HET: SAH; 1.20A {Pyrococcus furiosus} SCOP: c.66.1.7 PDB: 1jg2_A* 1jg3_A* 1jg4_A* Back     alignment and structure
>2gpy_A O-methyltransferase; structural genomics, PSI, protein structure initiative, NEW research center for structural genomics, nysgxrc; HET: MSE; 1.90A {Bacillus halodurans} Back     alignment and structure
>2oln_A NIKD protein; flavoprotein, rossmann fold, oxidoreductase; HET: FAD; 1.15A {Streptomyces tendae} PDB: 2olo_A* 3hzl_A* 2q6u_A* Back     alignment and structure
>2gf3_A MSOX, monomeric sarcosine oxidase; flavoprotein oxidase, inhibitor 2-furoic acid, oxidoreductas; HET: FAD; 1.30A {Bacillus SP} SCOP: c.3.1.2 d.16.1.3 PDB: 1el7_A* 1el8_A* 1el9_A* 1eli_A* 1l9e_A* 2a89_A* 2gb0_A* 1el5_A* 3qse_A* 3qsm_A* 3qss_A* 3bhk_A* 3bhf_A* 3m12_A* 3m13_A* 3m0o_A* 1l9c_A* 1l9d_A* 1zov_A* Back     alignment and structure
>3q87_B N6 adenine specific DNA methylase; SAM-methyltransferase, methyltransferase, methylation, trans activator-transferase complex; HET: SAM; 2.00A {Encephalitozoon cuniculi} Back     alignment and structure
>3ckk_A TRNA (guanine-N(7)-)-methyltransferase; mettl1, S-adenosyl-L-methionine, tRNA Pro structural genomics, structural genomics consortium, SGC; HET: SAM; 1.55A {Homo sapiens} Back     alignment and structure
>2pjd_A Ribosomal RNA small subunit methyltransferase C; gene duplication, RNA modification, SAM binding; 2.10A {Escherichia coli} Back     alignment and structure
>2pwy_A TRNA (adenine-N(1)-)-methyltransferase; mtase, adoMet, TRMI, tRNA-M1A58; HET: SAH; 1.70A {Thermus thermophilus} Back     alignment and structure
>1ws6_A Methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.50A {Thermus thermophilus} SCOP: c.66.1.46 Back     alignment and structure
>3tr6_A O-methyltransferase; cellular processes; HET: SAH; 2.70A {Coxiella burnetii} SCOP: c.66.1.0 Back     alignment and structure
>3r3h_A O-methyltransferase, SAM-dependent; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.65A {Legionella pneumophila subsp} Back     alignment and structure
>1fp2_A Isoflavone O-methyltransferase; protein-product complex; HET: SAH HMO; 1.40A {Medicago sativa} SCOP: a.4.5.29 c.66.1.12 PDB: 1fpx_A* 2qyo_A* Back     alignment and structure
>1ixk_A Methyltransferase; open beta sheet; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.38 Back     alignment and structure
>1nv8_A HEMK protein; class I adoMet-dependent methyltransferase; HET: SAM MEQ; 2.20A {Thermotoga maritima} SCOP: c.66.1.30 PDB: 1nv9_A* 1vq1_A* 1sg9_A* Back     alignment and structure
>4hc4_A Protein arginine N-methyltransferase 6; HRMT1L6, S-adenosyl-L-homocysteine, struc genomics, structural genomics consortium, SGC; HET: SAH; 1.97A {Homo sapiens} Back     alignment and structure
>3giw_A Protein of unknown function DUF574; rossmann-fold protein, structural genomics, joint center for structural genomics, JCSG; HET: MSE UNL; 1.45A {Streptomyces avermitilis} PDB: 3go4_A* Back     alignment and structure
>1i1n_A Protein-L-isoaspartate O-methyltransferase; S-adenosyl homocysteine, protein repair; HET: SAH; 1.50A {Homo sapiens} SCOP: c.66.1.7 PDB: 1kr5_A* Back     alignment and structure
>3k6r_A Putative transferase PH0793; structural genomics, PSI structure initiative, midwest center for structural genomic unknown function; 2.10A {Pyrococcus horikoshii} PDB: 3a25_A* 3a26_A* Back     alignment and structure
>3ajd_A Putative methyltransferase MJ0026; tRNA, M5C, rossmann fold, structural genomics, riken structu genomics/proteomics initiative; 1.27A {Methanocaldococcus jannaschii} PDB: 3a4t_A Back     alignment and structure
>2igt_A SAM dependent methyltransferase; alpha-beta sandwich, beta-barrel, structural genomics, PSI-2 structure initiative; HET: MSE SAM GOL; 1.89A {Agrobacterium tumefaciens str} SCOP: c.66.1.51 Back     alignment and structure
>4dzr_A Protein-(glutamine-N5) methyltransferase, release specific; structural genomics, PSI-biology; 2.55A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>1o54_A SAM-dependent O-methyltransferase; TM0748, structural genomi PSI, protein structure initiative, joint center for structu genomics; 1.65A {Thermotoga maritima} SCOP: c.66.1.13 Back     alignment and structure
>3c3p_A Methyltransferase; NP_951602.1, structural genomics, joint for structural genomics, JCSG, protein structure initiative transferase; 1.90A {Geobacter sulfurreducens pca} Back     alignment and structure
>1sui_A Caffeoyl-COA O-methyltransferase; rossmann fold, protein-cofactor-substrate complex; HET: SAH FRE; 2.70A {Medicago sativa} SCOP: c.66.1.1 PDB: 1sus_A* Back     alignment and structure
>2ipx_A RRNA 2'-O-methyltransferase fibrillarin; FBL, structural genomics, structural genomics consortium, SGC; HET: MTA; 1.82A {Homo sapiens} Back     alignment and structure
>2zfu_A Nucleomethylin, cerebral protein 1; nucleolar protein, SAM-binding protein, protein structure, N phosphoprotein, nuclear protein; HET: SAH; 2.00A {Homo sapiens} Back     alignment and structure
>2yvl_A TRMI protein, hypothetical protein; tRNA, methyltransferase, S-adenosylmethionine, structural GE NPPSFA; HET: SAM; 2.20A {Aquifex aeolicus} Back     alignment and structure
>1i9g_A Hypothetical protein RV2118C; mtase, adoMet, crystal, structural genomics, protein structure initiative; HET: SAM; 1.98A {Mycobacterium tuberculosis} SCOP: c.66.1.13 Back     alignment and structure
>2hnk_A SAM-dependent O-methyltransferase; modified rossman fold; HET: SAH; 2.30A {Leptospira interrogans} Back     alignment and structure
>1r18_A Protein-L-isoaspartate(D-aspartate)-O-methyltrans; methyltransferase, isomerization, protein repair, S-adenosyl homocysteine; HET: SAH; 2.20A {Drosophila melanogaster} SCOP: c.66.1.7 Back     alignment and structure
>1af7_A Chemotaxis receptor methyltransferase CHER; chemotaxis receptor methylation; HET: SAH; 2.00A {Salmonella typhimurium} SCOP: a.58.1.1 c.66.1.8 PDB: 1bc5_A* Back     alignment and structure
>3hp7_A Hemolysin, putative; structural genomics, APC64019, PSI-2, protein STR initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.53A {Streptococcus thermophilus} Back     alignment and structure
>2pbf_A Protein-L-isoaspartate O-methyltransferase beta-A methyltransferase; protein repair, isoaspartyl formation, P. falciparum; HET: SAH; 2.00A {Plasmodium falciparum} Back     alignment and structure
>1zg3_A Isoflavanone 4'-O-methyltransferase; rossman fold, plant Pro transferase; HET: 2HI SAH; 2.35A {Medicago truncatula} PDB: 1zga_A* 1zhf_A* 1zgj_A* Back     alignment and structure
>1g8a_A Fibrillarin-like PRE-rRNA processing protein; rRNA binding, RNA binding, structural genomics, BSGC structure funded by NIH; 1.40A {Pyrococcus horikoshii} SCOP: c.66.1.3 PDB: 2nnw_B 3nmu_F* 3nvk_I* 3nvm_B 1pry_A Back     alignment and structure
>3c3y_A Pfomt, O-methyltransferase; plant secondary metabolism; HET: SAH; 1.37A {Mesembryanthemum crystallinum} Back     alignment and structure
>3tma_A Methyltransferase; thump domain; 2.05A {Thermus thermophilus} Back     alignment and structure
>3a27_A TYW2, uncharacterized protein MJ1557; wybutosine modification, transferase; HET: SAM; 2.00A {Methanocaldococcus jannaschii} Back     alignment and structure
>2vdv_E TRNA (guanine-N(7)-)-methyltransferase; S-adenosyl-L-methionine, phosphorylation, M7G, spout MT, tRNA processing; HET: SAM; 2.30A {Saccharomyces cerevisiae} PDB: 2vdu_E Back     alignment and structure
>3cbg_A O-methyltransferase; cyanobacterium; HET: SAH FER 4FE; 2.00A {Synechocystis SP} Back     alignment and structure
>3axb_A Putative oxidoreductase; dinucleotide-binding fold; HET: FAD; 1.92A {Aeropyrum pernix} PDB: 3vqr_A* Back     alignment and structure
>2avd_A Catechol-O-methyltransferase; structural genomics, structural genomics consortium, SGC; HET: SAM; 1.70A {Homo sapiens} SCOP: c.66.1.1 Back     alignment and structure
>2plw_A Ribosomal RNA methyltransferase, putative; malaria, SAM, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.70A {Plasmodium falciparum} Back     alignment and structure
>2bm8_A Cephalosporin hydroxylase CMCI; cephamycin biosynthesis; 2.5A {Streptomyces clavuligerus} SCOP: c.66.1.50 PDB: 2bm9_A* 2br5_A* 2br4_A* 2br3_A* Back     alignment and structure
>2b25_A Hypothetical protein; structural genomics, methyl transferase, SAM, structural GEN consortium, SGC, transferase; HET: SAM; 2.50A {Homo sapiens} SCOP: c.66.1.13 Back     alignment and structure
>3bwc_A Spermidine synthase; SAM, SGPP, structura genomics, PSI, protein structure initiative, structural GEN pathogenic protozoa consortium; HET: MSE SAM; 2.30A {Trypanosoma cruzi} PDB: 3bwb_A* Back     alignment and structure
>1p91_A Ribosomal RNA large subunit methyltransferase A; RLMA, RRMA, 23S rRNA, NESG, structural genomics, PSI, protein structure initiative; HET: SAM; 2.80A {Escherichia coli} SCOP: c.66.1.33 Back     alignment and structure
>1wy7_A Hypothetical protein PH1948; seven-stranded beta sheet, methyltransferase fold, structura genomics, transferase; HET: SAH; 2.20A {Pyrococcus horikoshii} SCOP: c.66.1.32 Back     alignment and structure
>1zq9_A Probable dimethyladenosine transferase; SGC, structural genomics, structural genomics consortium; HET: SAM; 1.90A {Homo sapiens} SCOP: c.66.1.24 Back     alignment and structure
>3sso_A Methyltransferase; macrolide, natural product, rossman fold; HET: SAH; 1.90A {Micromonospora griseorubida} PDB: 3ssn_A* 3ssm_A* Back     alignment and structure
>2ld4_A Anamorsin; methyltransferase-like fold, alpha/beta fold, iron-sulfur PR biogenesis, apoptosis; NMR {Homo sapiens} PDB: 2yui_A Back     alignment and structure
>2yxl_A PH0851 protein, 450AA long hypothetical FMU protein; FMU-homolog, methyltransferase, structural genomics, NPPSFA; HET: SFG; 2.55A {Pyrococcus horikoshii} Back     alignment and structure
>3opn_A Putative hemolysin; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics, nysgxrc; 2.05A {Lactococcus lactis subsp} Back     alignment and structure
>3tm4_A TRNA (guanine N2-)-methyltransferase TRM14; rossmann fold, thump domain, tRNA methyltransferase; HET: SAM; 1.95A {Pyrococcus furiosus} PDB: 3tlj_A* 3tm5_A* Back     alignment and structure
>1ej0_A FTSJ; methyltransferase, adoMet, adenosyl methionine, heat shock proteins, 23S ribosomal RNA; HET: SAM; 1.50A {Escherichia coli} SCOP: c.66.1.2 PDB: 1eiz_A* Back     alignment and structure
>3lcv_B Sisomicin-gentamicin resistance methylase SGM; antibiotic resistance, methyltransferase, transferase; HET: SAM; 2.00A {Micromonospora zionensis} PDB: 3lcu_A* Back     alignment and structure
>3m6w_A RRNA methylase; rRNA methyltransferase, 5-methylcytidine, RSMF, adoMet, MULT specific, methyltransferase, transferase; HET: CXM SAM; 1.30A {Thermus thermophilus} PDB: 3m6v_A* 3m6u_A* 3m6x_A* Back     alignment and structure
>3dou_A Ribosomal RNA large subunit methyltransferase J; cell division, structural genomics, protein structure initiative, PSI; HET: SAM; 1.45A {Thermoplasma volcanium} SCOP: c.66.1.0 Back     alignment and structure
>3m4x_A NOL1/NOP2/SUN family protein; mtase domain, PUA domain, RRM motif, transferase; 2.28A {Enterococcus faecium} Back     alignment and structure
>3v76_A Flavoprotein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: FDA; 2.51A {Sinorhizobium meliloti} Back     alignment and structure
>3gjy_A Spermidine synthase; APC62791, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.47A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>2b78_A Hypothetical protein SMU.776; structure genomics, methyltransferase, caries, structural genomics, unknown function; 2.00A {Streptococcus mutans} SCOP: b.122.1.9 c.66.1.51 PDB: 3ldf_A* Back     alignment and structure
>1pj5_A N,N-dimethylglycine oxidase; channelling, FAD binding, folate binding, amine oxidase, oxidoreductase; HET: FAD; 1.61A {Arthrobacter globiformis} SCOP: b.44.2.1 c.3.1.2 d.16.1.5 d.250.1.1 PDB: 1pj6_A* 1pj7_A* 3gsi_A* Back     alignment and structure
>1xj5_A Spermidine synthase 1; structural genomics, protein structure initiative, CESG, AT1G23820, putrescine aminopropyl transferase, SPDS1; 2.70A {Arabidopsis thaliana} SCOP: c.66.1.17 PDB: 2q41_A Back     alignment and structure
>2frx_A Hypothetical protein YEBU; rossmann-type S-adenosylmethionine-dependent methyltransfera domain; 2.90A {Escherichia coli} Back     alignment and structure
>2o07_A Spermidine synthase; structural genomics, structural genomics consortium, SGC, transferase; HET: SPD MTA; 1.89A {Homo sapiens} SCOP: c.66.1.17 PDB: 2o06_A* 2o05_A* 2o0l_A* 3rw9_A* Back     alignment and structure
>1ne2_A Hypothetical protein TA1320; structural genomics, conserved hypothetical protein, PSI, protein structure initiative; 1.75A {Thermoplasma acidophilum} SCOP: c.66.1.32 Back     alignment and structure
>2wa2_A Non-structural protein 5; transferase, S-adenosyl-L- methionine, virion, membrane, flavivirus, N7-methyltransferase, 2'-O-methyltransferase; HET: SAM; 1.80A {Modoc virus} PDB: 2wa1_A* Back     alignment and structure
>2oxt_A Nucleoside-2'-O-methyltransferase; flavivirus, viral enzyme, RNA capping, S-adenosyl-L-methionine, viral protein; HET: SAM; 2.90A {Meaban virus} Back     alignment and structure
>2qm3_A Predicted methyltransferase; putative methyltransferase, structural genomics, pyrococcus PSI-2, protein structure initiative; HET: MSE; 2.05A {Pyrococcus furiosus dsm 3638} Back     alignment and structure
>1sqg_A SUN protein, FMU protein; rossmann-fold, mixed beta sheet, methyltransferase-fold, RNA-binding domain; 1.65A {Escherichia coli} SCOP: a.79.1.3 c.66.1.38 PDB: 1sqf_A Back     alignment and structure
>1uir_A Polyamine aminopropyltransferase; spermidien synthase, spermine synthase, riken STR genomics/proteomics initiative, RSGI; 2.00A {Thermus thermophilus} SCOP: c.66.1.17 PDB: 3anx_A* Back     alignment and structure
>2pt6_A Spermidine synthase; transferase, structural genomics consor SGC,dcadoMet complex; HET: S4M 1PG; 2.00A {Plasmodium falciparum} PDB: 2pss_A* 2pt9_A* Back     alignment and structure
>2b2c_A Spermidine synthase; beta-alpha, transferase; 2.50A {Caenorhabditis elegans} SCOP: c.66.1.17 Back     alignment and structure
>4dmg_A Putative uncharacterized protein TTHA1493; rRNA, methyltransferase, S-adenosyl-methionine, 23S ribosoma transferase; HET: SAM; 1.70A {Thermus thermophilus} Back     alignment and structure
>3frh_A 16S rRNA methylase; methyltransferase domain, helical N-terminal domain, methyltransferase, plasmid, transferase; HET: SAH; 1.20A {Escherichia coli} PDB: 3fri_A* 3b89_A* Back     alignment and structure
>2i7c_A Spermidine synthase; transferase, structural genomics consor; HET: AAT 1PG; 1.71A {Plasmodium falciparum} PDB: 2hte_A* 3b7p_A* 3rie_A* 2pwp_A* Back     alignment and structure
>2as0_A Hypothetical protein PH1915; RNA methyltransferase, structural genomics, PSI, protein structure initiative; 1.80A {Pyrococcus horikoshii} SCOP: b.122.1.9 c.66.1.51 Back     alignment and structure
>1mjf_A Spermidine synthase; spermidine synthetase, structural genomics, PSI, protein structure initiative; 1.80A {Pyrococcus furiosus} SCOP: c.66.1.17 PDB: 2e5w_A* 2zsu_A* Back     alignment and structure
>3c0k_A UPF0064 protein YCCW; PUA domain, adoMet dependent methyltransferase fold; 2.00A {Escherichia coli K12} Back     alignment and structure
>1inl_A Spermidine synthase; beta-barrel, rossman fold, structural genomics, PSI, protein structure initiative; 1.50A {Thermotoga maritima} SCOP: c.66.1.17 PDB: 1jq3_A* Back     alignment and structure
>2yx1_A Hypothetical protein MJ0883; methyl transferase, tRNA modification enzyme, transferase; HET: SFG; 2.20A {Methanocaldococcus jannaschii} PDB: 2zzn_A* 3ay0_A* 2zzm_A* Back     alignment and structure
>1iy9_A Spermidine synthase; rossmann fold, structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacillus subtilis} SCOP: c.66.1.17 Back     alignment and structure
>2h1r_A Dimethyladenosine transferase, putative; SGC toronto dimethyladenosine transferase, structural genomics, structural genomics consortium; 1.89A {Plasmodium falciparum} Back     alignment and structure
>2f8l_A Hypothetical protein LMO1582; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE SAM; 2.20A {Listeria monocytogenes} SCOP: c.66.1.45 Back     alignment and structure
>1wxx_A TT1595, hypothetical protein TTHA1280; thermus thermophillus, methyltransferase, adoMet, structural genomics; 1.80A {Thermus thermophilus} SCOP: b.122.1.9 c.66.1.51 PDB: 1wxw_A 2cww_A* Back     alignment and structure
>3v97_A Ribosomal RNA large subunit methyltransferase L; YCBY, RNA methyltransferase, ribosome RNA, SAH, RLML; HET: SAH OSU; 2.20A {Escherichia coli} PDB: 3v8v_A* Back     alignment and structure
>2nyu_A Putative ribosomal RNA methyltransferase 2; SAM, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.76A {Homo sapiens} Back     alignment and structure
>3k0b_A Predicted N6-adenine-specific DNA methylase; methylase,PF01170, putative RNA methylase, PSI,MCSG, structu genomics; 1.50A {Listeria monocytogenes str} Back     alignment and structure
>3ldu_A Putative methylase; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: MSE GTP; 1.70A {Clostridium difficile} Back     alignment and structure
>2jjq_A Uncharacterized RNA methyltransferase pyrab10780; metal-binding, tRNA methyltransferase, S-adenosyl-L-methionine, iron, 4Fe-4S, iron-sulfur; HET: SAH; 1.8A {Pyrococcus abyssi} PDB: 2vs1_A* Back     alignment and structure
>2okc_A Type I restriction enzyme stysji M protein; NP_813429.1, N-6 DNA methylase, type I restriction enzyme ST protein; HET: SAM; 2.20A {Bacteroides thetaiotaomicron vpi-5482} SCOP: c.66.1.45 Back     alignment and structure
>3gru_A Dimethyladenosine transferase; rossman fold, ribosomal assem adenosyl-L-methionine, rRNA, methyltransferase, RNA-binding processing; HET: AMP; 1.60A {Methanocaldococcus jannaschii} PDB: 3grr_A* 3grv_A* 3gry_A* 3fyd_A 3fyc_A* Back     alignment and structure
>3ldg_A Putative uncharacterized protein SMU.472; YPSC, methyltransferase, transferase; HET: SAH; 1.96A {Streptococcus mutans} Back     alignment and structure
>1uwv_A 23S rRNA (uracil-5-)-methyltransferase RUMA; RNA modification, iron-sulfur cluster, RNA processing; 1.95A {Escherichia coli} SCOP: b.40.4.12 c.66.1.40 PDB: 2bh2_A* Back     alignment and structure
>2p41_A Type II methyltransferase; vizier, viral enzymes involved in replication, dengue virus methyltransferase, structural genomics; HET: G1G SAH CIT; 1.80A {Dengue virus 2} SCOP: c.66.1.25 PDB: 2p1d_A* 1l9k_A* 2p3o_A* 2p3q_A* 2p40_A* 2p3l_A* 1r6a_A* Back     alignment and structure
>2i0z_A NAD(FAD)-utilizing dehydrogenases; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: FAD; 1.84A {Bacillus cereus} SCOP: c.3.1.8 e.74.1.1 Back     alignment and structure
>1qam_A ERMC' methyltransferase; rRNA methyltransferase ERMC', cofactor analogs; 2.20A {Bacillus subtilis} SCOP: c.66.1.24 PDB: 1qan_A* 1qao_A* 1qaq_A* 2erc_A Back     alignment and structure
>2cmg_A Spermidine synthase; transferase, putrescine aminopropyltransferase, spermidine biosynthesis, polyamine biosynthesis, SPEE; 2.0A {Helicobacter pylori} PDB: 2cmh_A Back     alignment and structure
>2gqf_A Hypothetical protein HI0933; structural genomics, FAD-utilizing protein, flavoprotein, PS protein structure initiative; HET: FAD; 2.70A {Haemophilus influenzae} SCOP: c.3.1.8 e.74.1.1 Back     alignment and structure
>3rp8_A Flavoprotein monooxygenase; FAD-binding protein, oxidoreductase; HET: FAD; 1.97A {Klebsiella pneumoniae} PDB: 3rp7_A* 3rp6_A* Back     alignment and structure
>2xyq_A Putative 2'-O-methyl transferase; transferase-viral protein complex, rossman fold; HET: SAH; 2.00A {Sars coronavirus} PDB: 2xyv_A* 2xyr_A* Back     alignment and structure
>2b9e_A NOL1/NOP2/SUN domain family, member 5 isoform 2; methytransferase, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.65A {Homo sapiens} SCOP: c.66.1.38 Back     alignment and structure
>3da1_A Glycerol-3-phosphate dehydrogenase; NESG BHR167 Q9KDW6 X-RAY, structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.70A {Bacillus halodurans} Back     alignment and structure
>3b5i_A S-adenosyl-L-methionine:salicylic acid carboxyl methyltransferase-like protein; sabath family, indole-3-acetic acid, S-AD methionine; HET: SAH; 2.75A {Arabidopsis thaliana} Back     alignment and structure
>2vou_A 2,6-dihydroxypyridine hydroxylase; oxidoreductase, aromatic hydroxylase, nicotine degradation, mono-oxygenase; HET: FAD; 2.6A {Arthrobacter nicotinovorans} SCOP: c.3.1.2 d.16.1.2 Back     alignment and structure
>2ih2_A Modification methylase TAQI; DNA, DNA methyltransferase, target base partner, 5-methylpyr 2(1H)-ONE, base flipping; HET: 5PY 6MA NEA; 1.61A {Thermus aquaticus} SCOP: c.66.1.27 d.287.1.1 PDB: 2ibs_A* 2ibt_A* 2ih4_A* 2ih5_A* 2jg3_A* 2np6_A* 2np7_A* 1aqj_A* 1aqi_A* 2adm_A* 1g38_A* Back     alignment and structure
>3nlc_A Uncharacterized protein VP0956; FAD-binding protein, NESG, structural genomics, PSI-2, prote structure initiative; HET: FAD; 2.15A {Vibrio parahaemolyticus} Back     alignment and structure
>2qa2_A CABE, polyketide oxygenase CABE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 2.70A {Streptomyces} Back     alignment and structure
>2r6z_A UPF0341 protein in RSP 3' region; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 1.80A {Neisseria gonorrhoeae} Back     alignment and structure
>2qa1_A PGAE, polyketide oxygenase PGAE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 1.80A {Streptomyces} Back     alignment and structure
>3tqs_A Ribosomal RNA small subunit methyltransferase A; protein synthesis; 1.98A {Coxiella burnetii} SCOP: c.66.1.0 Back     alignment and structure
>3fut_A Dimethyladenosine transferase; methyltransferase, dimethyltransferase, dual-specific methyltransferase, 16S rRNA methyltransferase; 1.52A {Thermus thermophilus} PDB: 3fuu_A* 3fuv_A 3fuw_A* 3fux_A* Back     alignment and structure
>2x3n_A Probable FAD-dependent monooxygenase; oxidoreductase; HET: FAD; 1.75A {Pseudomonas aeruginosa} Back     alignment and structure
>4hb9_A Similarities with probable monooxygenase; flavin, structural genomics, NEW YORK structural genomics RE consortium, nysgrc, PSI; HET: MSE FAD; 1.93A {Photorhabdus luminescens} Back     alignment and structure
>3nix_A Flavoprotein/dehydrogenase; structural genomics, PSI-2, NES protein structure initiative, northeast structural genomics consortium; HET: FAD; 2.60A {Cytophaga hutchinsonii} Back     alignment and structure
>3alj_A 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; alpha/beta fold, oxidoreductase; HET: FAD; 1.48A {Mesorhizobium loti} PDB: 3alh_A* 3ali_A* 3gmb_A* 3gmc_A* 3alk_A* 3alm_A* 3all_A* Back     alignment and structure
>3bt7_A TRNA (uracil-5-)-methyltransferase; methyluridine, methyltransferase, TRMA, RUMT; HET: 5MU; 2.43A {Escherichia coli} Back     alignment and structure
>4gqb_A Protein arginine N-methyltransferase 5; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} PDB: 4g56_A* Back     alignment and structure
>1y0p_A Fumarate reductase flavoprotein subunit; flavocytochrome, mesaconate, oxidoreductase; HET: HEM FAD; 1.50A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1qjd_A* 2b7s_A* 1jry_A* 2b7r_A* 1ksu_A* 1jrz_A* 1jrx_A* 1m64_A* 1p2h_A* 1p2e_A* 1kss_A* 1e39_A* 1q9i_A* 1lj1_A* Back     alignment and structure
>3i3l_A Alkylhalidase CMLS; flavin-dependent halogenase, chloramphenicol biosynthesis, halogenation reaction, structural genomics; HET: FAD; 2.20A {Streptomyces venezuelae} Back     alignment and structure
>2rgh_A Alpha-glycerophosphate oxidase; flavoprotein oxidase, oxidoreductase; HET: FAD; 2.30A {Streptococcus SP} PDB: 2rgo_A* Back     alignment and structure
>3ihg_A RDME; flavoenzyme, anthracycline, polyketide biosynthesis, merohedral twinning, enzyme mechanism, hydroxylase, flavoprotein; HET: FAD VAK; 2.49A {Streptomyces purpurascens} Back     alignment and structure
>2dul_A N(2),N(2)-dimethylguanosine tRNA methyltransferas; tRNA modification enzyme, guanine 26, N(2),N(2)-dimethyltran structural genomics; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.58 PDB: 2ejt_A* 2eju_A* 2ytz_A* Back     alignment and structure
>3fmw_A Oxygenase; mithramycin, baeyer-villiger, flavin binding protein, oxidoreductase; HET: FAD; 2.89A {Streptomyces argillaceus} Back     alignment and structure
>4at0_A 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidoreductase, dehydogenase, steroid catabolism; HET: FAD; 1.60A {Rhodococcus jostii} PDB: 4at2_A* Back     alignment and structure
>2xdo_A TETX2 protein; tetracycline degradation, tigecycline, flavin, bacteroides F oxidoreductase; HET: FAD; 2.09A {Bacteroides thetaiotaomicron} PDB: 2y6q_A* 2xyo_A* 2y6r_A* 3p9u_A* Back     alignment and structure
>1qo8_A Flavocytochrome C3 fumarate reductase; oxidoreductase; HET: HEM FAD; 2.15A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 Back     alignment and structure
>1k0i_A P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, hydrolase; HET: FAD PHB; 1.80A {Pseudomonas aeruginosa} SCOP: c.3.1.2 d.16.1.2 PDB: 1k0j_A* 1k0l_A* 1doc_A* 1d7l_A* 1dod_A* 1doe_A* 1ius_A* 1iut_A* 1iuu_A* 1iuv_A* 1iuw_A* 1iux_A* 1pxb_A* 1pxc_A* 1dob_A* 1ykj_A* 1pxa_A* 1pbe_A* 1pdh_A* 1phh_A* ... Back     alignment and structure
>3gwf_A Cyclohexanone monooxygenase; flavoprotein biocatalysis baeyer-villiger oxidation green CH monooxygenase, oxidoreductase; HET: FAD NAP; 2.20A {Rhodococcus SP} PDB: 3gwd_A* 3ucl_A* Back     alignment and structure
>3axs_A Probable N(2),N(2)-dimethylguanosine tRNA methylt TRM1; structural genomics, riken structural genomics/proteomics in RSGI; HET: SFG; 2.16A {Aquifex aeolicus} PDB: 3axt_A* Back     alignment and structure
>2qcu_A Aerobic glycerol-3-phosphate dehydrogenase; glycerol-3-phoshate dehydrogenase, oxidoreductase; HET: BOG FAD TAM; 1.75A {Escherichia coli} PDB: 2r45_A* 2r46_A* 2r4e_A* 2r4j_A* Back     alignment and structure
>1m6y_A S-adenosyl-methyltransferase MRAW; SAM-dependent methyltransferase fold, protein-cofactor product complex, structural genomics, PSI; HET: SAH; 1.90A {Thermotoga maritima} SCOP: a.60.13.1 c.66.1.23 PDB: 1n2x_A* Back     alignment and structure
>4ap3_A Steroid monooxygenase; oxidoreductase, baeyer-villiger; HET: FAD NAP; 2.39A {Rhodococcus rhodochrous} PDB: 4aox_A* 4aos_A* 4ap1_A* Back     alignment and structure
>4a9w_A Monooxygenase; baeyer-villiger, FAD, oxidoreductase; HET: FAD; 2.72A {Stenotrophomonas maltophilia} Back     alignment and structure
>1rp0_A ARA6, thiazole biosynthetic enzyme; protein ligand complex, biosynthetic protein; HET: AHZ HTO; 1.60A {Arabidopsis thaliana} SCOP: c.3.1.6 Back     alignment and structure
>3cvo_A Methyltransferase-like protein of unknown functio; rossman fold, structural genomics, joint center for structur genomics, JCSG; HET: MSE PG4; 1.80A {Silicibacter pomeroyi dss-3} Back     alignment and structure
>3itj_A Thioredoxin reductase 1; disulfide B flavoprotein, NADP, oxidoreductase, phosphoprotein, redox-A center; HET: FAD CIT; 2.40A {Saccharomyces cerevisiae} PDB: 3d8x_A* Back     alignment and structure
>3o0h_A Glutathione reductase; ssgcid, structur genomics, seattle structural genomics center for infectious gluathione reductase, oxidoreductase; HET: FAD; 1.90A {Bartonella henselae} Back     alignment and structure
>3f8d_A Thioredoxin reductase (TRXB-3); redox protein, nucleotide binding, FAD, flavoprotein, oxidoreductase; HET: FAD; 1.40A {Sulfolobus solfataricus} PDB: 3f8p_A* 3f8r_A* Back     alignment and structure
>3oz2_A Digeranylgeranylglycerophospholipid reductase; structural genomics, joint center for structural genomics; HET: MSE FAD OZ2; 1.60A {Thermoplasma acidophilum} Back     alignment and structure
>3c96_A Flavin-containing monooxygenase; FAD, oxidoreductase, PF01266, NESG, PAR240, structural genomics, PSI-2; HET: FAD; 1.90A {Pseudomonas aeruginosa PAO1} SCOP: c.3.1.2 d.16.1.2 PDB: 2rgj_A* Back     alignment and structure
>3e1t_A Halogenase; flavoprotein; HET: FAD; 2.05A {Chondromyces crocatus} Back     alignment and structure
>2zbw_A Thioredoxin reductase; redox protein, oxidoreductase, structural genomics, NPPSFA, project on protein structural and functional analyses; HET: FAD; 2.10A {Thermus thermophilus} Back     alignment and structure
>3c4n_A Uncharacterized protein DR_0571; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.40A {Deinococcus radiodurans R1} Back     alignment and structure
>2ar0_A M.ecoki, type I restriction enzyme ecoki M protein; structural genomics, protein structure initiative, nysgxrc; 2.80A {Escherichia coli} SCOP: c.66.1.45 PDB: 2y7c_B 2y7h_B* Back     alignment and structure
>3lzw_A Ferredoxin--NADP reductase 2; ferredoxin reductase, FAD, NADPH, flavoprotein, oxidor; HET: FAD NAP; 1.80A {Bacillus subtilis} PDB: 3lzx_A* Back     alignment and structure
>2oyr_A UPF0341 protein YHIQ; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAH; 2.00A {Shigella flexneri 2A} SCOP: c.66.1.55 PDB: 2pgx_A 2pkw_A Back     alignment and structure
>1d4d_A Flavocytochrome C fumarate reductase; oxidoreductase; HET: HEM FAD; 2.50A {Shewanella oneidensis} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1d4e_A* 1d4c_A* Back     alignment and structure
>2gv8_A Monooxygenase; FMO, FAD, NADPH, cofactor complex, PSI, structura genomics, protein structure initiative; HET: FAD NDP; 2.10A {Schizosaccharomyces pombe} SCOP: c.3.1.5 c.3.1.5 PDB: 2gvc_A* 1vqw_A* Back     alignment and structure
>2efj_A 3,7-dimethylxanthine methyltransferase; SAM-dependant methyltransferase, SAH, theobromine; HET: SAH 37T; 2.00A {Coffea canephora} PDB: 2eg5_A* Back     alignment and structure
>3oc4_A Oxidoreductase, pyridine nucleotide-disulfide FAM; structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.60A {Enterococcus faecalis} Back     alignment and structure
>3uzu_A Ribosomal RNA small subunit methyltransferase A; ssgcid, seattle structural genomics center for infectio disease; 1.75A {Burkholderia pseudomallei} Back     alignment and structure
>3atr_A Conserved archaeal protein; saturating double bonds, archaeal membrane precursor, like 2 geranylgeranylglyceryl phosphate; HET: FDA; 1.80A {Sulfolobus acidocaldarius} PDB: 3atq_A* Back     alignment and structure
>3fg2_P Putative rubredoxin reductase; ferredoxin reductase, RPA3782, F flavoprotein, oxidoreductase; HET: FAD; 2.20A {Rhodopseudomonas palustris} Back     alignment and structure
>3lxd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; glutathione reductase (GR)-like ONFR; HET: FAD; 2.50A {Novosphingobium aromaticivorans} Back     alignment and structure
>3ua3_A Protein arginine N-methyltransferase 5; TIM-barrel, rossmann fold, beta-barrel, symmetric arginine dimethylase, SAM binding; HET: SAH; 3.00A {Caenorhabditis elegans} PDB: 3ua4_A Back     alignment and structure
>3ab1_A Ferredoxin--NADP reductase; oxidoreductase, electron transport, FAD, flavoprotein; HET: FAD; 2.39A {Chlorobaculum tepidum} Back     alignment and structure
>1w4x_A Phenylacetone monooxygenase; baeyer-villiger, FAD; HET: FAD; 1.7A {Thermobifida fusca} SCOP: c.3.1.5 c.3.1.5 PDB: 2ylr_A* 2yls_A* 2ylt_A* 2ym1_A* 2ylw_A* 2ym2_A* 2ylx_A* 2ylz_A* Back     alignment and structure
>3v97_A Ribosomal RNA large subunit methyltransferase L; YCBY, RNA methyltransferase, ribosome RNA, SAH, RLML; HET: SAH OSU; 2.20A {Escherichia coli} PDB: 3v8v_A* Back     alignment and structure
>2aqj_A Tryptophan halogenase, pRNA; flavin-dependent halogenase, helical bundle, sandwiched sheets, structural genomics; HET: TRP FAD; 1.80A {Pseudomonas fluorescens} PDB: 2apg_A* 2ar8_A* 2ard_A* 2jkc_A* Back     alignment and structure
>3ftd_A Dimethyladenosine transferase; KSGA, rossmann-like fold, RNA methyltransferase, mtase, anti resistance, methyltransferase, RNA-binding; 1.44A {Aquifex aeolicus} PDB: 3ftc_A 3fte_A 3ftf_A* 3r9x_B* Back     alignment and structure
>3d1c_A Flavin-containing putative monooxygenase; NP_373108.1, struc genomics, joint center for structural genomics, JCSG; HET: FAD UNL; 2.40A {Staphylococcus aureus} Back     alignment and structure
>2bry_A NEDD9 interacting protein with calponin homology and LIM domains; transport, coiled coil, cytoskeleton, FAD, flavoprotein, metal-binding, zinc; HET: FAD; 1.45A {Mus musculus} PDB: 2c4c_A* 2bra_A* Back     alignment and structure
>4dna_A Probable glutathione reductase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; HET: FAD; 2.80A {Sinorhizobium meliloti} Back     alignment and structure
>3uox_A Otemo; baeyer-villiger monooxygenase, oxidoreductase; HET: FAD; 1.96A {Pseudomonas putida} PDB: 3uov_A* 3uoy_A* 3uoz_A* 3up4_A* 3up5_A* Back     alignment and structure
>2h88_A Succinate dehydrogenase flavoprotein subunit; complex II, membrane protein, heme protein, iron sulfur PROT cytochrome B, oxidoreductase; HET: FAD BHG HEM UNL; 1.74A {Gallus gallus} PDB: 1yq4_A* 1yq3_A* 2fbw_A* 2h89_A* 2wqy_A* 1zoy_A* 1zp0_A* 3abv_A* 3ae1_A* 3ae2_A* 3ae3_A* 3ae4_A* 3ae5_A* 3ae6_A* 3ae7_A* 3ae8_A* 3ae9_A* 3aea_A* 3aeb_A* 3aec_A* ... Back     alignment and structure
>3khk_A Type I restriction-modification system methylation subunit; structural genomics, PSI-2, protein structure initiative; 2.55A {Methanosarcina mazei} Back     alignment and structure
>1qyr_A KSGA, high level kasugamycin resistance protein, S-adenosylMet; adenosine dimethyltransferase, rRNA modification, transferase, translation; 2.10A {Escherichia coli} SCOP: c.66.1.24 PDB: 4adv_V 3tpz_A Back     alignment and structure
>2wdq_A Succinate dehydrogenase flavoprotein subunit; succinate dehydrogenase activity, cell inner membrane, trica acid cycle; HET: FAD HEM CBE; 2.40A {Escherichia coli} PDB: 1nen_A* 2acz_A* 1nek_A* 2wdr_A* 2wdv_A* 2wp9_A* 2ws3_A* 2wu2_A* 2wu5_A* Back     alignment and structure
>2bs2_A Quinol-fumarate reductase flavoprotein subunit A; 2Fe-2S, 3Fe-4S, 4Fe-4S, citric acid cycle, dihaem cytochrome B; HET: FAD HEM LMT; 1.78A {Wolinella succinogenes} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 2bs3_A* 1e7p_A* 2bs4_A* 1qlb_A* Back     alignment and structure
>1xdi_A RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno function; HET: FAD; 2.81A {Mycobacterium tuberculosis} SCOP: c.3.1.5 d.87.1.1 Back     alignment and structure
>2weu_A Tryptophan 5-halogenase; regioselectivity, antifungal protei; HET: TRP; 1.70A {Streptomyces rugosporus} PDB: 2wet_A* 2wes_A* Back     alignment and structure
>3jsk_A Cypbp37 protein; octameric thiazole synthase, biosynthetic protein; HET: AHZ; 2.70A {Neurospora crassa} Back     alignment and structure
>2e4g_A Tryptophan halogenase; flavin-binding, rebeccamycin biosynthesis, biosynthetic protein, flavoprotein; HET: TRP; 2.08A {Lechevalieria aerocolonigenes} PDB: 2o9z_A 2oa1_A* 2oal_A* 2oam_A Back     alignment and structure
>3ll7_A Putative methyltransferase; methytransferase, structural genomics, MCSG, PSI-2, protein initiative; HET: MSE; 1.80A {Porphyromonas gingivalis} Back     alignment and structure
>1trb_A Thioredoxin reductase; oxidoreductase(flavoenzyme); HET: FAD; 2.00A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 PDB: 1cl0_A* 1f6m_A* 1tdf_A* 1tde_A* Back     alignment and structure
>2xve_A Flavin-containing monooxygenase; oxidoreductase; HET: FAD; 1.99A {Methylophaga aminisulfidivorans} PDB: 2xvf_A* 2xvh_A* 2xvi_A* 2xvj_A* 2xlt_A* 2vqb_A* 2vq7_A* 2xlu_A* 2xlp_A* 2xls_A* 2xlr_A* Back     alignment and structure
>2pyx_A Tryptophan halogenase; structural genomics, JOI for structural genomics, JCSG, protein structure initiative biosynthetic protein; HET: MSE TLA PG4; 1.50A {Shewanella frigidimarina} Back     alignment and structure
>3iwa_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; structural genomics, PSI-2, protein structur initiative; 2.30A {Desulfovibrio vulgaris} Back     alignment and structure
>1ges_A Glutathione reductase; oxidoreductase(flavoenzyme); HET: FAD; 1.74A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1geu_A* 1ger_A* 1get_A* Back     alignment and structure
>1mo9_A ORF3; nucleotide binding motifs, nucleotide binding domain, oxidor; HET: FAD KPC; 1.65A {Xanthobacter autotrophicus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1mok_A* 2c3c_A* 2c3d_A* 3q6j_A* Back     alignment and structure
>2r0c_A REBC; flavin adenine dinucleotide, monooxygenase, oxidoreductase; HET: FAD; 1.80A {Lechevalieria aerocolonigenes} PDB: 2r0g_A* 2r0p_A* 3ept_A* Back     alignment and structure
>2gmh_A Electron transfer flavoprotein-ubiquinone oxidoreductase; HET: BHG FAD UQ5; 2.50A {Sus scrofa} SCOP: c.3.1.2 d.16.1.8 d.58.1.6 PDB: 2gmj_A* Back     alignment and structure
>2q0l_A TRXR, thioredoxin reductase; bacterial thiredoxin reductase, NADP+ B reduced izoalloxazine bending, oxidoreductase; HET: FAD NAP; 1.45A {Helicobacter pylori} PDB: 2q0k_A* 3ish_A* Back     alignment and structure
>2ywl_A Thioredoxin reductase related protein; uncharacterized conserved protein, rossmann fold, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2cvj_A* Back     alignment and structure
>2gjc_A Thiazole biosynthetic enzyme, mitochondrial; glutathione reductase type II family, thiazole synthase, mitochondria DNA repair; HET: AHZ; 1.82A {Saccharomyces cerevisiae} PDB: 3fpz_A* Back     alignment and structure
>2zxi_A TRNA uridine 5-carboxymethylaminomethyl modificat MNMG; modification, 5-carboxymethylaminomethyl uridine, WOBB uridine, FAD; HET: FAD; 2.30A {Aquifex aeolicus} PDB: 2zxh_A* 2e57_A* Back     alignment and structure
>2cul_A Glucose-inhibited division protein A-related PROT probable oxidoreductase; rossmann fold, protein-FAD complex; HET: FAD; 1.65A {Thermus thermophilus} SCOP: c.3.1.7 Back     alignment and structure
>2q7v_A Thioredoxin reductase; rossman fold, FAD, flavoprotein, oxidoreductase, redox- active center; HET: FAD; 1.90A {Deinococcus radiodurans} Back     alignment and structure
>2qae_A Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystine-oxidoreductase, homodimer; HET: FAD; 1.90A {Trypanosoma cruzi} Back     alignment and structure
>4fk1_A Putative thioredoxin reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: MSE FAD; 2.40A {Bacillus anthracis} PDB: 4fk1_C* Back     alignment and structure
>2yqu_A 2-oxoglutarate dehydrogenase E3 component; lipoamide dehydrogenase, 2-oxoglutarate dehydrogenase comple pyruvate dehydrogenase complex; HET: FAD; 1.70A {Thermus thermophilus} PDB: 2eq7_A* Back     alignment and structure
>3urh_A Dihydrolipoyl dehydrogenase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium; HET: FAD; 1.90A {Sinorhizobium meliloti} Back     alignment and structure
>3evf_A RNA-directed RNA polymerase NS5; NS5 methyltransferase, RNA CAP binding, binding, capsid protein; HET: GTA SAH; 1.45A {Yellow fever virus} SCOP: c.66.1.0 PDB: 3evb_A* 3evc_A* 3evd_A* 3eve_A* 3eva_A* Back     alignment and structure
>2v3a_A Rubredoxin reductase; alkane degradation, NADH oxidoreductase, rubredoxin reductas NAD, flavoprotein, oxidoreductase; HET: FAD; 2.4A {Pseudomonas aeruginosa} PDB: 2v3b_A* Back     alignment and structure
>1m6e_X S-adenosyl-L-methionnine:salicylic acid carboxyl methyltransferase; rossmann fold, protein-small molecule complex; HET: SAH SAL; 3.00A {Clarkia breweri} SCOP: c.66.1.35 Back     alignment and structure
>3lkd_A Type I restriction-modification system methyltransferase subunit; Q5M500_STRT2, STU0711, NESG, SUR80, structural genomics, PSI-2; 2.25A {Streptococcus thermophilus} Back     alignment and structure
>1fec_A Trypanothione reductase; redox-active center, oxidoreductase, flavoprotein, FAD, NADP; HET: FAD; 1.70A {Crithidia fasciculata} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1fea_A* 1feb_A* 2tpr_A* 1tyt_A* 1typ_A* 2jk6_A* 2w0h_A* 2yau_A* 2x50_A* 2ve2_A* Back     alignment and structure
>1chu_A Protein (L-aspartate oxidase); flavoenzyme, NAD biosynthesis, FAD, oxidoreductase; 2.20A {Escherichia coli} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1knr_A* 1knp_A* Back     alignment and structure
>3fbs_A Oxidoreductase; structural genomics, PSI2, MCSG, protein STR initiative, midwest center for structural genomics; HET: FAD; 2.15A {Agrobacterium tumefaciens} Back     alignment and structure
>2r9z_A Glutathione amide reductase; NAD, FAD, substrate specificity, oxidoreductase; HET: FAD; 2.10A {Marichromatium gracile} PDB: 2rab_A* Back     alignment and structure
>3ef6_A Toluene 1,2-dioxygenase system ferredoxin--NAD(+) reductase; FAD binding protein, NADH binding protein, aromatic hydrocar catabolism, FAD; HET: FAD; 1.80A {Pseudomonas putida} PDB: 4emi_A* 4emj_A* Back     alignment and structure
>3ces_A MNMG, tRNA uridine 5-carboxymethylaminomethyl modificat GIDA, GIDA; tRNA modification, FAD binding domain, structural genomics; 2.41A {Escherichia coli} PDB: 3cp2_A 3g05_A Back     alignment and structure
>3ics_A Coenzyme A-disulfide reductase; pyridine nucleotide-disulfide oxidoreductase class I, rhodan coenzyme A, flavin adenine dinucleotide; HET: FAD COA ADP; 1.94A {Bacillus anthracis} PDB: 3icr_A* 3ict_A* Back     alignment and structure
>1vdc_A NTR, NADPH dependent thioredoxin reductase; hypothetical protein, redox-active center, oxidoreductase, D oxidoreductase; HET: FAD; 2.50A {Arabidopsis thaliana} SCOP: c.3.1.5 c.3.1.5 PDB: 2whd_A* Back     alignment and structure
>3lad_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD; 2.20A {Azotobacter vinelandii} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1lpf_A* Back     alignment and structure
>1kf6_A Fumarate reductase flavoprotein; respiration, fumarate reductace, succinate dehydrogenase, CO quinol, quinone, oxidoreductase; HET: FAD HQO CE1 1PE; 2.70A {Escherichia coli} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1kfy_A* 1l0v_A* 2b76_A* 3cir_A* 3p4p_A* 3p4q_A* 3p4r_A* 3p4s_A* Back     alignment and structure
>3k30_A Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP binding site, oxidoreductase; HET: FMN ADP; 2.70A {Pimelobacter simplex} Back     alignment and structure
>2hqm_A GR, grase, glutathione reductase; glutathione reductase complexed with FAD, oxidoreductase; HET: NAG FAD GSH; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3cty_A Thioredoxin reductase; FAD, oxidoreductase, flavin, flavoprotein; HET: FAD; 2.35A {Thermoplasma acidophilum} Back     alignment and structure
>1fl2_A Alkyl hydroperoxide reductase subunit F; reactive oxygen, FAD, disulphi oxidoreductase, oxidoreductase; HET: FAD; 1.90A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 Back     alignment and structure
>2wpf_A Trypanothione reductase; oxidoreductase, trypanosomiasis, sleeping sickness, flavoPro redox-active center; HET: FAD WPF; 1.90A {Trypanosoma brucei} PDB: 2wov_A* 2wow_A* 2wp5_A* 2wp6_A* 2wpc_A* 2wpe_A* 2woi_A* 2wba_A* 1nda_A* 1gxf_A* 1bzl_A* 1aog_A* Back     alignment and structure
>1dxl_A Dihydrolipoamide dehydrogenase; oxidoreductase, multienzyme complex protein, pyruvate dehydrogenase complex, glycine decarboxylase complex; HET: FAD; 3.15A {Pisum sativum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>3r9u_A Thioredoxin reductase; structural genomics, center for structural genomics of infec diseases, csgid, thioredoxin-disulfide reductase, FAD; HET: FAD; 2.36A {Campylobacter jejuni} Back     alignment and structure
>2dkh_A 3-hydroxybenzoate hydroxylase; flavoprotein, monooxygenase, complex, oxidoreductase; HET: FAD 3HB; 1.80A {Comamonas testosteroni} PDB: 2dki_A* Back     alignment and structure
>1zk7_A HGII, reductase, mercuric reductase; mercuric ION reductase, oxidoreductase; HET: FAD; 1.60A {Pseudomonas aeruginosa} PDB: 1zx9_A* Back     alignment and structure
>2e5v_A L-aspartate oxidase; archaea, oxidoreductase; HET: FAD; 2.09A {Sulfolobus tokodaii} Back     alignment and structure
>3s5w_A L-ornithine 5-monooxygenase; class B flavin dependent N-hydroxylating monooxygenase, CLAS flavin dependent monooxygenase N-hydroxylating; HET: FAD ONH NAP; 1.90A {Pseudomonas aeruginosa} PDB: 3s61_A* Back     alignment and structure
>1zmd_A Dihydrolipoyl dehydrogenase; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha- ketoglutarate dehydrogenase; HET: FAD NAI; 2.08A {Homo sapiens} PDB: 1zmc_A* 2f5z_A* 1zy8_A* 3rnm_A* Back     alignment and structure
>3ntd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; COA, persulfide reductase, rhodanese; HET: COA FAD; 1.99A {Shewanella loihica} PDB: 3nta_A* 3nt6_A* Back     alignment and structure
>1onf_A GR, grase, glutathione reductase; oxidoreductase; HET: FAD; 2.60A {Plasmodium falciparum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>3h8l_A NADH oxidase; membrane protein, complete form, rossman-like fold, oxidoreductase; HET: FAD; 2.57A {Acidianus ambivalens} PDB: 3h8i_A* Back     alignment and structure
>2qy6_A UPF0209 protein YFCK; structural genomics, unknown function, PSI-2, protein struct initiative; 2.00A {Escherichia coli} Back     alignment and structure
>3o4f_A Spermidine synthase; aminopropyltransferase, polyamine synthase, rossmann fold, P biosynthesis, spermidine biosynthesis, transferase; 2.90A {Escherichia coli} Back     alignment and structure
>1y56_A Hypothetical protein PH1363; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} Back     alignment and structure
>2cdu_A NADPH oxidase; flavoenzyme, oxidoreductase; HET: FAD ADP; 1.8A {Lactobacillus sanfranciscensis} Back     alignment and structure
>3cp8_A TRNA uridine 5-carboxymethylaminomethyl modification enzyme GIDA; rossmann fold, FAD-binding domain, dinucleotide-binding motif; HET: FAD; 3.20A {Chlorobium tepidum} Back     alignment and structure
>4b1b_A TRXR, thioredoxin reductase; oxidoreductase, FAD, NADPH, thiol-mediated redox metabolism, pyridine nucleotide-disulfide oxidoreductase; HET: FAD; 2.90A {Plasmodium falciparum} Back     alignment and structure
>2a8x_A Dihydrolipoyl dehydrogenase, E3 component of alpha; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha keto acid dehydrogenase; HET: FAD; 2.40A {Mycobacterium tuberculosis} PDB: 3ii4_A* Back     alignment and structure
>3dgz_A Thioredoxin reductase 2; oxidoreductase, rossmann, flavoprotein, FAD, mitochondrion, redox-active center, selenium, selenocysteine, transit PEPT; HET: FAD NA7; 2.25A {Mus musculus} PDB: 1zkq_A* 1zdl_A* Back     alignment and structure
>3dk9_A Grase, GR, glutathione reductase; flavoenzyme, nicotinamide, acetylation, alternative initiation, cytoplasm, FAD, flavoprotein, mitochondrion, NADP; HET: SO4 FAD; 0.95A {Homo sapiens} PDB: 1bwc_A* 1gra_A* 1gre_A* 1grf_A* 1grh_A* 1grb_A* 2gh5_A* 1gsn_A* 3dk4_A* 3dk8_A* 3djj_A* 3grs_A* 3sqp_A* 4gr1_A* 2aaq_A* 1dnc_A* 1grg_A* 1grt_A* 1xan_A* 5grt_A* ... Back     alignment and structure
>3ic9_A Dihydrolipoamide dehydrogenase; APC62701, colwellia psychrer 34H, structural genomics, PSI-2; HET: FAD; 2.15A {Colwellia psychrerythraea} Back     alignment and structure
>1hyu_A AHPF, alkyl hydroperoxide reductase subunit F; thiol-thiolate hydrogen bond, nucleotide binding fold, thior reductase, thioredoxin; HET: FAD; 2.00A {Salmonella typhimurium} SCOP: c.3.1.5 c.3.1.5 c.47.1.2 c.47.1.2 PDB: 1zyn_A 1zyp_A Back     alignment and structure
>1q1r_A Putidaredoxin reductase; glutathione reductase fold, oxidoreductase; HET: FAD; 1.91A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1q1w_A* 3lb8_A* Back     alignment and structure
>3dgh_A TRXR-1, thioredoxin reductase 1, mitochondrial; oxidoreductase, rossmann, flavoprotein, alternative initiati mitochondrion, NADP; HET: FAD; 1.75A {Drosophila melanogaster} PDB: 2nvk_X* 3dh9_A* Back     alignment and structure
>3klj_A NAD(FAD)-dependent dehydrogenase, NIRB-family (N- domain); FAD-binding protein, GR-fold, oxidoreductase; HET: FAD; 2.10A {Clostridium acetobutylicum} Back     alignment and structure
>3gcz_A Polyprotein; flavivirus, RNA capping, methyltransferase, viral enzyme STR ATP-binding, nucleotide-binding, RNA replication, structura genomics; HET: SAM; 1.70A {Yokose virus} Back     alignment and structure
>3fpz_A Thiazole biosynthetic enzyme; FAD, mitochondrion, N thiamine biosynthesis, transit peptide, biosynthetic protei; HET: AHZ; 1.82A {Saccharomyces cerevisiae} Back     alignment and structure
>2a87_A TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TLS, oxidoreduct structural genomics, PSI, protein structure initiative; HET: FAD NAP; 3.00A {Mycobacterium tuberculosis} Back     alignment and structure
>3l8k_A Dihydrolipoyl dehydrogenase; redox-active center, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.50A {Sulfolobus solfataricus} Back     alignment and structure
>4fzv_A Putative methyltransferase NSUN4; mterf fold, methyltransferase fold, rRNA methyltransferase, mitochondria, transferase; HET: MSE SAM; 2.00A {Homo sapiens} PDB: 4fp9_A* Back     alignment and structure
>1ojt_A Surface protein; redox-active center, glycolysis, oxidoreductase, NAD, flavop FAD, P64K; HET: FAD; 2.75A {Neisseria meningitidis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1bhy_A* Back     alignment and structure
>1jnr_A Adenylylsulfate reductase; oxidoreductase; HET: FAD; 1.60A {Archaeoglobus fulgidus dsm 4304} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1jnz_A* 2fjb_A* 2fja_A* 2fjd_A* 2fje_A* Back     alignment and structure
>1wg8_A Predicted S-adenosylmethionine-dependent methyltransferase; S-adenosyl-methyltransferase, MRAW; HET: SAM; 2.00A {Thermus thermophilus} SCOP: a.60.13.1 c.66.1.23 Back     alignment and structure
>2wk1_A NOVP; transferase, O-methyltransferase, novobiocin, TYLF superfamily; HET: SAH; 1.40A {Streptomyces caeruleus} Back     alignment and structure
>3s1s_A Restriction endonuclease bpusi; PD--(D/E)XK catalytic motif, gamma-N6M-adenosine methyltrans S-adenosyl-methionine binding, hydrolase; HET: SAH; 2.35A {Bacillus pumilus} Back     alignment and structure
>1ebd_A E3BD, dihydrolipoamide dehydrogenase; redox-active center, glycolysis, oxidoreductase; HET: FAD; 2.60A {Geobacillus stearothermophilus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>3kd9_A Coenzyme A disulfide reductase; PSI-II, NYSGXRC, oxidoreductase, structural genomics structure initiative; 2.75A {Pyrococcus horikoshii} Back     alignment and structure
>1pn0_A Phenol 2-monooxygenase; two dimers, TLS refinement, oxidoreductase; HET: FAD; 1.70A {Trichosporon cutaneum} SCOP: c.3.1.2 c.47.1.10 d.16.1.2 PDB: 1foh_A* Back     alignment and structure
>3vrd_B FCCB subunit, flavocytochrome C flavin subunit; sulfide oxidation, heme C binding, FAD binding, electron TRA oxidoreductase complex; HET: HEC FAD; 1.50A {Thermochromatium tepidum} PDB: 1fcd_A* Back     alignment and structure
>1nhp_A NADH peroxidase; oxidoreductase (H2O2(A)); HET: FAD; 2.00A {Enterococcus faecalis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1npx_A* 1joa_A* 2npx_A* 1nhq_A* 1nhs_A* 1nhr_A* 1f8w_A* Back     alignment and structure
>3gyx_A Adenylylsulfate reductase; oxidoreductase; HET: FAD; 3.20A {Desulfovibrio gigas} Back     alignment and structure
>3cgb_A Pyridine nucleotide-disulfide oxidoreductase, CLA; coenzyme A, flavin adenine dinucleotide, selenomethionine, F flavoprotein; HET: COA FAD; 1.90A {Bacillus anthracis str} PDB: 3cgc_A* 3cgd_A* 3cge_A* Back     alignment and structure
>3lkz_A Non-structural protein 5; flavivirus, methyltransferase, inhibitor, P nucleotide-binding, RNA replication, viral protein; HET: SFG; 2.00A {West nile virus} Back     alignment and structure
>3qfa_A Thioredoxin reductase 1, cytoplasmic; protein-protein complex, rossmann fold, HO pyridine nucleotide disulfide oxidoreductase, electron TRAN oxidoreductase; HET: FAD; 2.20A {Homo sapiens} PDB: 3qfb_A* 2j3n_A* 2zzc_A* 2zzb_A* 2zz0_A* 2cfy_A* 1h6v_A* 3ean_A* 3eao_A* Back     alignment and structure
>3sx6_A Sulfide-quinone reductase, putative; sulfide:quinone oxidoreductase, Cys356Ala variant, integral membrane protein; HET: FAD LMT DCQ; 1.80A {Acidithiobacillus ferrooxidans} PDB: 3t0k_A* 3szc_A* 3sz0_A* 3t2z_A* 3t31_A* 3sy4_A* 3syi_A* 3sxi_A* 3t14_A* 3t2k_A* 3szw_A* 3szf_A* 3kpg_A* 3kpi_A* 3t2y_A* 3kpk_A* Back     alignment and structure
>2k4m_A TR8_protein, UPF0146 protein MTH_1000; alpha+beta, rossman fold, structural genomics, PSI-2; NMR {Methanothermobacterthermautotrophicus str} Back     alignment and structure
>4gcm_A TRXR, thioredoxin reductase; FAD/NAD-linked reductases, PYR redox 2 family, structural GE joint center for structural genomics, JCSG; HET: MSE FAD NAP EPE; 1.80A {Staphylococcus aureus subsp} Back     alignment and structure
>3g3e_A D-amino-acid oxidase; FAD, flavoprotein, oxidoreductase, PER; HET: FAD G3E; 2.20A {Homo sapiens} PDB: 3cuk_A* 2e48_A* 2e49_A* 2e4a_A* 2e82_A* 2du8_A* 1ve9_A* 1dao_A* 1ddo_A* 1kif_A* 1an9_A* 1evi_A* Back     alignment and structure
>3c6k_A Spermine synthase; spermidine aminopropyltransferase, SPMSY, structural genomics, structural genomics consortium, SGC, phosphoprotein; HET: SPD MTA; 1.95A {Homo sapiens} PDB: 3c6m_A* Back     alignment and structure
>1xhc_A NADH oxidase /nitrite reductase; southe collaboratory for structural genomics, secsg, hyperthermoph protein structure initiative, PSI; HET: FAD; 2.35A {Pyrococcus furiosus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>2bc0_A NADH oxidase; flavoprotein, pyridine nucleotide disulfide oxidoreductase, C(4A)-peroxyflavin, crystallography, conformational dynamics; HET: FAD; 2.00A {Streptococcus pyogenes} PDB: 2bcp_A* 2bc1_A* Back     alignment and structure
>3p8z_A Mtase, non-structural protein 5; methyltransferase, RNA, ER, transferase-transferase inhibito; HET: 36A SAH; 1.70A {Dengue virus 3} SCOP: c.66.1.25 PDB: 3p97_A* 2xbm_A* 3evg_A* Back     alignment and structure
>4auk_A Ribosomal RNA large subunit methyltransferase M; YGDE; HET: TLA PGE; 1.90A {Escherichia coli} PDB: 4atn_A* 4b17_A* Back     alignment and structure
>2eq6_A Pyruvate dehydrogenase complex, dihydrolipoamide dehydrogenase E3 component; oxidoreductase, homodimer, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2eq8_A* 2eq9_A* Back     alignment and structure
>3hyw_A Sulfide-quinone reductase; monotopic membrane protein, flavoprotein, polysulfur, oxidoreductase; HET: FAD DCQ LMT; 2.00A {Aquifex aeolicus} PDB: 3hyv_A* 3hyx_A* Back     alignment and structure
>1c0p_A D-amino acid oxidase; alpha-beta-alpha motif, flavin containing protein, oxidoreductase; HET: FAD; 1.20A {Rhodosporidium toruloides} SCOP: c.4.1.2 d.16.1.3 PDB: 1c0i_A* 1c0l_A* 1c0k_A* Back     alignment and structure
>4b63_A L-ornithine N5 monooxygenase; oxidoreductase, siderophore, flavin; HET: FAD NAP; 1.90A {Aspergillus fumigatus} PDB: 4b64_A* 4b65_A* 4b66_A* 4b67_A* 4b68_A* 4b69_A* Back     alignment and structure
>3ufb_A Type I restriction-modification system methyltran subunit; methyltransferase activity, transferase; 1.80A {Vibrio vulnificus} Back     alignment and structure
>2vdc_G Glutamate synthase [NADPH] small chain; oxidoreductase, amidotransferase, ammonia assimilation, iron, zymogen; HET: OMT FMN AKG FAD; 9.50A {Azospirillum brasilense} Back     alignment and structure
>3eld_A Methyltransferase; flavivirus, RNA capping, guanylyltransfer viral enzyme structure; HET: SFG; 1.90A {Wesselsbron virus} PDB: 3elu_A* 3elw_A* 3ely_A* 3emb_A* 3emd_A* Back     alignment and structure
>4eqs_A Coenzyme A disulfide reductase; oxidoreductase; HET: COA FAD; 1.50A {Staphylococcus aureus subsp} PDB: 1yqz_A* 4eqw_A* 4em4_A* 4em3_A* 4eqr_A* 4emw_A* 4eqx_A* Back     alignment and structure
>4a5l_A Thioredoxin reductase; oxidoreductase, redox metabolism, oxidative stress; HET: NDP FAD; 1.66A {Entamoeba histolytica} PDB: 4a65_A* Back     alignment and structure
>2px2_A Genome polyprotein [contains: capsid protein C (core protein); envelope protein M...; methyltransferase, SAH; HET: SAH; 2.00A {Murray valley encephalitis virus} PDB: 2px4_A* 2px5_A* 2pxa_A* 2pxc_A* 2px8_A* 2oy0_A* Back     alignment and structure
>3c4a_A Probable tryptophan hydroxylase VIOD; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.30A {Chromobacterium violaceum atcc 12472} Back     alignment and structure
>4g6h_A Rotenone-insensitive NADH-ubiquinone oxidoreducta mitochondrial; rossmann fold, electron transfer, FAD, oxidoreductase; HET: FAD NAD; 2.26A {Saccharomyces cerevisiae} PDB: 4g6g_A* 4g73_A* 4g74_A* 4g9k_A* 4gap_A* 4gav_A* Back     alignment and structure
>1nhp_A NADH peroxidase; oxidoreductase (H2O2(A)); HET: FAD; 2.00A {Enterococcus faecalis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1npx_A* 1joa_A* 2npx_A* 1nhq_A* 1nhs_A* 1nhr_A* 1f8w_A* Back     alignment and structure
>3qvp_A Glucose oxidase; oxidoreductase; HET: NAG BMA MAN FAD; 1.20A {Aspergillus niger} PDB: 1gal_A* 1cf3_A* 3qvr_A* Back     alignment and structure
>1v59_A Dihydrolipoamide dehydrogenase; 2-oxoacid dehydroganese complex, pyruvate dehydrogenase complex; HET: FAD NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1jeh_A* Back     alignment and structure
>1ebd_A E3BD, dihydrolipoamide dehydrogenase; redox-active center, glycolysis, oxidoreductase; HET: FAD; 2.60A {Geobacillus stearothermophilus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>2gqw_A Ferredoxin reductase; flavoprotein, oxidoreductase; HET: FAD; 1.40A {Pseudomonas SP} PDB: 1f3p_A* 1d7y_A* 2gr0_A* 2gr1_A* 2gr2_A* 2yvf_A* 2yvg_A* 2yvj_A* 2gr3_A* Back     alignment and structure
>3ihm_A Styrene monooxygenase A; rossman fold, anti-parallel beta strands, dimer, cavity, oxidoreductase; 2.30A {Pseudomonas putida} Back     alignment and structure
>1o94_A Tmadh, trimethylamine dehydrogenase; electron transport, protein complex; HET: FMN ADP AMP; 2.0A {Methylophilus methylotrophus} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 PDB: 1djn_A* 1o95_A* 2tmd_A* 1djq_A* Back     alignment and structure
>2zig_A TTHA0409, putative modification methylase; methyltransferase, S- adenosylmethionine, structural genomics, NPPSFA; 2.10A {Thermus thermophilus} PDB: 2zie_A* 2zif_A Back     alignment and structure
>1ojt_A Surface protein; redox-active center, glycolysis, oxidoreductase, NAD, flavop FAD, P64K; HET: FAD; 2.75A {Neisseria meningitidis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1bhy_A* Back     alignment and structure
>3g5s_A Methylenetetrahydrofolate--tRNA-(uracil-5-)- methyltransferase TRMFO; tRNA methyltransferase FAD folate, FAD, flavoprotein; HET: MSE FAD GSH; 1.05A {Thermus thermophilus} PDB: 3g5q_A* 3g5r_A* Back     alignment and structure
>1lvl_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD NAD; 2.45A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>1v59_A Dihydrolipoamide dehydrogenase; 2-oxoacid dehydroganese complex, pyruvate dehydrogenase complex; HET: FAD NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1jeh_A* Back     alignment and structure
>2bc0_A NADH oxidase; flavoprotein, pyridine nucleotide disulfide oxidoreductase, C(4A)-peroxyflavin, crystallography, conformational dynamics; HET: FAD; 2.00A {Streptococcus pyogenes} PDB: 2bcp_A* 2bc1_A* Back     alignment and structure
>1lvl_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD NAD; 2.45A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>3fim_B ARYL-alcohol oxidase; AAO, lignin degradation, oxidoreductase, flavoprotein; HET: FAD; 2.55A {Pleurotus eryngii} Back     alignment and structure
>1ps9_A 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel, flavodoxin, flavin, electron transfer, hydride transfer, oxidoreductase; HET: FAD FMN NAP MDE; 2.20A {Escherichia coli} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 850
d1kpga_285 c.66.1.18 (A:) CmaA1 {Mycobacterium tuberculosis [ 5e-62
d1kpia_291 c.66.1.18 (A:) CmaA2 {Mycobacterium tuberculosis [ 1e-60
d2fk8a1280 c.66.1.18 (A:22-301) Methoxy mycolic acid synthase 7e-59
d2v5za1383 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {H 3e-32
d2ivda1347 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen ox 7e-30
d2dw4a2449 c.3.1.2 (A:274-654,A:764-831) Lysine-specific hist 1e-26
d1seza1373 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen ox 7e-24
d1nkva_245 c.66.1.21 (A:) Hypothetical Protein YjhP {Escheric 9e-24
d2iida1370 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {M 3e-22
d1b5qa1347 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Mai 1e-21
d1nw3a_328 c.66.1.31 (A:) Catalytic, N-terminal domain of his 3e-20
d2bcgg1297 c.3.1.3 (G:5-301) Guanine nucleotide dissociation 7e-18
d2o57a1282 c.66.1.18 (A:16-297) Putative sarcosine dimethylgl 2e-17
d1i8ta1298 c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mu 9e-15
d1vl5a_231 c.66.1.41 (A:) Hypothetical protein BH2331 {Bacill 6e-14
d1d5ta1336 c.3.1.3 (A:-2-291,A:389-431) Guanine nucleotide di 1e-13
d2bi7a1314 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mu 1e-13
d1pjza_201 c.66.1.36 (A:) Thiopurine S-methyltransferase {Pse 6e-11
d1xxla_234 c.66.1.41 (A:) Hypothetical protein YcgJ {Bacillus 2e-10
d1l3ia_186 c.66.1.22 (A:) Precorrin-6Y methyltransferase (Cbi 2e-10
d2frna1260 c.66.1.47 (A:19-278) Hypothetical protein PH0793 { 2e-10
d2a14a1257 c.66.1.15 (A:5-261) Indolethylamine N-methyltransf 4e-10
d1ri5a_252 c.66.1.34 (A:) mRNA cap (Guanine N-7) methyltransf 9e-10
d1rp0a1278 c.3.1.6 (A:7-284) Thiazole biosynthetic enzyme Thi 2e-09
d1w4xa1298 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxy 1e-08
d2i0za1251 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {B 3e-08
d3c96a1288 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Ps 3e-08
d2gv8a1335 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monox 4e-08
d2fyta1311 c.66.1.6 (A:238-548) Protein arginine N-methyltran 6e-08
d1zx0a1229 c.66.1.16 (A:8-236) Guanidinoacetate methyltransfe 7e-08
d1kifa1246 c.4.1.2 (A:1-194,A:288-339) D-aminoacid oxidase, N 7e-08
d1cjca2230 c.4.1.1 (A:6-106,A:332-460) Adrenodoxin reductase 7e-08
d2i6ga1198 c.66.1.44 (A:1-198) Putative methyltransferase Teh 9e-08
d1k0ia1292 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydr 1e-07
d1dxla1221 c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehyd 1e-07
d2voua1265 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydr 1e-07
d1u2za_406 c.66.1.31 (A:) Catalytic, N-terminal domain of his 2e-07
d1c0pa1268 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxida 2e-07
d1oria_316 c.66.1.6 (A:) Protein arginine N-methyltransferase 2e-07
d1lqta2239 c.4.1.1 (A:2-108,A:325-456) Ferredoxin:NADP reduct 3e-07
d1jqea_280 c.66.1.19 (A:) Histamine methyltransferase {Human 3e-07
d1v59a1233 c.3.1.5 (A:1-160,A:283-355) Dihydrolipoamide dehyd 4e-07
d1g6q1_328 c.66.1.6 (1:) Arginine methyltransferase, HMT1 {Ba 4e-07
d1ojta1229 c.3.1.5 (A:117-275,A:401-470) Dihydrolipoamide deh 4e-07
d1d4ca2322 c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 ( 5e-07
d1y0pa2308 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 ( 6e-07
d1vdca1192 c.3.1.5 (A:1-117,A:244-316) Thioredoxin reductase 7e-07
d2gf3a1281 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bac 8e-07
d2gqfa1253 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein H 8e-07
d2gh1a1281 c.66.1.49 (A:13-293) Methyltransferase BC2162 {Bac 9e-07
d1ryia1276 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO { 1e-06
d1qo8a2317 c.3.1.4 (A:103-359,A:506-565) Flavocytochrome c3 ( 1e-06
d1dusa_194 c.66.1.4 (A:) Hypothetical protein MJ0882 {Archaeo 1e-06
d1y8ca_246 c.66.1.43 (A:) Putative methyltransferase CAC2371 2e-06
d1gtea4196 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine de 3e-06
d1trba1190 c.3.1.5 (A:1-118,A:245-316) Thioredoxin reductase 4e-06
d2gjca1311 c.3.1.6 (A:16-326) Thiazole biosynthetic enzyme Th 4e-06
d1pn0a1360 c.3.1.2 (A:1-240,A:342-461) Phenol hydroxylase {So 4e-06
d1xvaa_292 c.66.1.5 (A:) Glycine N-methyltransferase {Rat (Ra 5e-06
d1gesa1217 c.3.1.5 (A:3-146,A:263-335) Glutathione reductase 5e-06
d3lada1229 c.3.1.5 (A:1-158,A:278-348) Dihydrolipoamide dehyd 1e-05
d2gmha1380 c.3.1.2 (A:4-236,A:336-482) Electron transfer flav 1e-05
d1n4wa1367 c.3.1.2 (A:9-318,A:451-507) Cholesterol oxidase of 1e-05
d3coxa1370 c.3.1.2 (A:5-318,A:451-506) Cholesterol oxidase of 2e-05
d2bs2a2336 c.3.1.4 (A:1-250,A:372-457) Fumarate reductase {Wo 2e-05
d1jnra2356 c.3.1.4 (A:2-256,A:402-502) Adenylylsulfate reduct 3e-05
d1o54a_266 c.66.1.13 (A:) Hypothetical protein TM0748 {Thermo 5e-05
d1yb2a1250 c.66.1.13 (A:6-255) Hypothetical protein Ta0852 {T 5e-05
d1wy7a1201 c.66.1.32 (A:4-204) Hypothetical protein PH1948 {A 6e-05
d1pj5a2305 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine ox 6e-05
d1nhpa1198 c.3.1.5 (A:1-119,A:243-321) NADH peroxidase {Enter 7e-05
d1mo9a1261 c.3.1.5 (A:2-192,A:314-383) NADH-dependent 2-ketop 1e-04
d1lvla1220 c.3.1.5 (A:1-150,A:266-335) Dihydrolipoamide dehyd 1e-04
d1wzna1251 c.66.1.43 (A:1-251) Hypothetical methyltransferase 1e-04
d2p7ia1225 c.66.1.41 (A:22-246) Hypothetical protein ECA1738 1e-04
d1neka2330 c.3.1.4 (A:1-235,A:356-450) Succinate dehydogenase 2e-04
d2b25a1324 c.66.1.13 (A:6-329) Hypothetical protein FLJ20628 2e-04
d1ebda1223 c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehyd 3e-04
d3grsa1221 c.3.1.5 (A:18-165,A:291-363) Glutathione reductase 3e-04
d1onfa1259 c.3.1.5 (A:1-153,A:271-376) Glutathione reductase 5e-04
d1xdia1233 c.3.1.5 (A:2-161,A:276-348) Dihydrolipoamide dehyd 6e-04
d1bg6a2184 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvalin 7e-04
d1txga2180 c.2.1.6 (A:1-180) Glycerol-3- phosphate dehydrogen 9e-04
d1h6va1235 c.3.1.5 (A:10-170,A:293-366) Mammalian thioredoxin 9e-04
d1ks9a2167 c.2.1.6 (A:1-167) Ketopantoate reductase PanE {Esc 9e-04
d1f0ya2192 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA 0.001
d1chua2305 c.3.1.4 (A:2-237,A:354-422) L-aspartate oxidase {E 0.001
d1ps9a3179 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA redu 0.001
d1wdka3186 c.2.1.6 (A:311-496) Fatty oxidation complex alpha 0.001
d2ex4a1222 c.66.1.42 (A:2-224) Adrenal gland protein AD-003 ( 0.002
d1zq9a1278 c.66.1.24 (A:36-313) Probable dimethyladenosine tr 0.002
d1kf6a2311 c.3.1.4 (A:0-225,A:358-442) Fumarate reductase {Es 0.002
d1g8sa_230 c.66.1.3 (A:) Fibrillarin homologue {Archaeon Meth 0.002
d1fl2a1184 c.3.1.5 (A:212-325,A:452-521) Alkyl hydroperoxide 0.003
d1im8a_225 c.66.1.14 (A:) Hypothetical protein HI0319 (YecO) 0.003
d1q1ra1185 c.3.1.5 (A:2-114,A:248-319) Putidaredoxin reductas 0.003
d1yzha1204 c.66.1.53 (A:8-211) tRNA (guanine-N(7)-)-methyltra 0.003
d1d7ya1183 c.3.1.5 (A:5-115,A:237-308) NADH-dependent ferredo 0.004
>d1kpga_ c.66.1.18 (A:) CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]} Length = 285 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: S-adenosyl-L-methionine-dependent methyltransferases
superfamily: S-adenosyl-L-methionine-dependent methyltransferases
family: Mycolic acid cyclopropane synthase
domain: CmaA1
species: Mycobacterium tuberculosis [TaxId: 1773]

 Score =  209 bits (532), Expect = 5e-62
 Identities = 77/289 (26%), Positives = 129/289 (44%), Gaps = 13/289 (4%)

Query: 554 NTLAQARRNISHHYDVSNELFSLFLGKSMMYSCAIFKSEYEDLDVAQMRKVSLLIEKARV 613
           + L     N+  HYD+S++ F LFL  +  YSCA F+ +   L  AQ+ K+ L + K  +
Sbjct: 1   DELKPHFANVQAHYDLSDDFFRLFLDPTQTYSCAYFERDDMTLQEAQIAKIDLALGKLGL 60

Query: 614 NKGLDVLEIGCGWGTLAIEIVKQTGCKYTGITLSEEQLKYTETKVKEAGLQDHIRLYLCD 673
             G+ +L++GCGWG   +  V++      G+TLS+ Q  + +  V  +      R+ L  
Sbjct: 61  QPGMTLLDVGCGWGATMMRAVEKYDVNVVGLTLSKNQANHVQQLVANSENLRSKRVLLAG 120

Query: 674 YRQMPEVKKYDTIISCEMIENVGHEYIEEFFGCCESLLAEHGLLLLQFSSVPDQCYDGHR 733
           + Q    +  D I+S    E+ GHE  + FF     LL   G++LL   +         R
Sbjct: 121 WEQFD--EPVDRIVSIGAFEHFGHERYDAFFSLAHRLLPADGVMLLHTITGLHPKEIHER 178

Query: 734 LSP---------GFITEYVFPGGCLPSLNRITSAMTSSSRLCVEHLENIGIHFYQTLRCW 784
             P          FI   +FPGG LPS+  +    +++        +++  H+ +TL  W
Sbjct: 179 GLPMSFTFARFLKFIVTEIFPGGRLPSIPMVQECASANGFTVTRV-QSLQPHYAKTLDLW 237

Query: 785 RTNLMEKQSEILALGFNEKFIRTWEYYFDYCAAGFKSRTLGNYQIVFSR 833
              L   + + +AL   E + R +  Y   CA  F+   +   Q    +
Sbjct: 238 SAALQANKGQAIALQSEEVYER-YMKYLTGCAEMFRIGYIDVNQFTCQK 285
>d1kpia_ c.66.1.18 (A:) CmaA2 {Mycobacterium tuberculosis [TaxId: 1773]} Length = 291 Back     information, alignment and structure
>d2fk8a1 c.66.1.18 (A:22-301) Methoxy mycolic acid synthase 4, Mma4 {Mycobacterium tuberculosis [TaxId: 1773]} Length = 280 Back     information, alignment and structure
>d2v5za1 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} Length = 383 Back     information, alignment and structure
>d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} Length = 347 Back     information, alignment and structure
>d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} Length = 449 Back     information, alignment and structure
>d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Length = 373 Back     information, alignment and structure
>d1nkva_ c.66.1.21 (A:) Hypothetical Protein YjhP {Escherichia coli [TaxId: 562]} Length = 245 Back     information, alignment and structure
>d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Length = 370 Back     information, alignment and structure
>d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Length = 347 Back     information, alignment and structure
>d1nw3a_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Human (Homo sapiens) [TaxId: 9606]} Length = 328 Back     information, alignment and structure
>d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 297 Back     information, alignment and structure
>d2o57a1 c.66.1.18 (A:16-297) Putative sarcosine dimethylglycine methyltransferase {Red algae (Galdieria sulphuraria) [TaxId: 130081]} Length = 282 Back     information, alignment and structure
>d1i8ta1 c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mutase, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 298 Back     information, alignment and structure
>d1vl5a_ c.66.1.41 (A:) Hypothetical protein BH2331 {Bacillus halodurans [TaxId: 86665]} Length = 231 Back     information, alignment and structure
>d1d5ta1 c.3.1.3 (A:-2-291,A:389-431) Guanine nucleotide dissociation inhibitor, GDI {Cow (Bos taurus) [TaxId: 9913]} Length = 336 Back     information, alignment and structure
>d2bi7a1 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mutase, N-terminal domain {Klebsiella pneumoniae [TaxId: 573]} Length = 314 Back     information, alignment and structure
>d1pjza_ c.66.1.36 (A:) Thiopurine S-methyltransferase {Pseudomonas syringae [TaxId: 317]} Length = 201 Back     information, alignment and structure
>d1xxla_ c.66.1.41 (A:) Hypothetical protein YcgJ {Bacillus subtilis [TaxId: 1423]} Length = 234 Back     information, alignment and structure
>d1l3ia_ c.66.1.22 (A:) Precorrin-6Y methyltransferase (CbiT) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Length = 186 Back     information, alignment and structure
>d2frna1 c.66.1.47 (A:19-278) Hypothetical protein PH0793 {Pyrococcus horikoshii [TaxId: 53953]} Length = 260 Back     information, alignment and structure
>d2a14a1 c.66.1.15 (A:5-261) Indolethylamine N-methyltransferase, INMT {Human (Homo sapiens) [TaxId: 9606]} Length = 257 Back     information, alignment and structure
>d1ri5a_ c.66.1.34 (A:) mRNA cap (Guanine N-7) methyltransferase {Fungus (Encephalitozoon cuniculi) [TaxId: 6035]} Length = 252 Back     information, alignment and structure
>d1rp0a1 c.3.1.6 (A:7-284) Thiazole biosynthetic enzyme Thi4 {Thale cress(Arabidopsis thaliana) [TaxId: 3702]} Length = 278 Back     information, alignment and structure
>d1w4xa1 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Length = 298 Back     information, alignment and structure
>d2i0za1 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]} Length = 251 Back     information, alignment and structure
>d3c96a1 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 287]} Length = 288 Back     information, alignment and structure
>d2gv8a1 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Length = 335 Back     information, alignment and structure
>d2fyta1 c.66.1.6 (A:238-548) Protein arginine N-methyltransferase 3, PRMT3 {Human (Homo sapiens) [TaxId: 9606]} Length = 311 Back     information, alignment and structure
>d1zx0a1 c.66.1.16 (A:8-236) Guanidinoacetate methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Length = 229 Back     information, alignment and structure
>d1kifa1 c.4.1.2 (A:1-194,A:288-339) D-aminoacid oxidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Length = 246 Back     information, alignment and structure
>d1cjca2 c.4.1.1 (A:6-106,A:332-460) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Length = 230 Back     information, alignment and structure
>d2i6ga1 c.66.1.44 (A:1-198) Putative methyltransferase TehB {Salmonella typhimurium [TaxId: 90371]} Length = 198 Back     information, alignment and structure
>d1k0ia1 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas aeruginosa [TaxId: 287]} Length = 292 Back     information, alignment and structure
>d1dxla1 c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Length = 221 Back     information, alignment and structure
>d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} Length = 265 Back     information, alignment and structure
>d1u2za_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 406 Back     information, alignment and structure
>d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]} Length = 268 Back     information, alignment and structure
>d1oria_ c.66.1.6 (A:) Protein arginine N-methyltransferase 1, PRMT1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 316 Back     information, alignment and structure
>d1lqta2 c.4.1.1 (A:2-108,A:325-456) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} Length = 239 Back     information, alignment and structure
>d1jqea_ c.66.1.19 (A:) Histamine methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Length = 280 Back     information, alignment and structure
>d1v59a1 c.3.1.5 (A:1-160,A:283-355) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 233 Back     information, alignment and structure
>d1g6q1_ c.66.1.6 (1:) Arginine methyltransferase, HMT1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 328 Back     information, alignment and structure
>d1ojta1 c.3.1.5 (A:117-275,A:401-470) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Length = 229 Back     information, alignment and structure
>d1d4ca2 c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella putrefaciens [TaxId: 24]} Length = 322 Back     information, alignment and structure
>d1y0pa2 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Length = 308 Back     information, alignment and structure
>d1vdca1 c.3.1.5 (A:1-117,A:244-316) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 192 Back     information, alignment and structure
>d2gf3a1 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]} Length = 281 Back     information, alignment and structure
>d2gqfa1 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein HI0933 {Haemophilus influenzae [TaxId: 727]} Length = 253 Back     information, alignment and structure
>d2gh1a1 c.66.1.49 (A:13-293) Methyltransferase BC2162 {Bacillus cereus [TaxId: 1396]} Length = 281 Back     information, alignment and structure
>d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} Length = 276 Back     information, alignment and structure
>d1qo8a2 c.3.1.4 (A:103-359,A:506-565) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Length = 317 Back     information, alignment and structure
>d1dusa_ c.66.1.4 (A:) Hypothetical protein MJ0882 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 194 Back     information, alignment and structure
>d1y8ca_ c.66.1.43 (A:) Putative methyltransferase CAC2371 {Clostridium acetobutylicum [TaxId: 1488]} Length = 246 Back     information, alignment and structure
>d1gtea4 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]} Length = 196 Back     information, alignment and structure
>d1trba1 c.3.1.5 (A:1-118,A:245-316) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Length = 190 Back     information, alignment and structure
>d2gjca1 c.3.1.6 (A:16-326) Thiazole biosynthetic enzyme Thi4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 311 Back     information, alignment and structure
>d1pn0a1 c.3.1.2 (A:1-240,A:342-461) Phenol hydroxylase {Soil-living yeast (Trichosporon cutaneum) [TaxId: 5554]} Length = 360 Back     information, alignment and structure
>d1xvaa_ c.66.1.5 (A:) Glycine N-methyltransferase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 292 Back     information, alignment and structure
>d1gesa1 c.3.1.5 (A:3-146,A:263-335) Glutathione reductase {Escherichia coli [TaxId: 562]} Length = 217 Back     information, alignment and structure
>d3lada1 c.3.1.5 (A:1-158,A:278-348) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Length = 229 Back     information, alignment and structure
>d2gmha1 c.3.1.2 (A:4-236,A:336-482) Electron transfer flavoprotein-ubiquinone oxidoreductase, EFT-QO {Pig (Sus scrofa) [TaxId: 9823]} Length = 380 Back     information, alignment and structure
>d1n4wa1 c.3.1.2 (A:9-318,A:451-507) Cholesterol oxidase of GMC family {Streptomyces sp. [TaxId: 1931]} Length = 367 Back     information, alignment and structure
>d3coxa1 c.3.1.2 (A:5-318,A:451-506) Cholesterol oxidase of GMC family {Brevibacterium sterolicum [TaxId: 1702]} Length = 370 Back     information, alignment and structure
>d2bs2a2 c.3.1.4 (A:1-250,A:372-457) Fumarate reductase {Wolinella succinogenes [TaxId: 844]} Length = 336 Back     information, alignment and structure
>d1jnra2 c.3.1.4 (A:2-256,A:402-502) Adenylylsulfate reductase A subunit {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 356 Back     information, alignment and structure
>d1o54a_ c.66.1.13 (A:) Hypothetical protein TM0748 {Thermotoga maritima [TaxId: 2336]} Length = 266 Back     information, alignment and structure
>d1yb2a1 c.66.1.13 (A:6-255) Hypothetical protein Ta0852 {Thermoplasma acidophilum [TaxId: 2303]} Length = 250 Back     information, alignment and structure
>d1wy7a1 c.66.1.32 (A:4-204) Hypothetical protein PH1948 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Length = 201 Back     information, alignment and structure
>d1pj5a2 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine oxidase {Arthrobacter globiformis [TaxId: 1665]} Length = 305 Back     information, alignment and structure
>d1nhpa1 c.3.1.5 (A:1-119,A:243-321) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Length = 198 Back     information, alignment and structure
>d1mo9a1 c.3.1.5 (A:2-192,A:314-383) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Length = 261 Back     information, alignment and structure
>d1lvla1 c.3.1.5 (A:1-150,A:266-335) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Length = 220 Back     information, alignment and structure
>d1wzna1 c.66.1.43 (A:1-251) Hypothetical methyltransferase PH1305 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Length = 251 Back     information, alignment and structure
>d2p7ia1 c.66.1.41 (A:22-246) Hypothetical protein ECA1738 {Erwinia carotovora [TaxId: 554]} Length = 225 Back     information, alignment and structure
>d1neka2 c.3.1.4 (A:1-235,A:356-450) Succinate dehydogenase {Escherichia coli [TaxId: 562]} Length = 330 Back     information, alignment and structure
>d2b25a1 c.66.1.13 (A:6-329) Hypothetical protein FLJ20628 {Human (Homo sapiens) [TaxId: 9606]} Length = 324 Back     information, alignment and structure
>d1ebda1 c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Length = 223 Back     information, alignment and structure
>d3grsa1 c.3.1.5 (A:18-165,A:291-363) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1onfa1 c.3.1.5 (A:1-153,A:271-376) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Length = 259 Back     information, alignment and structure
>d1xdia1 c.3.1.5 (A:2-161,A:276-348) Dihydrolipoamide dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Length = 233 Back     information, alignment and structure
>d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} Length = 184 Back     information, alignment and structure
>d1txga2 c.2.1.6 (A:1-180) Glycerol-3- phosphate dehydrogenase {Archaeoglobus fulgidus [TaxId: 2234]} Length = 180 Back     information, alignment and structure
>d1h6va1 c.3.1.5 (A:10-170,A:293-366) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 235 Back     information, alignment and structure
>d1ks9a2 c.2.1.6 (A:1-167) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]} Length = 167 Back     information, alignment and structure
>d1f0ya2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Length = 192 Back     information, alignment and structure
>d1chua2 c.3.1.4 (A:2-237,A:354-422) L-aspartate oxidase {Escherichia coli [TaxId: 562]} Length = 305 Back     information, alignment and structure
>d1ps9a3 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA reductase, middle domain {Escherichia coli [TaxId: 562]} Length = 179 Back     information, alignment and structure
>d1wdka3 c.2.1.6 (A:311-496) Fatty oxidation complex alpha subunit, middle domain {Pseudomonas fragi [TaxId: 296]} Length = 186 Back     information, alignment and structure
>d2ex4a1 c.66.1.42 (A:2-224) Adrenal gland protein AD-003 (C9orf32) {Human (Homo sapiens) [TaxId: 9606]} Length = 222 Back     information, alignment and structure
>d1zq9a1 c.66.1.24 (A:36-313) Probable dimethyladenosine transferase {Human (Homo sapiens) [TaxId: 9606]} Length = 278 Back     information, alignment and structure
>d1kf6a2 c.3.1.4 (A:0-225,A:358-442) Fumarate reductase {Escherichia coli [TaxId: 562]} Length = 311 Back     information, alignment and structure
>d1g8sa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 230 Back     information, alignment and structure
>d1fl2a1 c.3.1.5 (A:212-325,A:452-521) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Length = 184 Back     information, alignment and structure
>d1im8a_ c.66.1.14 (A:) Hypothetical protein HI0319 (YecO) {Haemophilus influenzae [TaxId: 727]} Length = 225 Back     information, alignment and structure
>d1q1ra1 c.3.1.5 (A:2-114,A:248-319) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Length = 185 Back     information, alignment and structure
>d1yzha1 c.66.1.53 (A:8-211) tRNA (guanine-N(7)-)-methyltransferase TrmB {Streptococcus pneumoniae [TaxId: 1313]} Length = 204 Back     information, alignment and structure
>d1d7ya1 c.3.1.5 (A:5-115,A:237-308) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Length = 183 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query850
d1kpga_285 CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]} 100.0
d1kpia_291 CmaA2 {Mycobacterium tuberculosis [TaxId: 1773]} 100.0
d2fk8a1280 Methoxy mycolic acid synthase 4, Mma4 {Mycobacteri 100.0
d2o57a1282 Putative sarcosine dimethylglycine methyltransfera 99.97
d2ivda1347 Protoporphyrinogen oxidase {Myxococcus xanthus [Ta 99.94
d2v5za1383 Monoamine oxidase B {Human (Homo sapiens) [TaxId: 99.91
d1nkva_245 Hypothetical Protein YjhP {Escherichia coli [TaxId 99.9
d2iida1370 L-aminoacid oxidase {Malayan pit viper (Calloselas 99.9
d1vl5a_231 Hypothetical protein BH2331 {Bacillus halodurans [ 99.9
d1xxla_234 Hypothetical protein YcgJ {Bacillus subtilis [TaxI 99.89
d1seza1373 Protoporphyrinogen oxidase {Tobacco (Nicotiana tab 99.88
d2bcgg1297 Guanine nucleotide dissociation inhibitor, GDI {Ba 99.87
d1nw3a_328 Catalytic, N-terminal domain of histone methyltran 99.85
d2ex4a1222 Adrenal gland protein AD-003 (C9orf32) {Human (Hom 99.82
d1ve3a1226 Hypothetical protein PH0226 {Archaeon Pyrococcus h 99.82
d1xtpa_254 Hypothetical protein Lmaj004091aaa (LmjF30.0810) { 99.8
d1tw3a2253 Carminomycin 4-O-methyltransferase {Streptomyces p 99.8
d1d5ta1336 Guanine nucleotide dissociation inhibitor, GDI {Co 99.8
d1b5qa1347 Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} 99.8
d1wzna1251 Hypothetical methyltransferase PH1305 {Archaeon Py 99.8
d2i6ga1198 Putative methyltransferase TehB {Salmonella typhim 99.8
d1pjza_201 Thiopurine S-methyltransferase {Pseudomonas syring 99.79
d1ri5a_252 mRNA cap (Guanine N-7) methyltransferase {Fungus ( 99.76
d1im8a_225 Hypothetical protein HI0319 (YecO) {Haemophilus in 99.76
d2p7ia1225 Hypothetical protein ECA1738 {Erwinia carotovora [ 99.76
d1y8ca_246 Putative methyltransferase CAC2371 {Clostridium ac 99.76
d2a14a1257 Indolethylamine N-methyltransferase, INMT {Human ( 99.75
d1vlma_208 Possible histamine N-methyltransferase TM1293 {The 99.75
d1qzza2256 Aclacinomycin-10-hydroxylase RdmB {Streptomyces pu 99.74
d1l3ia_186 Precorrin-6Y methyltransferase (CbiT) {Archaeon Me 99.74
d2bzga1229 Thiopurine S-methyltransferase {Human (Homo sapien 99.74
d2bi7a1314 UDP-galactopyranose mutase, N-terminal domain {Kle 99.74
d2nxca1254 PrmA-like protein TTHA0656 (TT0836) {Thermus therm 99.7
d2avna1246 Hypothetical methyltransferase TM1389 {Thermotoga 99.7
d1dusa_194 Hypothetical protein MJ0882 {Archaeon Methanococcu 99.69
d2gh1a1281 Methyltransferase BC2162 {Bacillus cereus [TaxId: 99.69
d1dl5a1213 Protein-L-isoaspartyl O-methyltransferase {Thermot 99.67
d1g8sa_230 Fibrillarin homologue {Archaeon Methanococcus jann 99.67
d1yb2a1250 Hypothetical protein Ta0852 {Thermoplasma acidophi 99.64
d1i9ga_264 Probable methyltransferase Rv2118c {Mycobacterium 99.61
d1nt2a_209 Fibrillarin homologue {Archaeon Archaeoglobus fulg 99.61
d1o54a_266 Hypothetical protein TM0748 {Thermotoga maritima [ 99.61
d1zx0a1229 Guanidinoacetate methyltransferase {Human (Homo sa 99.6
d2dw4a2449 Lysine-specific histone demethylase 1, LSD1 {Human 99.6
d1i8ta1298 UDP-galactopyranose mutase, N-terminal domain {Esc 99.6
d1p91a_268 rRNA methyltransferase RlmA {Escherichia coli [Tax 99.58
d1xvaa_292 Glycine N-methyltransferase {Rat (Rattus norvegicu 99.58
d2g72a1263 Phenylethanolamine N-methyltransferase, PNMTase {H 99.54
d1i1na_224 Protein-L-isoaspartyl O-methyltransferase {Human ( 99.54
d2fcaa1204 tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacil 99.54
d2gf3a1281 Sarcosine oxidase {Bacillus sp., strain b0618 [Tax 99.53
d1jqea_280 Histamine methyltransferase {Human (Homo sapiens) 99.52
d1vbfa_224 Protein-L-isoaspartyl O-methyltransferase {Sulfolo 99.52
d2b25a1324 Hypothetical protein FLJ20628 {Human (Homo sapiens 99.49
d1yzha1204 tRNA (guanine-N(7)-)-methyltransferase TrmB {Strep 99.49
d1g8aa_227 Fibrillarin homologue {Archaeon Pyrococcus horikos 99.49
d1g6q1_328 Arginine methyltransferase, HMT1 {Baker's yeast (S 99.48
d1jg1a_215 Protein-L-isoaspartyl O-methyltransferase {Archaeo 99.47
d1oria_316 Protein arginine N-methyltransferase 1, PRMT1 {Rat 99.47
d1ryia1276 Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} 99.47
d2fyta1311 Protein arginine N-methyltransferase 3, PRMT3 {Hum 99.44
d2frna1260 Hypothetical protein PH0793 {Pyrococcus horikoshii 99.43
d1pj5a2305 N,N-dimethylglycine oxidase {Arthrobacter globifor 99.42
d1u2za_406 Catalytic, N-terminal domain of histone methyltran 99.41
d2i0za1251 Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396] 99.41
d2gqfa1253 Hypothetical protein HI0933 {Haemophilus influenza 99.36
d2b3ta1274 N5-glutamine methyltransferase, HemK {Escherichia 99.35
d1fp1d2244 Chalcone O-methyltransferase {Alfalfa (Medicago sa 99.35
d1r18a_223 Protein-L-isoaspartyl O-methyltransferase {Fruit f 99.34
d2as0a2324 Hypothetical protein PH1915, middle and C-terminal 99.27
d1wxxa2318 Hypothetical protein TTHA1280, middle and C-termin 99.22
d2esra1152 Putative methyltransferase SPy1538 {Streptococcus 99.22
d1fp2a2244 Isoflavone O-methyltransferase {Alfalfa (Medicago 99.2
d1m6ya2192 TM0872, methyltransferase domain {Thermotoga marit 99.2
d2gv8a1335 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 99.19
d1ws6a1171 Methyltransferase TTHA0928 {Thermus thermophilus [ 99.18
d1kyza2243 Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltra 99.16
d2voua1265 Dihydroxypyridine hydroxylase DhpH {Arthrobacter n 99.16
d2igta1309 Putative methyltransferase Atu0340 {Agrobacterium 99.15
d1w4xa1298 Phenylacetone monooxygenase {Thermobifida fusca [T 99.15
d2b78a2317 Hypothetical protein SMu776, middle and C-terminal 99.12
d1y0pa2308 Flavocytochrome c3 (respiratory fumarate reductase 99.11
d1wy7a1201 Hypothetical protein PH1948 {Archaeon Pyrococcus h 99.11
d2cl5a1214 Catechol O-methyltransferase, COMT {Rat (Rattus no 99.11
d1nv8a_271 N5-glutamine methyltransferase, HemK {Thermotoga m 99.09
d2avda1219 COMT domain-containing protein 1, COMTD1 {Human (H 99.07
d1d4ca2322 Flavocytochrome c3 (respiratory fumarate reductase 99.06
d2h00a1250 Methyltransferase 10 domain containing protein MET 99.04
d1gesa2116 Glutathione reductase {Escherichia coli [TaxId: 56 99.03
d1qo8a2317 Flavocytochrome c3 (respiratory fumarate reductase 99.01
d1ne2a_197 Hypothetical protein Ta1320 {Archaeon Thermoplasma 99.01
d1vg0a1491 Rab escort protein 1 {Rat (Rattus norvegicus) [Tax 98.96
d1susa1227 Caffeoyl-CoA O-methyltransferase {Alfalfa (Medicag 98.93
d2fhpa1182 Putative methylase EF2452 {Enterococcus faecalis [ 98.92
d1onfa2117 Glutathione reductase {Plasmodium falciparum [TaxI 98.89
d1q1ra2133 Putidaredoxin reductase {Pseudomonas putida [TaxId 98.88
d1ebda2117 Dihydrolipoamide dehydrogenase {Bacillus stearothe 98.86
d3lada2119 Dihydrolipoamide dehydrogenase {Azotobacter vinela 98.86
d2fpoa1183 Methylase YhhF {Escherichia coli [TaxId: 562]} 98.84
d1ps9a3179 2,4-dienoyl-CoA reductase, middle domain {Escheric 98.83
d1af7a2193 Chemotaxis receptor methyltransferase CheR, C-term 98.82
d3c96a1288 Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 98.81
d2bs2a2336 Fumarate reductase {Wolinella succinogenes [TaxId: 98.8
d1nhpa2123 NADH peroxidase {Enterococcus faecalis [TaxId: 135 98.8
d1d7ya2121 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 98.79
d1jsxa_207 Glucose-inhibited division protein B (GidB) {Esche 98.78
d1m6ia2137 Apoptosis-inducing factor (AIF) {Human (Homo sapie 98.75
d1qama_235 rRNA adenine dimethylase {Bacillus subtilis, Ermc' 98.75
d1v59a2122 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 98.71
d1feca2117 Trypanothione reductase {Crithidia fasciculata [Ta 98.71
d1aoga2117 Trypanothione reductase {Trypanosoma cruzi [TaxId: 98.7
d1n4wa1367 Cholesterol oxidase of GMC family {Streptomyces sp 98.68
d3coxa1370 Cholesterol oxidase of GMC family {Brevibacterium 98.65
d1yuba_245 rRNA adenine dimethylase {Streptococcus pneumoniae 98.64
d1k0ia1292 p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas a 98.63
d1dxla2123 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 98.62
d2f8la1328 Hypothetical protein Lmo1582 {Listeria monocytogen 98.61
d1lvla2115 Dihydrolipoamide dehydrogenase {Pseudomonas putida 98.61
d1ojta2125 Dihydrolipoamide dehydrogenase {Neisseria meningit 98.58
d1xhca2122 NADH oxidase /nitrite reductase {Pyrococcus furios 98.57
d1uira_312 Spermidine synthase {Thermus thermophilus [TaxId: 98.57
d3grsa2125 Glutathione reductase {Human (Homo sapiens) [TaxId 98.56
d1kf6a2311 Fumarate reductase {Escherichia coli [TaxId: 562]} 98.56
d1gtea4196 Dihydropyrimidine dehydrogenase, domain 2 {Pig (Su 98.55
d1mjfa_276 Putative spermidine synthetase PF0127 (SpeE) {Arch 98.53
d1c0pa1268 D-aminoacid oxidase, N-terminal domain {Rhodotorul 98.52
d2ifta1183 Putative methylase HI0767 {Haemophilus influenzae 98.51
d1wg8a2182 TM0872, methyltransferase domain {Thermus thermoph 98.5
d2ih2a1223 DNA methylase TaqI, N-terminal domain {Thermus aqu 98.5
d1neka2330 Succinate dehydogenase {Escherichia coli [TaxId: 5 98.5
d1mo9a2121 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 98.48
d1rp0a1278 Thiazole biosynthetic enzyme Thi4 {Thale cress(Ara 98.47
d1lqta2239 Ferredoxin:NADP reductase FprA {Mycobacterium tube 98.47
d1zq9a1278 Probable dimethyladenosine transferase {Human (Hom 98.47
d2cula1230 GidA-related protein TTHA1897 {Thermus thermophilu 98.47
d1djqa3233 Trimethylamine dehydrogenase, middle domain {Methy 98.45
d1chua2305 L-aspartate oxidase {Escherichia coli [TaxId: 562] 98.44
d1inla_295 Spermidine synthase {Thermotoga maritima [TaxId: 2 98.42
d1uwva2358 rRNA (Uracil-5-)-methyltransferase RumA, catalytic 98.41
d1jnra2356 Adenylylsulfate reductase A subunit {Archaeon Arch 98.38
d1cjca2230 Adrenodoxin reductase of mitochondrial p450 system 98.38
d1v59a1233 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 98.36
d1dxla1221 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 98.36
d2gmha1380 Electron transfer flavoprotein-ubiquinone oxidored 98.35
d1h6va2122 Mammalian thioredoxin reductase {Rat (Rattus norve 98.35
d1xdza_239 Glucose-inhibited division protein B (GidB) {Bacil 98.34
d1ojta1229 Dihydrolipoamide dehydrogenase {Neisseria meningit 98.33
d1xj5a_290 Spermidine synthase {Thale cress (Arabidopsis thal 98.3
d1ixka_313 Hypothetical methyltransferase PH1374 {Archaeon Py 98.29
d2b2ca1312 Spermidine synthase {Caenorhabditis elegans [TaxId 98.27
d1ej0a_180 RNA methyltransferase FtsJ {Escherichia coli [TaxI 98.26
d2gjca1311 Thiazole biosynthetic enzyme Thi4 {Baker's yeast ( 98.24
d2okca1425 Type I restriction enzyme StySJI M protein {Bacter 98.24
d2o07a1285 Spermidine synthase {Human (Homo sapiens) [TaxId: 98.23
d1iy9a_274 Spermidine synthase {Bacillus subtilis [TaxId: 142 98.2
d1sqga2284 Ribosomal RNA small subunit methyltransferase B, R 98.17
d1gesa1217 Glutathione reductase {Escherichia coli [TaxId: 56 98.15
d1qyra_252 High level kasugamycin resistance protein KsgA {Es 98.15
d1nhpa1198 NADH peroxidase {Enterococcus faecalis [TaxId: 135 98.14
d1trba1190 Thioredoxin reductase {Escherichia coli [TaxId: 56 98.14
d3lada1229 Dihydrolipoamide dehydrogenase {Azotobacter vinela 98.12
d1ebda1223 Dihydrolipoamide dehydrogenase {Bacillus stearothe 98.09
d1fl2a1184 Alkyl hydroperoxide reductase subunit F (AhpF), C- 98.06
d1h6va1235 Mammalian thioredoxin reductase {Rat (Rattus norve 98.04
d1lvla1220 Dihydrolipoamide dehydrogenase {Pseudomonas putida 98.02
d1pn0a1360 Phenol hydroxylase {Soil-living yeast (Trichosporo 98.0
d3grsa1221 Glutathione reductase {Human (Homo sapiens) [TaxId 98.0
d1cf3a1385 Glucose oxidase {Aspergillus niger [TaxId: 5061]} 97.96
d1kifa1246 D-aminoacid oxidase, N-terminal domain {Pig (Sus s 97.95
d2b9ea1293 NOL1R {Human (Homo sapiens) [TaxId: 9606]} 97.95
d1onfa1259 Glutathione reductase {Plasmodium falciparum [TaxI 97.95
d1vdca1192 Thioredoxin reductase {Mouse-ear cress (Arabidopsi 97.92
d2ar0a1524 M.EcoKI {Escherichia coli [TaxId: 562]} 97.9
d2f5va1379 Pyranose 2-oxidase {White-rot fungus (Peniophora s 97.89
d2bm8a1232 Cephalosporin hydroxylase CmcI {Streptomyces clavu 97.89
d1mo9a1261 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 97.84
d2dula1375 N(2),N(2)-dimethylguanosine tRNA methyltransferase 97.84
d1xhca1167 NADH oxidase /nitrite reductase {Pyrococcus furios 97.82
d1piwa2168 Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas 97.82
d1m6ex_359 Salicylic acid carboxyl methyltransferase (SAMT) { 97.81
d1m6ia1213 Apoptosis-inducing factor (AIF) {Human (Homo sapie 97.77
d2p41a1257 An RNA cap (nucleoside-2'-O-)-methyltransferase do 97.6
d1vj0a2182 Hypothetical protein TM0436 {Thermotoga maritima [ 97.58
d2oyra1250 Hypothetical protein YhiQ {Shigella flexneri [TaxI 97.58
d1aoga1238 Trypanothione reductase {Trypanosoma cruzi [TaxId: 97.57
d1xdia1233 Dihydrolipoamide dehydrogenase {Mycobacterium tube 97.56
d1feca1240 Trypanothione reductase {Crithidia fasciculata [Ta 97.56
d1e3ja2170 Ketose reductase (sorbitol dehydrogenase) {Silverl 97.45
d1fcda1186 Flavocytochrome c sulfide dehydrogenase, FCSD, fla 97.4
d2jfga193 UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 97.4
d1yb5a2174 Quinone oxidoreductase {Human (Homo sapiens) [TaxI 97.32
d1kdga1360 Flavoprotein domain of flavocytochrome cellobiose 97.32
d1kola2195 Formaldehyde dehydrogenase {Pseudomonas putida [Ta 97.29
d1jqba2174 Bacterial secondary alcohol dehydrogenase {Clostri 97.23
d1pl8a2171 Ketose reductase (sorbitol dehydrogenase) {Human ( 97.11
d1gpea1391 Glucose oxidase {Penicillium amagasakiense [TaxId: 97.1
d1uufa2168 Hypothetical protein YahK {Escherichia coli [TaxId 97.07
d1llua2166 Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax 97.05
d1e3ia2174 Alcohol dehydrogenase {Mouse (Mus musculus), class 97.03
d1q1ra1185 Putidaredoxin reductase {Pseudomonas putida [TaxId 96.98
d1e5qa1182 Saccharopine reductase {Rice blast fungus (Magnapo 96.97
d1ju2a1351 Hydroxynitrile lyase {Almond (Prunus dulcis) [TaxI 96.89
d1f8fa2174 Benzyl alcohol dehydrogenase {Acinetobacter calcoa 96.83
d1bg6a2184 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A 96.81
d1o9ga_249 rRNA methyltransferase AviRa {Streptomyces viridoc 96.68
d1rjwa2168 Alcohol dehydrogenase {Bacillus stearothermophilus 96.65
d1jvba2170 Alcohol dehydrogenase {Archaeon Sulfolobus solfata 96.62
d1ks9a2167 Ketopantoate reductase PanE {Escherichia coli [Tax 96.6
d1i4wa_322 Transcription factor sc-mtTFB {Baker's yeast (Sacc 96.5
d1iz0a2171 Quinone oxidoreductase {Thermus thermophilus [TaxI 96.41
d1d7ya1183 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 96.39
d1qora2179 Quinone oxidoreductase {Escherichia coli [TaxId: 5 96.36
d1xa0a2176 B. subtilis YhfP homologue {Bacillus stearothermop 96.31
d1djqa2156 Trimethylamine dehydrogenase, C-terminal domain {M 96.2
d1v3va2182 Leukotriene b4 12-hydroxydehydrogenase/prostagland 96.2
d1mv8a2202 GDP-mannose 6-dehydrogenase {Pseudomonas aeruginos 96.2
d1pqwa_183 Putative enoyl reductase domain of polyketide synt 96.05
d1lssa_132 Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax 96.03
d1p0fa2174 Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 95.94
d1f0ya2192 Short chain L-3-hydroxyacyl CoA dehydrogenase {Hum 95.93
d1d1ta2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 95.89
d1pjca1168 L-alanine dehydrogenase {Phormidium lapideum [TaxI 95.86
d1wdka3186 Fatty oxidation complex alpha subunit, middle doma 95.59
d1l7da1183 Nicotinamide nucleotide transhydrogenase dI compon 95.52
d1gu7a2189 2,4-dienoyl-CoA reductase {Yeast (Candida tropical 95.52
d1h2ba2172 Alcohol dehydrogenase {Archaeon Aeropyrum pernix [ 95.49
d2hmva1134 Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} 95.38
d2fzwa2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 95.26
d1gtea3153 Dihydropyrimidine dehydrogenase, domain 3 {Pig (Su 95.06
d1g60a_256 Methyltransferase mboII {Moraxella bovis [TaxId: 4 95.03
d1tt7a2167 Hypothetical protein YhfP {Bacillus subtilis [TaxI 94.96
d1txga2180 Glycerol-3- phosphate dehydrogenase {Archaeoglobus 94.81
d2f1ka2165 Prephenate dehydrogenase TyrA {Synechocystis sp. p 94.81
d1pjca1168 L-alanine dehydrogenase {Phormidium lapideum [TaxI 94.6
d1kyqa1150 Bifunctional dehydrogenase/ferrochelatase Met8p, N 94.6
d1dlja2196 UDP-glucose dehydrogenase (UDPGDH) {Streptococcus 94.57
d1cdoa2175 Alcohol dehydrogenase {Cod (Gadus callarias) [TaxI 94.23
d1pjqa1113 Siroheme synthase CysG, domain 1 {Salmonella typhi 94.22
d1booa_320 m.PvuII N4 cytosine-specific DNA methyltransferase 94.2
d1n1ea2189 Glycerol-3- phosphate dehydrogenase {Trypanosome ( 94.18
d1eg2a_279 m.RsrI N6 adenosine-specific DNA methyltransferase 94.09
d2uyoa1297 Putative methyltransferase ML2640 {Mycobacterium l 93.98
d2jhfa2176 Alcohol dehydrogenase {Horse (Equus caballus) [Tax 93.94
d1o89a2177 Hypothetical protein YhdH {Escherichia coli [TaxId 93.9
d2gv8a2107 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 93.81
d2f1ka2165 Prephenate dehydrogenase TyrA {Synechocystis sp. p 93.61
d1jaya_212 Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archae 93.53
d2pv7a2152 Prephenate dehydrogenase TyrA {Haemophilus influen 93.5
d1vj1a2187 Putative zinc-binding alcohol dehydrogenase {Mouse 93.49
d1lssa_132 Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax 93.28
d1ez4a1146 Lactate dehydrogenase {Lactobacillus pentosus [Tax 93.21
d1xg5a_257 Putative dehydrogenase ARPG836 (MGC4172) {Human (H 93.04
d1trba2126 Thioredoxin reductase {Escherichia coli [TaxId: 56 92.82
d1hyha1146 L-2-hydroxyisocapronate dehydrogenase, L-HICDH {La 92.8
d1fl2a2126 Alkyl hydroperoxide reductase subunit F (AhpF), C- 92.78
d2dw4a2449 Lysine-specific histone demethylase 1, LSD1 {Human 92.72
d1guza1142 Malate dehydrogenase {Chlorobium vibrioforme [TaxI 92.64
d1nyta1170 Shikimate 5-dehydrogenase AroE {Escherichia coli [ 92.6
d1vpda2161 Hydroxyisobutyrate dehydrogenase {Salmonella typhi 92.59
d2g5ca2171 Prephenate dehydrogenase TyrA {Aquifex aeolicus [T 92.42
d1zkda1365 Hypothetical protein RPA4359 {Rhodopseudomonas pal 92.34
d1vdca2130 Thioredoxin reductase {Mouse-ear cress (Arabidopsi 91.96
d1ps9a2162 2,4-dienoyl-CoA reductase, C-terminal domain {Esch 91.88
d1ojua1142 Malate dehydrogenase {Archaeon Archaeoglobus fulgi 91.85
d1hyea1145 MJ0490, lactate/malate dehydrogenase {Archaeon Met 91.83
d1uxja1142 Malate dehydrogenase {Chloroflexus aurantiacus [Ta 91.76
d1ae1a_258 Tropinone reductase {Jimsonweed (Datura stramonium 91.47
d1pzga1154 Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5 91.46
d1l7da1183 Nicotinamide nucleotide transhydrogenase dI compon 90.97
d1a5za1140 Lactate dehydrogenase {Thermotoga maritima [TaxId: 90.84
d1ldna1148 Lactate dehydrogenase {Bacillus stearothermophilus 90.77
d3cuma2162 Hydroxyisobutyrate dehydrogenase {Pseudomonas aeru 90.74
d1iy8a_258 Levodione reductase {Corynebacterium aquaticum [Ta 90.65
d2fy8a1129 Potassium channel-related protein MthK {Archaeon M 90.59
d1y6ja1142 Lactate dehydrogenase {Clostridium thermocellum [T 90.45
d1pgja2178 6-phosphogluconate dehydrogenase {Trypanosoma bruc 90.42
d1npya1167 Shikimate 5-dehydrogenase-like protein HI0607 {Hae 90.36
d1i36a2152 Conserved hypothetical protein MTH1747 {Archaeon M 90.26
d1o8ca277 Hypothetical protein YhdH {Escherichia coli [TaxId 89.89
d1i0za1160 Lactate dehydrogenase {Human (Homo sapiens), heart 89.69
d1e3ja2170 Ketose reductase (sorbitol dehydrogenase) {Silverl 89.42
d1llda1143 Lactate dehydrogenase {Bifidobacterium longum, str 88.91
d1piwa2168 Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas 88.9
d1llua2166 Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax 88.87
d1a9xa4121 Carbamoyl phosphate synthetase (CPS), large subuni 88.85
d1mlda1144 Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 88.79
d1dcta_324 DNA methylase HaeIII {Haemophilus aegyptius [TaxId 88.75
d1pl8a2171 Ketose reductase (sorbitol dehydrogenase) {Human ( 88.63
d1w4xa2235 Phenylacetone monooxygenase {Thermobifida fusca [T 88.48
d2hmva1134 Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} 88.32
d1zema1260 Xylitol dehydrogenase {Gluconobacter oxydans [TaxI 88.28
d2ae2a_259 Tropinone reductase {Jimsonweed (Datura stramonium 88.16
d2g5ca2171 Prephenate dehydrogenase TyrA {Aquifex aeolicus [T 88.04
d1t2da1150 Lactate dehydrogenase {Malaria parasite (Plasmodiu 87.91
d2pgda2176 6-phosphogluconate dehydrogenase {Sheep (Ovis orie 87.87
d1pr9a_244 Carbonyl reductase {Human (Homo sapiens) [TaxId: 9 87.85
d2rhca1257 beta-keto acyl carrier protein reductase {Streptom 87.77
d2ldxa1159 Lactate dehydrogenase {Mouse (Mus musculus) [TaxId 87.74
d1g0oa_272 1,3,8-trihydroxynaphtalene reductase (THNR, naphto 87.71
d1id1a_153 Rck domain from putative potassium channel Kch {Es 87.48
d1p77a1171 Shikimate 5-dehydrogenase AroE {Haemophilus influe 87.03
d1li4a1163 S-adenosylhomocystein hydrolase {Human (Homo sapie 87.03
d2ahra2152 Pyrroline-5-carboxylate reductase ProC {Streptococ 86.99
d1id1a_153 Rck domain from putative potassium channel Kch {Es 86.63
d1nvta1177 Shikimate 5-dehydrogenase AroE {Archaeon Methanoco 86.55
d1hdoa_205 Biliverdin IX beta reductase {Human (Homo sapiens) 86.34
d1vi2a1182 Putative shikimate dehydrogenase YdiB {Escherichia 86.23
d1vj0a2182 Hypothetical protein TM0436 {Thermotoga maritima [ 86.06
d1uufa2168 Hypothetical protein YahK {Escherichia coli [TaxId 85.93
d2gdza1254 15-hydroxyprostaglandin dehydrogenase, PGDH {Human 85.82
d2c07a1251 beta-keto acyl carrier protein reductase {Malaria 85.47
d1p3da196 UDP-N-acetylmuramate-alanine ligase MurC {Haemophi 84.76
d2cmda1145 Malate dehydrogenase {Escherichia coli [TaxId: 562 84.69
d1v8ba1163 S-adenosylhomocystein hydrolase {Plasmodium falcip 84.53
d1wmaa1275 Carbonyl reductase/20beta-hydroxysteroid dehydroge 84.38
d1rjda_328 Leucine carboxy methyltransferase Ppm1 {Baker's ye 84.32
d1cyda_242 Carbonyl reductase {Mouse (Mus musculus) [TaxId: 1 84.17
d1luaa1191 Methylene-tetrahydromethanopterin dehydrogenase {M 83.95
d1jqba2174 Bacterial secondary alcohol dehydrogenase {Clostri 83.84
d1ja9a_259 1,3,6,8-tetrahydroxynaphthalene reductase {Rice bl 83.7
d1yb1a_244 17-beta-hydroxysteroid dehydrogenase type XI {Huma 83.6
d1a9xa3127 Carbamoyl phosphate synthetase (CPS), large subuni 83.59
d2c7pa1327 DNA methylase HhaI {Haemophilus haemolyticus [TaxI 83.53
d1qyca_307 Phenylcoumaran benzylic ether reductase {Loblolly 83.25
d1rjwa2168 Alcohol dehydrogenase {Bacillus stearothermophilus 83.16
d1vl8a_251 Gluconate 5-dehydrogenase {Thermotoga maritima [Ta 83.09
d1gpja2159 Glutamyl tRNA-reductase middle domain {Archaeon Me 82.66
d1e3ia2174 Alcohol dehydrogenase {Mouse (Mus musculus), class 82.31
d1nffa_244 Putative oxidoreductase Rv2002 {Mycobacterium tube 82.09
d1kola2195 Formaldehyde dehydrogenase {Pseudomonas putida [Ta 82.09
d1luaa1191 Methylene-tetrahydromethanopterin dehydrogenase {M 81.81
d1zk4a1251 R-specific alcohol dehydrogenase {Lactobacillus br 81.78
d1jw9b_247 Molybdenum cofactor biosynthesis protein MoeB {Esc 81.69
d1gega_255 meso-2,3-butanediol dehydrogenase {Klebsiella pneu 81.65
d1o6za1142 Malate dehydrogenase {Archaeon Haloarcula marismor 81.65
d1ikta_115 SCP2-like domain of MFE-2 {Human (Homo sapiens) [T 81.48
d2py6a1395 Methyltransferase FkbM {Methylobacillus flagellatu 81.42
d1yqga2152 Pyrroline-5-carboxylate reductase ProC {Neisseria 80.79
d1yxma1297 Peroxisomal trans 2-enoyl CoA reductase {Human (Ho 80.68
d1qyda_312 Pinoresinol-lariciresinol reductase {Giant arborvi 80.63
d1ydea1250 Retinal dehydrogenase/reductase 3 {Human (Homo sap 80.4
>d1kpga_ c.66.1.18 (A:) CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: S-adenosyl-L-methionine-dependent methyltransferases
superfamily: S-adenosyl-L-methionine-dependent methyltransferases
family: Mycolic acid cyclopropane synthase
domain: CmaA1
species: Mycobacterium tuberculosis [TaxId: 1773]

Probab=100.00  E-value=3.2e-63  Score=513.87  Aligned_cols=276  Identities=27%  Similarity=0.492  Sum_probs=257.4

Q ss_pred             CchHHHHHhhhhccCCChHHHHHhcCCCcceeecccCCCCCCHHHHHHHHHHHHHHHcCCCCCCeEEEEccCccHHHHHH
Q 038410          554 NTLAQARRNISHHYDVSNELFSLFLGKSMMYSCAIFKSEYEDLDVAQMRKVSLLIEKARVNKGLDVLEIGCGWGTLAIEI  633 (850)
Q Consensus       554 ~~~~~~~~~i~~~Yd~~~~~~~~~l~~~~~ys~~~~~~~~~~l~~aq~~~~~~~~~~l~~~~~~~vLDiGcG~G~~~~~l  633 (850)
                      |+.+++.+||++|||++|+||++|||++|+|||+||+.++++|++||.+|++.++++++++||++|||||||||++++++
T Consensus         1 ~~~~~~~~~i~~HYD~~~~fy~~~Lg~~~~YS~g~~~~~~~tL~eAQ~~k~~~~~~~l~l~~G~~VLDiGCG~G~~a~~~   80 (285)
T d1kpga_           1 DELKPHFANVQAHYDLSDDFFRLFLDPTQTYSCAYFERDDMTLQEAQIAKIDLALGKLGLQPGMTLLDVGCGWGATMMRA   80 (285)
T ss_dssp             CCSCCCHHHHHHHHTSCHHHHTTTSCTTCCCSCCCCSSTTCCHHHHHHHHHHHHHTTTTCCTTCEEEEETCTTSHHHHHH
T ss_pred             CCCCccHHHHHHhcCCcHHHHHHhCCCCCcEeeEEeCCCCCCHHHHHHHHHHHHHHHcCCCCCCEEEEecCcchHHHHHH
Confidence            45677889999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHhcCCEEEEEeCCHHHHHHHHHHHHHcCCCCCEEEEEcccCCCCCCCCccEEEEecchhhhChhhHHHHHHHHHhcccc
Q 038410          634 VKQTGCKYTGITLSEEQLKYTETKVKEAGLQDHIRLYLCDYRQMPEVKKYDTIISCEMIENVGHEYIEEFFGCCESLLAE  713 (850)
Q Consensus       634 a~~~~~~v~gid~s~~~~~~a~~~~~~~gl~~~v~~~~~D~~~~~~~~~fD~v~s~~~~~~~~~~~~~~~~~~~~r~Lkp  713 (850)
                      |+++||+|+|||+|++|+++|++++++.|+.+++++..+|+++++  ++||.|+|++|+||++.+++..+|++++++|||
T Consensus        81 a~~~g~~v~git~s~~Q~~~a~~~~~~~g~~~~v~~~~~d~~~~~--~~fD~i~si~~~eh~~~~~~~~~~~~~~r~Lkp  158 (285)
T d1kpga_          81 VEKYDVNVVGLTLSKNQANHVQQLVANSENLRSKRVLLAGWEQFD--EPVDRIVSIGAFEHFGHERYDAFFSLAHRLLPA  158 (285)
T ss_dssp             HHHHCCEEEEEESCHHHHHHHHHHHHTCCCCSCEEEEESCGGGCC--CCCSEEEEESCGGGTCTTTHHHHHHHHHHHSCT
T ss_pred             HhcCCcceEEEeccHHHHHHHHHHHHhhhhhhhhHHHHhhhhccc--ccccceeeehhhhhcCchhHHHHHHHHHhhcCC
Confidence            999999999999999999999999999999999999999999987  789999999999999999999999999999999


Q ss_pred             CeEEEEEEecCCCCcCCC---------CcCccccccccccCCCCCCCHHHHHHHHhcCCceEEEEeeecCCcHHHHHHHH
Q 038410          714 HGLLLLQFSSVPDQCYDG---------HRLSPGFITEYVFPGGCLPSLNRITSAMTSSSRLCVEHLENIGIHFYQTLRCW  784 (850)
Q Consensus       714 gG~~~~~~~~~~~~~~~~---------~~~~~~~~~~~i~p~~~~~~~~~~~~~~~~~~gf~v~~~~~~~~~y~~tl~~w  784 (850)
                      ||++++++++........         .....+||++||||+|.+|+..++...+++ +||+|+++++++.||++|++.|
T Consensus       159 gG~~~l~~i~~~~~~~~~~~~~~~~~~~~~~~~fi~kyiFpgg~lPsl~~~~~~~e~-agf~v~~~~~~~~hYarTl~~W  237 (285)
T d1kpga_         159 DGVMLLHTITGLHPKEIHERGLPMSFTFARFLKFIVTEIFPGGRLPSIPMVQECASA-NGFTVTRVQSLQPHYAKTLDLW  237 (285)
T ss_dssp             TCEEEEEEEEECCHHHHTTTTCSCHHHHHHHHHHHHHHTSTTCCCCCHHHHHHHHHT-TTCEEEEEEECHHHHHHHHHHH
T ss_pred             CCcEEEEEEeccCchhhccccCCcchhhhchhhHHHHHhccCCCCCChhhHHHHHHH-hchhhcccccchhhHHHHHHHH
Confidence            999999999854422111         123457999999999999999999887775 7999999999999999999999


Q ss_pred             HHHHHhcHHHHHhccCCHHHHHHHHHHHHHHHHHhccCcceEEEEEEEe
Q 038410          785 RTNLMEKQSEILALGFNEKFIRTWEYYFDYCAAGFKSRTLGNYQIVFSR  833 (850)
Q Consensus       785 ~~~~~~~~~~~~~~~~~~~~~r~w~~yl~~~~~~f~~~~~~~~q~~~~~  833 (850)
                      +++|+++++++.++ +++++.|+|++||++|+++|+.|.++++|++++|
T Consensus       238 ~~~f~~~~~ei~~~-~~~~~~rrw~~Yl~~c~~~F~~g~~~v~q~~~~k  285 (285)
T d1kpga_         238 SAALQANKGQAIAL-QSEEVYERYMKYLTGCAEMFRIGYIDVNQFTCQK  285 (285)
T ss_dssp             HHHHHHTHHHHHHH-SCHHHHHHHHHHHHHHHHHHHTTSEEEEEEEEEC
T ss_pred             HHHHHHHHHHHHHh-cCHHHHHHHHHHHHHHHHHHHCCCCeEEEEEEEC
Confidence            99999999999999 5777789999999999999999999999999987
>d1kpia_ c.66.1.18 (A:) CmaA2 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2fk8a1 c.66.1.18 (A:22-301) Methoxy mycolic acid synthase 4, Mma4 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2o57a1 c.66.1.18 (A:16-297) Putative sarcosine dimethylglycine methyltransferase {Red algae (Galdieria sulphuraria) [TaxId: 130081]} Back     information, alignment and structure
>d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} Back     information, alignment and structure
>d2v5za1 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nkva_ c.66.1.21 (A:) Hypothetical Protein YjhP {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Back     information, alignment and structure
>d1vl5a_ c.66.1.41 (A:) Hypothetical protein BH2331 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1xxla_ c.66.1.41 (A:) Hypothetical protein YcgJ {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nw3a_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ex4a1 c.66.1.42 (A:2-224) Adrenal gland protein AD-003 (C9orf32) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ve3a1 c.66.1.43 (A:2-227) Hypothetical protein PH0226 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1xtpa_ c.66.1.42 (A:) Hypothetical protein Lmaj004091aaa (LmjF30.0810) {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1tw3a2 c.66.1.12 (A:99-351) Carminomycin 4-O-methyltransferase {Streptomyces peucetius [TaxId: 1950]} Back     information, alignment and structure
>d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1wzna1 c.66.1.43 (A:1-251) Hypothetical methyltransferase PH1305 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2i6ga1 c.66.1.44 (A:1-198) Putative methyltransferase TehB {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1pjza_ c.66.1.36 (A:) Thiopurine S-methyltransferase {Pseudomonas syringae [TaxId: 317]} Back     information, alignment and structure
>d1ri5a_ c.66.1.34 (A:) mRNA cap (Guanine N-7) methyltransferase {Fungus (Encephalitozoon cuniculi) [TaxId: 6035]} Back     information, alignment and structure
>d1im8a_ c.66.1.14 (A:) Hypothetical protein HI0319 (YecO) {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2p7ia1 c.66.1.41 (A:22-246) Hypothetical protein ECA1738 {Erwinia carotovora [TaxId: 554]} Back     information, alignment and structure
>d1y8ca_ c.66.1.43 (A:) Putative methyltransferase CAC2371 {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d2a14a1 c.66.1.15 (A:5-261) Indolethylamine N-methyltransferase, INMT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vlma_ c.66.1.41 (A:) Possible histamine N-methyltransferase TM1293 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1qzza2 c.66.1.12 (A:102-357) Aclacinomycin-10-hydroxylase RdmB {Streptomyces purpurascens [TaxId: 1924]} Back     information, alignment and structure
>d1l3ia_ c.66.1.22 (A:) Precorrin-6Y methyltransferase (CbiT) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d2bzga1 c.66.1.36 (A:17-245) Thiopurine S-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bi7a1 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mutase, N-terminal domain {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d2nxca1 c.66.1.39 (A:1-254) PrmA-like protein TTHA0656 (TT0836) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2avna1 c.66.1.41 (A:1-246) Hypothetical methyltransferase TM1389 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1dusa_ c.66.1.4 (A:) Hypothetical protein MJ0882 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2gh1a1 c.66.1.49 (A:13-293) Methyltransferase BC2162 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1dl5a1 c.66.1.7 (A:1-213) Protein-L-isoaspartyl O-methyltransferase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1g8sa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1yb2a1 c.66.1.13 (A:6-255) Hypothetical protein Ta0852 {Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1i9ga_ c.66.1.13 (A:) Probable methyltransferase Rv2118c {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1nt2a_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1o54a_ c.66.1.13 (A:) Hypothetical protein TM0748 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1zx0a1 c.66.1.16 (A:8-236) Guanidinoacetate methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i8ta1 c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mutase, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1p91a_ c.66.1.33 (A:) rRNA methyltransferase RlmA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xvaa_ c.66.1.5 (A:) Glycine N-methyltransferase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2g72a1 c.66.1.15 (A:18-280) Phenylethanolamine N-methyltransferase, PNMTase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i1na_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fcaa1 c.66.1.53 (A:10-213) tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2gf3a1 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]} Back     information, alignment and structure
>d1jqea_ c.66.1.19 (A:) Histamine methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vbfa_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d2b25a1 c.66.1.13 (A:6-329) Hypothetical protein FLJ20628 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yzha1 c.66.1.53 (A:8-211) tRNA (guanine-N(7)-)-methyltransferase TrmB {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1g8aa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1g6q1_ c.66.1.6 (1:) Arginine methyltransferase, HMT1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1jg1a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1oria_ c.66.1.6 (A:) Protein arginine N-methyltransferase 1, PRMT1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} Back     information, alignment and structure
>d2fyta1 c.66.1.6 (A:238-548) Protein arginine N-methyltransferase 3, PRMT3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2frna1 c.66.1.47 (A:19-278) Hypothetical protein PH0793 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1pj5a2 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine oxidase {Arthrobacter globiformis [TaxId: 1665]} Back     information, alignment and structure
>d1u2za_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2i0za1 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d2gqfa1 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein HI0933 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2b3ta1 c.66.1.30 (A:2-275) N5-glutamine methyltransferase, HemK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fp1d2 c.66.1.12 (D:129-372) Chalcone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d1r18a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2as0a2 c.66.1.51 (A:73-396) Hypothetical protein PH1915, middle and C-terminal domains {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1wxxa2 c.66.1.51 (A:65-382) Hypothetical protein TTHA1280, middle and C-terminal domains {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2esra1 c.66.1.46 (A:28-179) Putative methyltransferase SPy1538 {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1fp2a2 c.66.1.12 (A:109-352) Isoflavone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d1m6ya2 c.66.1.23 (A:2-114,A:216-294) TM0872, methyltransferase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2gv8a1 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d1ws6a1 c.66.1.46 (A:15-185) Methyltransferase TTHA0928 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1kyza2 c.66.1.12 (A:120-362) Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d2igta1 c.66.1.51 (A:1-309) Putative methyltransferase Atu0340 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1w4xa1 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Back     information, alignment and structure
>d2b78a2 c.66.1.51 (A:69-385) Hypothetical protein SMu776, middle and C-terminal domains {Streptococcus mutans [TaxId: 1309]} Back     information, alignment and structure
>d1y0pa2 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d1wy7a1 c.66.1.32 (A:4-204) Hypothetical protein PH1948 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2cl5a1 c.66.1.1 (A:3-216) Catechol O-methyltransferase, COMT {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1nv8a_ c.66.1.30 (A:) N5-glutamine methyltransferase, HemK {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2avda1 c.66.1.1 (A:44-262) COMT domain-containing protein 1, COMTD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1d4ca2 c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella putrefaciens [TaxId: 24]} Back     information, alignment and structure
>d2h00a1 c.66.1.54 (A:5-254) Methyltransferase 10 domain containing protein METT10D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qo8a2 c.3.1.4 (A:103-359,A:506-565) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d1ne2a_ c.66.1.32 (A:) Hypothetical protein Ta1320 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1vg0a1 c.3.1.3 (A:3-444,A:558-606) Rab escort protein 1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1susa1 c.66.1.1 (A:21-247) Caffeoyl-CoA O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d2fhpa1 c.66.1.46 (A:1-182) Putative methylase EF2452 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d2fpoa1 c.66.1.46 (A:10-192) Methylase YhhF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ps9a3 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA reductase, middle domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1af7a2 c.66.1.8 (A:92-284) Chemotaxis receptor methyltransferase CheR, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d3c96a1 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2bs2a2 c.3.1.4 (A:1-250,A:372-457) Fumarate reductase {Wolinella succinogenes [TaxId: 844]} Back     information, alignment and structure
>d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1jsxa_ c.66.1.20 (A:) Glucose-inhibited division protein B (GidB) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1m6ia2 c.3.1.5 (A:264-400) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qama_ c.66.1.24 (A:) rRNA adenine dimethylase {Bacillus subtilis, Ermc' [TaxId: 1423]} Back     information, alignment and structure
>d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1feca2 c.3.1.5 (A:170-286) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d1aoga2 c.3.1.5 (A:170-286) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1n4wa1 c.3.1.2 (A:9-318,A:451-507) Cholesterol oxidase of GMC family {Streptomyces sp. [TaxId: 1931]} Back     information, alignment and structure
>d3coxa1 c.3.1.2 (A:5-318,A:451-506) Cholesterol oxidase of GMC family {Brevibacterium sterolicum [TaxId: 1702]} Back     information, alignment and structure
>d1yuba_ c.66.1.24 (A:) rRNA adenine dimethylase {Streptococcus pneumoniae, Ermam [TaxId: 1313]} Back     information, alignment and structure
>d1k0ia1 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1dxla2 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d2f8la1 c.66.1.45 (A:2-329) Hypothetical protein Lmo1582 {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1ojta2 c.3.1.5 (A:276-400) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1uira_ c.66.1.17 (A:) Spermidine synthase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kf6a2 c.3.1.4 (A:0-225,A:358-442) Fumarate reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gtea4 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1mjfa_ c.66.1.17 (A:) Putative spermidine synthetase PF0127 (SpeE) {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]} Back     information, alignment and structure
>d2ifta1 c.66.1.46 (A:11-193) Putative methylase HI0767 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1wg8a2 c.66.1.23 (A:5-108,A:207-284) TM0872, methyltransferase domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2ih2a1 c.66.1.27 (A:21-243) DNA methylase TaqI, N-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1neka2 c.3.1.4 (A:1-235,A:356-450) Succinate dehydogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mo9a2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d1rp0a1 c.3.1.6 (A:7-284) Thiazole biosynthetic enzyme Thi4 {Thale cress(Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1lqta2 c.4.1.1 (A:2-108,A:325-456) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1zq9a1 c.66.1.24 (A:36-313) Probable dimethyladenosine transferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cula1 c.3.1.7 (A:2-231) GidA-related protein TTHA1897 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1djqa3 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1chua2 c.3.1.4 (A:2-237,A:354-422) L-aspartate oxidase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1inla_ c.66.1.17 (A:) Spermidine synthase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1uwva2 c.66.1.40 (A:75-432) rRNA (Uracil-5-)-methyltransferase RumA, catalytic domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jnra2 c.3.1.4 (A:2-256,A:402-502) Adenylylsulfate reductase A subunit {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1cjca2 c.4.1.1 (A:6-106,A:332-460) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1v59a1 c.3.1.5 (A:1-160,A:283-355) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1dxla1 c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d2gmha1 c.3.1.2 (A:4-236,A:336-482) Electron transfer flavoprotein-ubiquinone oxidoreductase, EFT-QO {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1xdza_ c.66.1.20 (A:) Glucose-inhibited division protein B (GidB) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1ojta1 c.3.1.5 (A:117-275,A:401-470) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1xj5a_ c.66.1.17 (A:) Spermidine synthase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1ixka_ c.66.1.38 (A:) Hypothetical methyltransferase PH1374 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2b2ca1 c.66.1.17 (A:3-314) Spermidine synthase {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1ej0a_ c.66.1.2 (A:) RNA methyltransferase FtsJ {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gjca1 c.3.1.6 (A:16-326) Thiazole biosynthetic enzyme Thi4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2okca1 c.66.1.45 (A:9-433) Type I restriction enzyme StySJI M protein {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d2o07a1 c.66.1.17 (A:16-300) Spermidine synthase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iy9a_ c.66.1.17 (A:) Spermidine synthase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1sqga2 c.66.1.38 (A:145-428) Ribosomal RNA small subunit methyltransferase B, RsmB (Sun, Fmu/Fmv), C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gesa1 c.3.1.5 (A:3-146,A:263-335) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qyra_ c.66.1.24 (A:) High level kasugamycin resistance protein KsgA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nhpa1 c.3.1.5 (A:1-119,A:243-321) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1trba1 c.3.1.5 (A:1-118,A:245-316) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3lada1 c.3.1.5 (A:1-158,A:278-348) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1ebda1 c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1fl2a1 c.3.1.5 (A:212-325,A:452-521) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1h6va1 c.3.1.5 (A:10-170,A:293-366) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1lvla1 c.3.1.5 (A:1-150,A:266-335) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1pn0a1 c.3.1.2 (A:1-240,A:342-461) Phenol hydroxylase {Soil-living yeast (Trichosporon cutaneum) [TaxId: 5554]} Back     information, alignment and structure
>d3grsa1 c.3.1.5 (A:18-165,A:291-363) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cf3a1 c.3.1.2 (A:3-324,A:521-583) Glucose oxidase {Aspergillus niger [TaxId: 5061]} Back     information, alignment and structure
>d1kifa1 c.4.1.2 (A:1-194,A:288-339) D-aminoacid oxidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2b9ea1 c.66.1.38 (A:133-425) NOL1R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1onfa1 c.3.1.5 (A:1-153,A:271-376) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1vdca1 c.3.1.5 (A:1-117,A:244-316) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2ar0a1 c.66.1.45 (A:6-529) M.EcoKI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2f5va1 c.3.1.2 (A:43-354,A:553-619) Pyranose 2-oxidase {White-rot fungus (Peniophora sp. SG) [TaxId: 204723]} Back     information, alignment and structure
>d2bm8a1 c.66.1.50 (A:2-233) Cephalosporin hydroxylase CmcI {Streptomyces clavuligerus [TaxId: 1901]} Back     information, alignment and structure
>d1mo9a1 c.3.1.5 (A:2-192,A:314-383) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d2dula1 c.66.1.58 (A:3-377) N(2),N(2)-dimethylguanosine tRNA methyltransferase Trm1 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1xhca1 c.3.1.5 (A:1-103,A:226-289) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1m6ex_ c.66.1.35 (X:) Salicylic acid carboxyl methyltransferase (SAMT) {Clarkia breweri [TaxId: 36903]} Back     information, alignment and structure
>d1m6ia1 c.3.1.5 (A:128-263,A:401-477) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2p41a1 c.66.1.25 (A:8-264) An RNA cap (nucleoside-2'-O-)-methyltransferase domain of RNA polymerase NS5 {Dengue virus 2 [TaxId: 11060]} Back     information, alignment and structure
>d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2oyra1 c.66.1.55 (A:1-250) Hypothetical protein YhiQ {Shigella flexneri [TaxId: 623]} Back     information, alignment and structure
>d1aoga1 c.3.1.5 (A:3-169,A:287-357) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1xdia1 c.3.1.5 (A:2-161,A:276-348) Dihydrolipoamide dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1feca1 c.3.1.5 (A:1-169,A:287-357) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Back     information, alignment and structure
>d1fcda1 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]} Back     information, alignment and structure
>d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yb5a2 c.2.1.1 (A:121-294) Quinone oxidoreductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kdga1 c.3.1.2 (A:215-512,A:694-755) Flavoprotein domain of flavocytochrome cellobiose dehydrogenase (CDH), FAD-binding domain {Fungus (Phanerochaete chrysosporium) [TaxId: 5306]} Back     information, alignment and structure
>d1kola2 c.2.1.1 (A:161-355) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} Back     information, alignment and structure
>d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gpea1 c.3.1.2 (A:1-328,A:525-587) Glucose oxidase {Penicillium amagasakiense [TaxId: 63559]} Back     information, alignment and structure
>d1uufa2 c.2.1.1 (A:145-312) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1llua2 c.2.1.1 (A:144-309) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1e3ia2 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} Back     information, alignment and structure
>d1q1ra1 c.3.1.5 (A:2-114,A:248-319) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1ju2a1 c.3.1.2 (A:1-293,A:464-521) Hydroxynitrile lyase {Almond (Prunus dulcis) [TaxId: 3755]} Back     information, alignment and structure
>d1f8fa2 c.2.1.1 (A:163-336) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} Back     information, alignment and structure
>d1o9ga_ c.66.1.29 (A:) rRNA methyltransferase AviRa {Streptomyces viridochromogenes [TaxId: 1938]} Back     information, alignment and structure
>d1rjwa2 c.2.1.1 (A:138-305) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1jvba2 c.2.1.1 (A:144-313) Alcohol dehydrogenase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1ks9a2 c.2.1.6 (A:1-167) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1i4wa_ c.66.1.24 (A:) Transcription factor sc-mtTFB {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1iz0a2 c.2.1.1 (A:99-269) Quinone oxidoreductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1d7ya1 c.3.1.5 (A:5-115,A:237-308) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1qora2 c.2.1.1 (A:113-291) Quinone oxidoreductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xa0a2 c.2.1.1 (A:119-294) B. subtilis YhfP homologue {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1djqa2 c.3.1.1 (A:490-645) Trimethylamine dehydrogenase, C-terminal domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1v3va2 c.2.1.1 (A:113-294) Leukotriene b4 12-hydroxydehydrogenase/prostaglandin 15-keto reductase {Guinea pig (Cavia porcellus) [TaxId: 10141]} Back     information, alignment and structure
>d1mv8a2 c.2.1.6 (A:1-202) GDP-mannose 6-dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1pqwa_ c.2.1.1 (A:) Putative enoyl reductase domain of polyketide synthase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1p0fa2 c.2.1.1 (A:1164-1337) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]} Back     information, alignment and structure
>d1f0ya2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1d1ta2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1pjca1 c.2.1.4 (A:136-303) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]} Back     information, alignment and structure
>d1wdka3 c.2.1.6 (A:311-496) Fatty oxidation complex alpha subunit, middle domain {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1l7da1 c.2.1.4 (A:144-326) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]} Back     information, alignment and structure
>d1gu7a2 c.2.1.1 (A:161-349) 2,4-dienoyl-CoA reductase {Yeast (Candida tropicalis) [TaxId: 5482]} Back     information, alignment and structure
>d1h2ba2 c.2.1.1 (A:155-326) Alcohol dehydrogenase {Archaeon Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2fzwa2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1gtea3 c.3.1.1 (A:288-440) Dihydropyrimidine dehydrogenase, domain 3 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1g60a_ c.66.1.11 (A:) Methyltransferase mboII {Moraxella bovis [TaxId: 476]} Back     information, alignment and structure
>d1tt7a2 c.2.1.1 (A:128-294) Hypothetical protein YhfP {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1txga2 c.2.1.6 (A:1-180) Glycerol-3- phosphate dehydrogenase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} Back     information, alignment and structure
>d1pjca1 c.2.1.4 (A:136-303) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]} Back     information, alignment and structure
>d1kyqa1 c.2.1.11 (A:1-150) Bifunctional dehydrogenase/ferrochelatase Met8p, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1dlja2 c.2.1.6 (A:1-196) UDP-glucose dehydrogenase (UDPGDH) {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1cdoa2 c.2.1.1 (A:165-339) Alcohol dehydrogenase {Cod (Gadus callarias) [TaxId: 8053]} Back     information, alignment and structure
>d1pjqa1 c.2.1.11 (A:1-113) Siroheme synthase CysG, domain 1 {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1booa_ c.66.1.11 (A:) m.PvuII N4 cytosine-specific DNA methyltransferase {Proteus vulgaris [TaxId: 585]} Back     information, alignment and structure
>d1n1ea2 c.2.1.6 (A:9-197) Glycerol-3- phosphate dehydrogenase {Trypanosome (Leishmania mexicana) [TaxId: 5665]} Back     information, alignment and structure
>d1eg2a_ c.66.1.11 (A:) m.RsrI N6 adenosine-specific DNA methyltransferase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d2uyoa1 c.66.1.57 (A:14-310) Putative methyltransferase ML2640 {Mycobacterium leprae [TaxId: 1769]} Back     information, alignment and structure
>d2jhfa2 c.2.1.1 (A:164-339) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]} Back     information, alignment and structure
>d1o89a2 c.2.1.1 (A:116-292) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gv8a2 c.3.1.5 (A:181-287) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} Back     information, alignment and structure
>d1jaya_ c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2pv7a2 c.2.1.6 (A:92-243) Prephenate dehydrogenase TyrA {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1vj1a2 c.2.1.1 (A:125-311) Putative zinc-binding alcohol dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1ez4a1 c.2.1.5 (A:16-162) Lactate dehydrogenase {Lactobacillus pentosus [TaxId: 1589]} Back     information, alignment and structure
>d1xg5a_ c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC4172) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1trba2 c.3.1.5 (A:119-244) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hyha1 c.2.1.5 (A:21-166) L-2-hydroxyisocapronate dehydrogenase, L-HICDH {Lactobacillus confusus [TaxId: 1583]} Back     information, alignment and structure
>d1fl2a2 c.3.1.5 (A:326-451) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1guza1 c.2.1.5 (A:1-142) Malate dehydrogenase {Chlorobium vibrioforme [TaxId: 1098]} Back     information, alignment and structure
>d1nyta1 c.2.1.7 (A:102-271) Shikimate 5-dehydrogenase AroE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vpda2 c.2.1.6 (A:3-163) Hydroxyisobutyrate dehydrogenase {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2g5ca2 c.2.1.6 (A:30-200) Prephenate dehydrogenase TyrA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1zkda1 c.66.1.52 (A:2-366) Hypothetical protein RPA4359 {Rhodopseudomonas palustris [TaxId: 1076]} Back     information, alignment and structure
>d1vdca2 c.3.1.5 (A:118-243) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1ps9a2 c.3.1.1 (A:466-627) 2,4-dienoyl-CoA reductase, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ojua1 c.2.1.5 (A:22-163) Malate dehydrogenase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1hyea1 c.2.1.5 (A:1-145) MJ0490, lactate/malate dehydrogenase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1uxja1 c.2.1.5 (A:2-143) Malate dehydrogenase {Chloroflexus aurantiacus [TaxId: 1108]} Back     information, alignment and structure
>d1ae1a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), I [TaxId: 4076]} Back     information, alignment and structure
>d1pzga1 c.2.1.5 (A:14-163) Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5811]} Back     information, alignment and structure
>d1l7da1 c.2.1.4 (A:144-326) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]} Back     information, alignment and structure
>d1a5za1 c.2.1.5 (A:22-163) Lactate dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ldna1 c.2.1.5 (A:15-162) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d3cuma2 c.2.1.6 (A:1-162) Hydroxyisobutyrate dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1iy8a_ c.2.1.2 (A:) Levodione reductase {Corynebacterium aquaticum [TaxId: 144185]} Back     information, alignment and structure
>d2fy8a1 c.2.1.9 (A:116-244) Potassium channel-related protein MthK {Archaeon Methanothermobacter thermautotrophicus [TaxId: 145262]} Back     information, alignment and structure
>d1y6ja1 c.2.1.5 (A:7-148) Lactate dehydrogenase {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1pgja2 c.2.1.6 (A:1-178) 6-phosphogluconate dehydrogenase {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1npya1 c.2.1.7 (A:103-269) Shikimate 5-dehydrogenase-like protein HI0607 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1i36a2 c.2.1.6 (A:1-152) Conserved hypothetical protein MTH1747 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1o8ca2 c.2.1.1 (A:116-192) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1i0za1 c.2.1.5 (A:1-160) Lactate dehydrogenase {Human (Homo sapiens), heart isoform (H chain) [TaxId: 9606]} Back     information, alignment and structure
>d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Back     information, alignment and structure
>d1llda1 c.2.1.5 (A:7-149) Lactate dehydrogenase {Bifidobacterium longum, strain am101-2 [TaxId: 216816]} Back     information, alignment and structure
>d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1llua2 c.2.1.1 (A:144-309) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1a9xa4 c.30.1.1 (A:556-676) Carbamoyl phosphate synthetase (CPS), large subunit PreATP-grasp domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mlda1 c.2.1.5 (A:1-144) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1dcta_ c.66.1.26 (A:) DNA methylase HaeIII {Haemophilus aegyptius [TaxId: 197575]} Back     information, alignment and structure
>d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w4xa2 c.3.1.5 (A:155-389) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Back     information, alignment and structure
>d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1zema1 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconobacter oxydans [TaxId: 442]} Back     information, alignment and structure
>d2ae2a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), II [TaxId: 4076]} Back     information, alignment and structure
>d2g5ca2 c.2.1.6 (A:30-200) Prephenate dehydrogenase TyrA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1t2da1 c.2.1.5 (A:1-150) Lactate dehydrogenase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d2pgda2 c.2.1.6 (A:1-176) 6-phosphogluconate dehydrogenase {Sheep (Ovis orientalis aries) [TaxId: 9940]} Back     information, alignment and structure
>d1pr9a_ c.2.1.2 (A:) Carbonyl reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2rhca1 c.2.1.2 (A:5-261) beta-keto acyl carrier protein reductase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d2ldxa1 c.2.1.5 (A:1-159) Lactate dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1g0oa_ c.2.1.2 (A:) 1,3,8-trihydroxynaphtalene reductase (THNR, naphtol reductase) {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1id1a_ c.2.1.9 (A:) Rck domain from putative potassium channel Kch {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1p77a1 c.2.1.7 (A:102-272) Shikimate 5-dehydrogenase AroE {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1li4a1 c.2.1.4 (A:190-352) S-adenosylhomocystein hydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ahra2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1id1a_ c.2.1.9 (A:) Rck domain from putative potassium channel Kch {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nvta1 c.2.1.7 (A:111-287) Shikimate 5-dehydrogenase AroE {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vi2a1 c.2.1.7 (A:107-288) Putative shikimate dehydrogenase YdiB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1uufa2 c.2.1.1 (A:145-312) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gdza1 c.2.1.2 (A:3-256) 15-hydroxyprostaglandin dehydrogenase, PGDH {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c07a1 c.2.1.2 (A:54-304) beta-keto acyl carrier protein reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1p3da1 c.5.1.1 (A:11-106) UDP-N-acetylmuramate-alanine ligase MurC {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2cmda1 c.2.1.5 (A:1-145) Malate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1v8ba1 c.2.1.4 (A:235-397) S-adenosylhomocystein hydrolase {Plasmodium falciparum, isolate 3D7 [TaxId: 5833]} Back     information, alignment and structure
>d1wmaa1 c.2.1.2 (A:2-276) Carbonyl reductase/20beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rjda_ c.66.1.37 (A:) Leucine carboxy methyltransferase Ppm1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1cyda_ c.2.1.2 (A:) Carbonyl reductase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1luaa1 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} Back     information, alignment and structure
>d1ja9a_ c.2.1.2 (A:) 1,3,6,8-tetrahydroxynaphthalene reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1yb1a_ c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase type XI {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9xa3 c.30.1.1 (A:1-127) Carbamoyl phosphate synthetase (CPS), large subunit PreATP-grasp domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2c7pa1 c.66.1.26 (A:1-327) DNA methylase HhaI {Haemophilus haemolyticus [TaxId: 726]} Back     information, alignment and structure
>d1qyca_ c.2.1.2 (A:) Phenylcoumaran benzylic ether reductase {Loblolly pine (Pinus taeda) [TaxId: 3352]} Back     information, alignment and structure
>d1rjwa2 c.2.1.1 (A:138-305) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1vl8a_ c.2.1.2 (A:) Gluconate 5-dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1gpja2 c.2.1.7 (A:144-302) Glutamyl tRNA-reductase middle domain {Archaeon Methanopyrus kandleri [TaxId: 2320]} Back     information, alignment and structure
>d1e3ia2 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} Back     information, alignment and structure
>d1nffa_ c.2.1.2 (A:) Putative oxidoreductase Rv2002 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1kola2 c.2.1.1 (A:161-355) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1luaa1 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1zk4a1 c.2.1.2 (A:1-251) R-specific alcohol dehydrogenase {Lactobacillus brevis [TaxId: 1580]} Back     information, alignment and structure
>d1jw9b_ c.111.1.1 (B:) Molybdenum cofactor biosynthesis protein MoeB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gega_ c.2.1.2 (A:) meso-2,3-butanediol dehydrogenase {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1o6za1 c.2.1.5 (A:22-162) Malate dehydrogenase {Archaeon Haloarcula marismortui [TaxId: 2238]} Back     information, alignment and structure
>d1ikta_ d.106.1.1 (A:) SCP2-like domain of MFE-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2py6a1 c.66.1.56 (A:14-408) Methyltransferase FkbM {Methylobacillus flagellatus [TaxId: 405]} Back     information, alignment and structure
>d1yqga2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Neisseria meningitidis, serogroup B [TaxId: 487]} Back     information, alignment and structure
>d1yxma1 c.2.1.2 (A:7-303) Peroxisomal trans 2-enoyl CoA reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qyda_ c.2.1.2 (A:) Pinoresinol-lariciresinol reductase {Giant arborvitae (Thuja plicata) [TaxId: 3316]} Back     information, alignment and structure
>d1ydea1 c.2.1.2 (A:4-253) Retinal dehydrogenase/reductase 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure