Citrus Sinensis ID: 038430


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------
MWVCVSDTFEEISVANAIIEGLGESTSSLSEFQSLMSHIHRSIEGKKNFLILNDVWDGDYNKWAPFFLCLNHGLHGSKILVTTRNELVARMMGSTNIIFIEQLTEEECWSLFKRLAFFGCSFEDCERLEPIGQKIARKCKGLPIAAKVIGNLLRSKSTIKDWQRILDSEMWKAEEIGKGLLTPLLLSYNDLSSNSMVKRFFSYCAVFPKDYNMYKEELISLWMAQGYLNAEEYEEKEMTGEECFNILAARSFFQEFEKNDDDDIMSCKMHDIVHDFAQFVSSKECLWLEINSTKESVINAFGGKVRHLGLKFKGGASFPMSIHGLNRLRTLLIDDESPPNSSLDKIPENVGKLMHLKYLNLSELHIERLPKTLCELYNLQKLDIRGCRNLRELPTGIGKLKNMRSLLNGLTCSLKYMPIGISKLTSLRTLDKFAVGGGVDGGSTCRLECLKNFQLIRKCGIEGLSNVSHLDEAERLELKNMENLLHLYLWFEVVDREDEDWEDEEENEDEGGEDEDEDGGYKEEKGGKVVDGEYEERRRKNEKDEQLLEALQPPLNVEKLWILFNGGNILPKWLTSLTNLSDLKLVFCENCEQLPPLGKLPLEKLELCHLKSVKRVGNEFLEIEESEDDPSSSSSSSSVTAFPKVKSLEIKELEEGNYRITRKENISIIPRLSSLRI
cEEEEcccccHHHHHHHHHHHHccccccccHHHHHHHHHHHHHccccEEEEEccccccccccHHHHHHHHcccccccEEEEEEccHHHHHHHcccccEEcccccHHHHHHHHHHHHcccccccccccHHHHHHHHHHHccccHHHHHHHHHHHcccccHHHHHHHHHHHcccccccccccHHHHHHHcccccccccHHHHHHHHccccccccccHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHcccccEEEcccccccccEEccHHHHHHHHHHHcccEEEEEEccccccccccccccEEEEEEEEcccccccccccccccccEEEEccccccccccccccccccccccccEEEEcccccccccccHHccccccEEEcccccccccccccHHccccccHHccccccccccccccccccccccccccEEcccccccccccccccccccccccccccccccccccccHHHHHHHccccccccHHcccEEcccccccccccccccccccccccccccccccccccccccHHHHHHHccccHHHHHHHcccccccccEEEEEcccccccccccccccccEEEEEcccccccccccccccccccccccccccEEEcccccccccccccccccccccccccccccccccccccccccEEcccccccccccccccccc
cEEEEcccccHHHHHHHHHHHHcccccccccHHHHHHHHHHHHcccEEEEEEEccccccHHHHHHHHHHHHccccccEEEEEEccHHHHHHHccccccccccccHHHHHHHHHHHHcccccccccccHHHHHHHHHHHccccHHHHHHHHHHHHccccHHHHHHHHHccHcccccccccccHHHEEEHcccccHHHHHHHHHHHHcccccccccHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHccccccccccccEEEHHHHHHHHHHHHcccEEEEEEcccccccccccccccEEEEEEEcccccccccHHcccccccEEEEEEcccccccHHcccccccccccccEEEEccccccccccccccccccEEEEEcccccHHcccHHccccccccEEEEccccccccccccccccccccEEEEEEcccccccccccccHcHHHHccccccccccccccccccHHHcccccccccccEEEEEccccccccccccccccHHHHHHcccccccccccccccccccHHHHHHccccccHHHHHHHccccccccEEEEEcccccccccHcccccccEEEEEccccccccccccccccccEEEEcccccccEccHHHccccccccccccccccccccccccccEEEEccccccccccHcHEEcccccccccccc
MWVCVSDTFEEISVANAIIEGLGESTSSLSEFQSLMSHIHRSIEGKKNFLILNDvwdgdynkwapfflclnhglhgskILVTTRNELVARMMGSTNIIFIEQLTEEECWSLFKRLaffgcsfedcerlEPIGQKIARKCKGLPIAAKVIGNLLRSKSTIKDWQRILDSEMWKAEEIGKGLLTPLLlsyndlssnsmVKRFFSYcavfpkdynMYKEELISLWMAQGYLNAEEYEEKEMTGEECFNILAARSFFQefeknddddimsckmhDIVHDFAQFVSSKECLWLEINSTKESVINAFGGkvrhlglkfkggasfpmsiHGLNRLRTlliddesppnssldkipenVGKLMHLKYLNLSELHIERLPKTLCELYNlqkldirgcrnlrelptgigkLKNMRSLLNGLTcslkympigiskltslrtldkfavgggvdggstcRLECLKNFQLIRKCGieglsnvshldEAERLELKNMENLLHLYLWFEVvdrededwedeeenedeggedededggykeekggkvvdgeyeeRRRKNEKDEQLLEAlqpplnveKLWILFnggnilpkwltsltnlsdlklvfcenceqlpplgklpleklelchlksVKRVGNEFleieeseddpssssssssvtafpkvkSLEIKEleegnyritrkenisiiprlsslri
MWVCVSDTFEEISVANAIIEGLGESTSSLSEFQSLMSHIHRSIEGKKNFLILNDVWDGDYNKWAPFFLCLNHGLHGSKILVTTRNELVARMMGSTNIIFIEQLTEEECWSLFKRLAFFGCSFEDCERLEPIGQKIARKCKGLPIAAKVignllrskstikDWQRILDSEMWKAEEIGKGLLTPLLLSYNDLSSNSMVKRFFSYCAVFPKDYNMYKEELISLWMAQGYLNAEEYEEKEMTGEECFNILAARSFFQEFEKNDDDDIMSCKMHDIVHDFAQFVSSKECLWLEINSTKESVINAFGGKVRHLGLKFKGGASFPMSIHGLNRLRTLLIDDESPPNSSLDKIPENVGKLMHLKYLNLSELHIERLPKTLCELYNLQKLDIRGCRNLRELptgigklknMRSLLNGLTCSLKYMPIGISKLTSLRTLDKFAvgggvdggstCRLECLKNFQLIRKCGIEGLSNVSHLDEAERLELKNMENLLHLYLWFEVVDREDEDWEdeeenedeggedededggykeekggkvvdgeyeerRRKNEKDEQLLEALQPPLNVEKLWILFNGGNILPKWLTSLTNLSDLKLVFCENCEQLPPLGKLPLEKLELCHLKSVKRVGNEFLEIeeseddpssssssssvtafpkvksleikeleegnyritrkenisiiprlsslri
MWVCVSDTFEEISVANAIIeglgestsslseFQSLMSHIHRSIEGKKNFLILNDVWDGDYNKWAPFFLCLNHGLHGSKILVTTRNELVARMMGSTNIIFIEQLTEEECWSLFKRLAFFGCSFEDCERLEPIGQKIARKCKGLPIAAKVIGNLLRSKSTIKDWQRILDSEMWKAEEIGKGLLTPlllsyndlssnsMVKRFFSYCAVFPKDYNMYKEELISLWMAQGYLNAeeyeekemtgeeCFNILAARSFFQEFEKNDDDDIMSCKMHDIVHDFAQFVSSKECLWLEINSTKESVINAFGGKVRHLGLKFKGGASFPMSIHGLNRLRTLLIDDESPPNSSLDKIPENVGKLMHLKYLNLSELHIERLPKTLCELYNLQKLDIRGCRNLRELPTGIGKLKNMRSLLNGLTCSLKYMPIGISKLTSLRTLDKFAVGGGVDGGSTCRLECLKNFQLIRKCGIEGLSNVSHLDEAERLELKNMENLLHLYLWFevvdrededwedeeenedeggedededggykeekggkvvdgeyeeRRRKNEKDEQLLEALQPPLNVEKLWILFNGGNILPKWLTSLTNLSDLKLVFCENCEQlpplgklpleklelCHLKSVKRVGNEFLEIEESEDDPssssssssVTAFPKVKSLEIKELEEGNYRITRKENisiiprlsslri
*WVCVSDTFEEISVANAIIEGLG********FQSLMSHIHRSIEGKKNFLILNDVWDGDYNKWAPFFLCLNHGLHGSKILVTTRNELVARMMGSTNIIFIEQLTEEECWSLFKRLAFFGCSFEDCERLEPIGQKIARKCKGLPIAAKVIGNLLRSKSTIKDWQRILDSEMWKAEEIGKGLLTPLLLSYNDLSSNSMVKRFFSYCAVFPKDYNMYKEELISLWMAQGYLNAEEYEEKEMTGEECFNILAARSFFQEFEKNDDDDIMSCKMHDIVHDFAQFVSSKECLWLEINSTKESVINAFGGKVRHLGLKFKGGASFPMSIHGLNRLRTLLI***************NVGKLMHLKYLNLSELHIERLPKTLCELYNLQKLDIRGCRNLRELPTGIGKLKNMRSLLNGLTCSLKYMPIGISKLTSLRTLDKFAVGGGVDGGSTCRLECLKNFQLIRKCGIEGLSNVSHLDEAERLELKNMENLLHLYLWFEVVD*********************************************************PPLNVEKLWILFNGGNILPKWLTSLTNLSDLKLVFCENCEQLPPLGKLPLEKLELCHLKSVKRVGNEFL********************************************************
MWVCVSDTFEEISVANAIIEGLGE**********LMSHIHRSIEGKKNFLILNDVWDGDYNKWAPFFLCLNHGLHGSKILVTTRNELVARMMGSTNIIFIEQLTEEECWSLFKRLAF**********LEPIGQKIARKCKGLPIAAKVIGNLLRSKSTIKDWQRILDSEMWKAEEIGKGLLTPLLLSYNDLSSNSMVKRFFSYCAVFPKDYNMYKEELISLWMAQ*************TGEECFNILAARSFFQEFEKNDDDDIMSCKMHDIVHDFAQFVSSKECLWLEINST******AFGGKVRHLGLKFKGGASFPMSIHGLNRLRTLLIDDESPPNSSLDKIPENVGKLMHLKYLNLSELHIERLPKTLCELYNLQKLDIRGCRNLRELPTGIGKLKNMRSLLNGLTCSLKYMPIGISKLTSLRTLDKFAVGGGVDGGSTCRLECLKNFQLIRKCGIEGLSNVSHLDEAERLELKNMENLLHLYLWFEVVDREDEDWEDEEENED*GGEDEDEDGGYKEEKGGKVVDGEYEERRRKNEKDEQLLEALQPPLNVEKLWILFNGGNILPKWLTSLTNLSDLKLVFCENCEQLPPLGKLPLEKLELCHLKSVKRVGNEFLEIEES*************TAFPKVKSLEIKELEEGNYRITRKENISIIPRLSSLRI
MWVCVSDTFEEISVANAIIEGLGESTSSLSEFQSLMSHIHRSIEGKKNFLILNDVWDGDYNKWAPFFLCLNHGLHGSKILVTTRNELVARMMGSTNIIFIEQLTEEECWSLFKRLAFFGCSFEDCERLEPIGQKIARKCKGLPIAAKVIGNLLRSKSTIKDWQRILDSEMWKAEEIGKGLLTPLLLSYNDLSSNSMVKRFFSYCAVFPKDYNMYKEELISLWMAQGYLNAEEYEEKEMTGEECFNILAARSFFQEFEKNDDDDIMSCKMHDIVHDFAQFVSSKECLWLEINSTKESVINAFGGKVRHLGLKFKGGASFPMSIHGLNRLRTLLIDDESPPNSSLDKIPENVGKLMHLKYLNLSELHIERLPKTLCELYNLQKLDIRGCRNLRELPTGIGKLKNMRSLLNGLTCSLKYMPIGISKLTSLRTLDKFAVGGGVDGGSTCRLECLKNFQLIRKCGIEGLSNVSHLDEAERLELKNMENLLHLYLWFEVVDRE***************************KGGKVV*************DEQLLEALQPPLNVEKLWILFNGGNILPKWLTSLTNLSDLKLVFCENCEQLPPLGKLPLEKLELCHLKSVKRVGNEFLEI*******************PKVKSLEIKELEEGNYRITRKENISIIPRLSSLRI
MWVCVSDTFEEISVANAIIEGLGESTSSLSEFQSLMSHIHRSIEGKKNFLILNDVWDGDYNKWAPFFLCLNHGLHGSKILVTTRNELVARMMGSTNIIFIEQLTEEECWSLFKRLAFFGCSFEDCERLEPIGQKIARKCKGLPIAAKVIGNLLRSKSTIKDWQRILDSEMWKAEEIGKGLLTPLLLSYNDLSSNSMVKRFFSYCAVFPKDYNMYKEELISLWMAQGYLNAEEYEEKEMTGEECFNILAARSFFQEFEKNDDDDIMSCKMHDIVHDFAQFVSSKECLWLEINSTKESVINAFGGKVRHLGLKFKGGASFPMSIHGLNRLRTLLIDDESPPNSSLDKIPENVGKLMHLKYLNLSELHIERLPKTLCELYNLQKLDIRGCRNLRELPTGIGKLKNMRSLLNGLTCSLKYMPIGISKLTSLRTLDKFAVGGGVDGGSTCRLECLKNFQLIRKCGIEGLSNVSHLDEAERLELKNMENLLHLYLWFEVVDREDEDWEDEEENEDEGGEDEDEDGGYKEEKGGKVVDGEYEERRRKNEKDEQLLEALQPPLNVEKLWILFNGGNILPKWLTSLTNLSDLKLVFCENCEQLPPLGKLPLEKLELCHLKSVKRVGNEFLEIEESEDDPSSSSSSSSVTAFPKVKSLEIKELEEGNYRITRKENISIIPRLSSLR*
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MWVCVSDTFEEISVANAIIEGLGESTSSLSEFQSLMSHIHRSIEGKKNFLILNDVWDGDYNKWAPFFLCLNHGLHGSKILVTTRNELVARMMGSTNIIFIEQLTEEECWSLFKRLAFFGCSFEDCERLEPIGQKIARKCKGLPIAAKVIGNLLRSKSTIKDWQRILDSEMWKAEEIGKGLLTPLLLSYNDLSSNSMVKRFFSYCAVFPKDYNMYKEELISLWMAQGYLNAEEYEEKEMTGEECFNILAARSFFQEFEKNDDDDIMSCKMHDIVHDFAQFVSSKECLWLEINSTKESVINAFGGKVRHLGLKFKGGASFPMSIHGLNRLRTLLIDDESPPNSSLDKIPENVGKLMHLKYLNLSELHIERLPKTLCELYNLQKLDIRGCRNLRELPTGIGKLKNMRSLLNGLTCSLKYMPIGISKLTSLRTLDKFAVGGGVDGGSTCRLECLKNFQLIRKCGIEGLSNVSHLDEAERLELKNMENLLHLYLWFEVVDREDEDWEDEEENEDEGGEDEDEDGGYKEEKGGKVVDGEYEERRRKNEKDEQLLEALQPPLNVEKLWILFNGGNILPKWLTSLTNLSDLKLVFCENCEQLPPLGKLPLEKLELCHLKSVKRVGNEFLEIEESEDDPSSSSSSSSVTAFPKVKSLEIKELEEGNYRITRKENISIIPRLSSLRI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query677 2.2.26 [Sep-21-2011]
Q7XA42 979 Putative disease resistan N/A no 0.800 0.553 0.349 1e-78
Q7XA39 988 Putative disease resistan N/A no 0.890 0.610 0.324 4e-76
Q7XA40 992 Putative disease resistan N/A no 0.810 0.553 0.332 3e-75
Q7XBQ9 970 Disease resistance protei N/A no 0.856 0.597 0.327 4e-71
Q9LRR5 1424 Putative disease resistan yes no 0.914 0.434 0.297 4e-62
Q9LRR4 1054 Putative disease resistan no no 0.828 0.532 0.273 3e-57
Q38834852 Disease resistance RPP13- no no 0.688 0.546 0.287 3e-45
Q39214926 Disease resistance protei no no 0.580 0.424 0.290 1e-38
O81825919 Probable disease resistan no no 0.646 0.476 0.278 4e-31
Q8W3K3910 Putative disease resistan no no 0.617 0.459 0.272 2e-30
>sp|Q7XA42|RGA1_SOLBU Putative disease resistance protein RGA1 OS=Solanum bulbocastanum GN=RGA1 PE=2 SV=2 Back     alignment and function desciption
 Score =  294 bits (753), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 214/613 (34%), Positives = 307/613 (50%), Gaps = 71/613 (11%)

Query: 1   MWVCVSDTFEEISVANAIIEGLGESTSSLSEFQSLMSHIHRSIEGKKNFLILNDVWDGDY 60
           +W+C+SD F E  +  AI+E +   + S  +   L   +   + GK+ FL+L+DVW+ D 
Sbjct: 209 IWICISDDFNEKRLIKAIVESIEGKSLSDMDLAPLQKKLQELLNGKRYFLVLDDVWNEDQ 268

Query: 61  NKWAPFFLCLNHGLHGSKILVTTRNELVARMMGSTNIIFIEQLTEEECWSLFKRLAFFGC 120
           +KWA     L  G  G+ +L TTR E V  +MG+     +  L+ E+CW LF + A FG 
Sbjct: 269 HKWANLRAVLKVGASGAFVLTTTRLEKVGSIMGTLQPYELSNLSPEDCWFLFMQRA-FGH 327

Query: 121 SFEDCERLEPIGQKIARKCKGLPIAAKVIGNLLRSKSTIKDWQRILDSEMWKAEEIGKGL 180
             E    L  IG++I +KC G+P+AAK +G +LR K   ++W+ + DS +W   +    +
Sbjct: 328 QEEINPNLMAIGKEIVKKCGGVPLAAKTLGGILRFKREEREWEHVRDSPIWNLPQDESSI 387

Query: 181 LTPLLLSYNDLSSNSMVKRFFSYCAVFPKDYNMYKEELISLWMAQGYLNAEEYEEKEMTG 240
           L  L LSY+ L  +  +++ F YCAVFPKD  M KE LI+ WMA G+L ++   E E  G
Sbjct: 388 LPALRLSYHHLPLD--LRQCFVYCAVFPKDTKMAKENLIAFWMAHGFLLSKGNLELEDVG 445

Query: 241 EECFNILAARSFFQEFEKNDDDDIMSCKMHDIVHDFAQFVSSKECLWLEINSTKESVINA 300
            E +N L  RSFFQE E          KMHD++HD A  + S        +S+    INA
Sbjct: 446 NEVWNELYLRSFFQEIEVESGKTYF--KMHDLIHDLATSLFSANT-----SSSNIREINA 498

Query: 301 -FGGKVRHLGLKFKGGASFPMSIHGLNRLRTLLIDDESPPNSSLDKIPENVGKLMHLKYL 359
            + G +  +G      +  P  +     LR L +      NS+L+++P ++G L+HL+YL
Sbjct: 499 NYDGYMMSIGFAEVVSSYSPSLLQKFVSLRVLNLR-----NSNLNQLPSSIGDLVHLRYL 553

Query: 360 NLS-ELHIERLPKTLCELYNLQKLDIRGCRNLRELPTGIGKLKNMRS-LLNGLTCSLKYM 417
           +LS    I  LPK LC+L NLQ LD+  C +L  LP    KL ++R+ LL+G  CSL   
Sbjct: 554 DLSGNFRIRNLPKRLCKLQNLQTLDLHYCDSLSCLPKQTSKLGSLRNLLLDG--CSLTST 611

Query: 418 PIGISKLTSLRTLDKFAVGGGVDGGSTCRLECLKNFQLIRKCGIEGLSNVSHLDEAERLE 477
           P  I  LT L++L  F +G         +L  LKN  L     I  L  V    +A+   
Sbjct: 612 PPRIGLLTCLKSLSCFVIG----KRKGHQLGELKNLNLYGSISITKLDRVKKDTDAKEAN 667

Query: 478 LKNMENLLHLYLWFEVVDREDEDWEDEEENEDEGGEDEDEDGGYKEEKGGKVVDGEYEER 537
           L    NL  L L           W              D DG                  
Sbjct: 668 LSAKANLHSLCL----------SW--------------DLDG------------------ 685

Query: 538 RRKNEKDEQLLEALQPPLNVEKLWILFNGGNILPKWL--TSLTNLSDLKLVFCENCEQLP 595
             K+  D ++LEAL+P  N++ L I   GG  LP W+  + L N+  +++  CENC  LP
Sbjct: 686 --KHRYDSEVLEALKPHSNLKYLEINGFGGIRLPDWMNQSVLKNVVSIRIRGCENCSCLP 743

Query: 596 PLGKLP-LEKLEL 607
           P G+LP LE LEL
Sbjct: 744 PFGELPCLESLEL 756




Disease resistance protein. Resistance proteins guard the plant against pathogens that contain an appropriate avirulence protein via a direct or indirect interaction with this avirulence protein. That triggers a defense system which restricts the pathogen growth.
Solanum bulbocastanum (taxid: 147425)
>sp|Q7XA39|RGA4_SOLBU Putative disease resistance protein RGA4 OS=Solanum bulbocastanum GN=RGA4 PE=2 SV=1 Back     alignment and function description
>sp|Q7XA40|RGA3_SOLBU Putative disease resistance protein RGA3 OS=Solanum bulbocastanum GN=RGA3 PE=2 SV=2 Back     alignment and function description
>sp|Q7XBQ9|RGA2_SOLBU Disease resistance protein RGA2 OS=Solanum bulbocastanum GN=RGA2 PE=1 SV=1 Back     alignment and function description
>sp|Q9LRR5|DRL21_ARATH Putative disease resistance protein At3g14460 OS=Arabidopsis thaliana GN=At3g14460 PE=3 SV=1 Back     alignment and function description
>sp|Q9LRR4|R13L1_ARATH Putative disease resistance RPP13-like protein 1 OS=Arabidopsis thaliana GN=RPPL1 PE=3 SV=1 Back     alignment and function description
>sp|Q38834|R13L4_ARATH Disease resistance RPP13-like protein 4 OS=Arabidopsis thaliana GN=RPP13L4 PE=2 SV=2 Back     alignment and function description
>sp|Q39214|RPM1_ARATH Disease resistance protein RPM1 OS=Arabidopsis thaliana GN=RPM1 PE=1 SV=1 Back     alignment and function description
>sp|O81825|DRL28_ARATH Probable disease resistance protein At4g27220 OS=Arabidopsis thaliana GN=At4g27220 PE=2 SV=1 Back     alignment and function description
>sp|Q8W3K3|DRL8_ARATH Putative disease resistance protein At1g58400 OS=Arabidopsis thaliana GN=At1g58400 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query677
224122712 945 cc-nbs-lrr resistance protein [Populus t 0.924 0.662 0.413 1e-128
224122696 906 cc-nbs-lrr resistance protein [Populus t 0.889 0.664 0.402 1e-123
224130338 906 nbs-lrr resistance protein [Populus tric 0.886 0.662 0.397 1e-122
224114824 941 cc-nbs-lrr resistance protein [Populus t 0.903 0.650 0.394 1e-122
224134406 987 cc-nbs-lrr resistance protein [Populus t 0.896 0.614 0.397 1e-119
224110248 888 cc-nbs-lrr resistance protein [Populus t 0.878 0.670 0.401 1e-119
147825450 927 hypothetical protein VITISV_000086 [Viti 0.902 0.659 0.392 1e-119
359482769 904 PREDICTED: putative disease resistance p 0.899 0.673 0.392 1e-119
147843549 970 hypothetical protein VITISV_000507 [Viti 0.898 0.626 0.406 1e-119
359482790 923 PREDICTED: putative disease resistance p 0.899 0.659 0.387 1e-118
>gi|224122712|ref|XP_002318907.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|222859580|gb|EEE97127.1| cc-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  464 bits (1193), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 298/720 (41%), Positives = 410/720 (56%), Gaps = 94/720 (13%)

Query: 1   MWVCVSDTFEEISVANAIIEGLGESTSSLSEFQSLMSHIHRSIEGKKNFLILNDVWDGDY 60
           +WVCVS+ F+EI +A AI+E L    ++L E QSL+  +  SI GK+  L+L+DVW  ++
Sbjct: 231 IWVCVSEPFDEIRIAKAILEQLEGRPTNLVELQSLLQGVSESITGKRLLLVLDDVWTENH 290

Query: 61  NKWAPFFLCLNHGLHGSKILVTTRNELVARMMGSTNIIFIEQLTEEECWSLFKRLAFFGC 120
            +W      L     GS+ILVTTR + VA MMG+ + I IE+L++E C S+F  +AF   
Sbjct: 291 GQWEQLKPSLTGCARGSRILVTTRKDAVATMMGTDHRINIEKLSDEICRSIFNHVAFQER 350

Query: 121 SFEDCERLEPIGQKIARKCKGLPIAAKVIGNLLRSKSTIKDWQRILDSEMWKAEEIGKG- 179
           S ++ ERL  IG KIA KCKGLP+AAKV+G L++SK T ++W+R+L SE+W+ +E+ +  
Sbjct: 351 SEDERERLTDIGDKIANKCKGLPLAAKVLGGLMQSKRTREEWERVLSSELWRLDEVDRDQ 410

Query: 180 ----LLTPLLLSYNDLSSNSMVKRFFSYCAVFPKDYNMYKEELISLWMAQGYLNAEEYEE 235
               +  PLLLSY DL S  +V+R F YCA+FPKDY M K EL+ +WMAQGY+      +
Sbjct: 411 VESRIFIPLLLSYYDLPS--VVRRCFLYCAMFPKDYEMGKYELVKMWMAQGYIKETSGGD 468

Query: 236 KEMTGEECFNILAARSFFQEFEKNDDDDIMSCKMHDIVHDFAQFVSSKECLWLEINSTKE 295
            E+ GE  F++LAARSFFQ+FE  D  + M  KMHDIVHDFAQ+++  ECL +++N+   
Sbjct: 469 MELVGERYFHVLAARSFFQDFE-TDIFEGMKFKMHDIVHDFAQYMTKNECLTVDVNTLGG 527

Query: 296 SVINAFGGKVRHLGLKFKGGASFPMSIHGLNRLRTLLIDDESP------PN--------- 340
           + +     +VRHL +      SFP+SIH    LR+LLID   P      P+         
Sbjct: 528 ATVETSIERVRHLSMMVSEETSFPVSIHKAKGLRSLLIDTRDPSLGAALPDLFKQLTCIR 587

Query: 341 ------SSLDKIPENVGKLMHLKYLNLSEL-HIERLPKTLCELYNLQKLDIRGCRNLREL 393
                 SS+ +IP  VGKL+HL+++NL+    +E LP+T+C+L NLQ LD+  CR+L+EL
Sbjct: 588 SLNLSASSIKEIPNEVGKLIHLRHVNLARCGELESLPETMCDLCNLQSLDVTWCRSLKEL 647

Query: 394 PTGIGKLKNMRSLLNGLTCSLKYMPIGISKLTSLRTLDKFAV-GGGVDGGSTCRLECLKN 452
           P  IGKL  +R L       + ++P GI ++T LRTLD F V GGG +      L  LKN
Sbjct: 648 PNAIGKLIKLRHL-RIYRSGVDFIPKGIERITCLRTLDVFKVCGGGENESKAANLRELKN 706

Query: 453 FQLI------RKCGIEGLSNVSHLDEAERLELKNMENLLHLYLWFEVVDREDEDWEDEEE 506
              I      R  G  G+ + S   EA+   LKN + L  L L F        D E  E 
Sbjct: 707 LNHIGGSLNIRNLG-GGIEDASDAAEAQ---LKNKKRLRRLELVF--------DREKTEL 754

Query: 507 NEDEGGEDEDEDGGYKEEKGGKVVDGEYEERRRKNEKDEQLLEALQPPLNVEKLWILFNG 566
             +EG                                   L+EALQPP N+E L I   G
Sbjct: 755 QANEGS----------------------------------LIEALQPPSNLEYLTISSYG 780

Query: 567 GNILPKWLTSLTNLSDLKLVFCENCEQLPPLGKLP-LEKLELCHLKSVKRVGNEFLEIEE 625
           G  LP W+ +LT L  L+L  C   E LPPLG+LP LE+L L  LK V+R+   FL IE+
Sbjct: 781 GFDLPNWMMTLTRLLALELHDCTKLEVLPPLGRLPNLERLALRSLK-VRRLDAGFLGIEK 839

Query: 626 SEDDPSSSSSSSSVTAFPKVKSLEIKELEE--GNYRITRKE------NISIIPRLSSLRI 677
            E+   +    + VTAFPK+K LEI  ++E  G  R +  E      +ISI+P+L  L I
Sbjct: 840 DENASINEGEIARVTAFPKLKILEIWNIKEWDGIERRSVGEEDATTTSISIMPQLRQLTI 899




Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|224122696|ref|XP_002318903.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|222859576|gb|EEE97123.1| cc-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224130338|ref|XP_002328584.1| nbs-lrr resistance protein [Populus trichocarpa] gi|222838566|gb|EEE76931.1| nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224114824|ref|XP_002332291.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|222832453|gb|EEE70930.1| cc-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224134406|ref|XP_002321815.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|222868811|gb|EEF05942.1| cc-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224110248|ref|XP_002333128.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|222834939|gb|EEE73388.1| cc-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|147825450|emb|CAN71072.1| hypothetical protein VITISV_000086 [Vitis vinifera] Back     alignment and taxonomy information
>gi|359482769|ref|XP_003632834.1| PREDICTED: putative disease resistance protein RGA4-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|147843549|emb|CAN79463.1| hypothetical protein VITISV_000507 [Vitis vinifera] Back     alignment and taxonomy information
>gi|359482790|ref|XP_002268671.2| PREDICTED: putative disease resistance protein RGA4-like [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query677
TAIR|locus:2091662 1424 AT3G14460 [Arabidopsis thalian 0.703 0.334 0.303 4.7e-51
TAIR|locus:2078012852 ZAR1 "HOPZ-ACTIVATED RESISTANC 0.703 0.558 0.273 1.8e-42
TAIR|locus:2091672 1054 AT3G14470 [Arabidopsis thalian 0.607 0.389 0.289 1.5e-39
TAIR|locus:2077572926 RPM1 "RESISTANCE TO P. SYRINGA 0.539 0.394 0.282 3.2e-37
UNIPROTKB|O48647 1802 O48647 "XA1" [Oryza sativa (ta 0.695 0.261 0.248 8.1e-31
TAIR|locus:2197739762 AT1G61300 [Arabidopsis thalian 0.579 0.514 0.269 1.4e-25
TAIR|locus:504956483847 AT3G46730 [Arabidopsis thalian 0.576 0.460 0.273 5.4e-24
TAIR|locus:2131689919 AT4G27220 [Arabidopsis thalian 0.607 0.447 0.274 6.9e-24
TAIR|locus:2036214851 AT1G15890 [Arabidopsis thalian 0.679 0.540 0.247 8.8e-24
TAIR|locus:2166320888 AT5G63020 [Arabidopsis thalian 0.586 0.447 0.264 3.1e-23
TAIR|locus:2091662 AT3G14460 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 503 (182.1 bits), Expect = 4.7e-51, Sum P(3) = 4.7e-51
 Identities = 157/517 (30%), Positives = 243/517 (47%)

Query:     1 MWVCVSDTFEEISVANAIIXXXXXXXXXXXXFQSLMSHIHRSIEGKKNFLILNDVWDGDY 60
             MW+     F   +V  A++              SL   + +++ GK+  L+L+D W    
Sbjct:   227 MWISAGINFNVFTVTKAVLQDITSSAVNTEDLPSLQIQLKKTLSGKRFLLVLDDFWSESD 286

Query:    61 NKWAPFFLCLNHGLHGSKILVTTRNELVARMMGSTNIIFIEQLTEEECWSLFKRLAFFGC 120
             ++W  F +       GSKI++TTR+E+V+ +  +  I  ++ +T EECW L  R AF   
Sbjct:   287 SEWESFQVAFTDAEEGSKIVLTTRSEIVSTVAKAEKIYQMKLMTNEECWELISRFAFGNI 346

Query:   121 SFEDC-ERLEPIGQKIARKCKGLPIAAKVIGNLLRSKSTIKDWQRILDSEMWKAEEIGKG 179
             S     + LE IG++IA +CKGLP+AA+ I + LRSK    DW  +  S+ + +      
Sbjct:   347 SVGSINQELEGIGKRIAEQCKGLPLAARAIASHLRSKPNPDDWYAV--SKNFSSYT---N 401

Query:   180 LLTPXXXXXXXXXXXXMVKRFFSYCAVFPKDYNMYKEELISLWMAQGYL-NAXXXXXXXX 238
              + P            + KR F+ C++FPK +   +EEL+ LWMA   L           
Sbjct:   402 SILPVLKLSYDSLPPQL-KRCFALCSIFPKGHVFDREELVLLWMAIDLLYQPRSSRRLED 460

Query:   239 XXXXCFNILAARSFFQEFEKNDDDDIMSCKMHDIVHDFAQFVSSKECLWLEINSTKE--S 296
                     L A+SFFQ      D  + S  MHD+++D A+ VS   C  LE ++  E  S
Sbjct:   461 IGNDYLGDLVAQSFFQRL----DITMTSFVMHDLMNDLAKAVSGDFCFRLEDDNIPEIPS 516

Query:   297 VIN--AFGGKVRHLGLKFKG--GASFPMSIHGLNR---LRTLLIDDE--SPPNSSLD--- 344
                  +F        + F+   GA F  +I   N    L +L + ++  +P  ++L    
Sbjct:   517 TTRHFSFSRSQCDASVAFRSICGAEFLRTILPFNSPTSLESLQLTEKVLNPLLNALSGLR 576

Query:   345 ----------KIPENVGKLMHLKYLNLSELHIERLPKTLCELYNLQKLDIRGCRNLRELP 394
                        +P+++  L  L+YL+LS   I+ LP+ +C L NLQ L +  CR+L  LP
Sbjct:   577 ILSLSHYQITNLPKSLKGLKLLRYLDLSSTKIKELPEFVCTLCNLQTLLLSNCRDLTSLP 636

Query:   395 TGIGKLKNMRSLLNGLTCSLKYMPIGISKLTSLRTLDKFAVGGGVDGGSTCRLECLKNFQ 454
               I +L N+R LL+ +   L  MP GI KL SL+ L  F +G  + G     L+ L + +
Sbjct:   637 KSIAELINLR-LLDLVGTPLVEMPPGIKKLRSLQKLSNFVIGR-LSGAGLHELKELSHLR 694

Query:   455 LIRKCGIEGLSNVSHLDEAERLELKNMENLLHLYL-W 490
                +  I  L NV+   EA+   LK    L  L L W
Sbjct:   695 GTLR--ISELQNVAFASEAKDAGLKRKPFLDGLILKW 729


GO:0005634 "nucleus" evidence=ISM
GO:0006952 "defense response" evidence=IEA;ISS
GO:0043531 "ADP binding" evidence=IEA
TAIR|locus:2078012 ZAR1 "HOPZ-ACTIVATED RESISTANCE 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2091672 AT3G14470 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2077572 RPM1 "RESISTANCE TO P. SYRINGAE PV MACULICOLA 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|O48647 O48647 "XA1" [Oryza sativa (taxid:4530)] Back     alignment and assigned GO terms
TAIR|locus:2197739 AT1G61300 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:504956483 AT3G46730 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2131689 AT4G27220 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2036214 AT1G15890 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2166320 AT5G63020 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
fgenesh4_pg.C_LG_XII001317
cc-nbs-lrr resistance protein (945 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query677
pfam00931285 pfam00931, NB-ARC, NB-ARC domain 1e-47
PRK10263 1355 PRK10263, PRK10263, DNA translocase FtsK; Provisio 5e-04
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 5e-04
PLN03210 1153 PLN03210, PLN03210, Resistant to P 0.004
>gnl|CDD|216202 pfam00931, NB-ARC, NB-ARC domain Back     alignment and domain information
 Score =  169 bits (430), Expect = 1e-47
 Identities = 87/236 (36%), Positives = 130/236 (55%), Gaps = 10/236 (4%)

Query: 1   MWVCVSDTFEEISVANAIIEGLGESTSSLSE--FQSLMSHIHRSIEGKKNFLILNDVWDG 58
            WV VS T+ E  +   I++ LG   S   E     L   I  ++  K+  L+L+DVW+ 
Sbjct: 53  AWVVVSKTYTEFRLQKDILQELGLDDSDWVEKNESELAVKIKEALLRKRFLLVLDDVWE- 111

Query: 59  DYNKWAPFFLCLNHGLHGSKILVTTRNELVARMMGSTN-IIFIEQLTEEECWSLFKRLAF 117
             N W    +    G +GS+++VTTR+E VA  MG T+    +E L  EE W LF    F
Sbjct: 112 -KNDWDKIGVPFPDGENGSRVIVTTRSESVAGRMGGTSKPHEVESLEPEESWELFSNKVF 170

Query: 118 FGCSFEDCERLEPIGQKIARKCKGLPIAAKVIGNLLRSKSTIKDWQRILDSEMWKAEEIG 177
                  C  LE + ++I  KCKGLP+A KV+G LL  KST+++W+ +L+    +     
Sbjct: 171 EK-ELPPCPELEEVAKEIVEKCKGLPLALKVLGGLLAFKSTVQEWEHVLEQLNNELAGRD 229

Query: 178 --KGLLTPLLLSYNDLSSNSMVKRFFSYCAVFPKDYNMYKEELISLWMAQGYLNAE 231
               +L+ L LSY++L     +KR F Y A+FP+DYN+ KE+LI LW+A+G++   
Sbjct: 230 GLNEVLSILSLSYDNL--PMHLKRCFLYLALFPEDYNIRKEQLIKLWIAEGFVIPS 283


Length = 285

>gnl|CDD|236669 PRK10263, PRK10263, DNA translocase FtsK; Provisional Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 677
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 100.0
PLN03210 1153 Resistant to P. syringae 6; Provisional 100.0
PF00931287 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is 99.97
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.87
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.86
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.81
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.77
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.77
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.76
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.72
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.66
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.64
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.55
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.55
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.48
KOG0617264 consensus Ras suppressor protein (contains leucine 99.47
KOG0617264 consensus Ras suppressor protein (contains leucine 99.44
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.42
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.4
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.39
KOG4237 498 consensus Extracellular matrix protein slit, conta 99.29
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 99.26
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.18
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.11
KOG4237 498 consensus Extracellular matrix protein slit, conta 99.08
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.07
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.69
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.68
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.63
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 98.62
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.6
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.5
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.5
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.49
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 98.47
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.42
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 98.35
PLN03150623 hypothetical protein; Provisional 98.33
PLN03150623 hypothetical protein; Provisional 98.32
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.27
KOG4341483 consensus F-box protein containing LRR [General fu 98.25
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.23
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.22
PRK15386426 type III secretion protein GogB; Provisional 98.19
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.19
PRK04841 903 transcriptional regulator MalT; Provisional 98.09
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.07
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.01
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 97.88
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 97.85
KOG4341483 consensus F-box protein containing LRR [General fu 97.85
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.59
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.55
PRK15386426 type III secretion protein GogB; Provisional 97.38
TIGR03015269 pepcterm_ATPase putative secretion ATPase, PEP-CTE 97.31
KOG2982418 consensus Uncharacterized conserved protein [Funct 97.27
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 97.24
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.17
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 97.15
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.12
COG2909 894 MalT ATP-dependent transcriptional regulator [Tran 96.95
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 96.79
KOG2982418 consensus Uncharacterized conserved protein [Funct 96.75
PRK00411394 cdc6 cell division control protein 6; Reviewed 96.69
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.35
PF05729166 NACHT: NACHT domain 96.27
PRK06893229 DNA replication initiation factor; Validated 96.25
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 96.24
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 96.24
KOG2123388 consensus Uncharacterized conserved protein [Funct 96.04
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 96.02
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.92
KOG1947482 consensus Leucine rich repeat proteins, some prote 95.86
KOG2123388 consensus Uncharacterized conserved protein [Funct 95.74
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 94.83
PF01637234 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 94.32
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 94.22
KOG1947482 consensus Leucine rich repeat proteins, some prote 94.02
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 93.23
TIGR03420226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Me 93.09
PF13401131 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S 93.03
PRK00080328 ruvB Holliday junction DNA helicase RuvB; Reviewed 92.83
TIGR00635305 ruvB Holliday junction DNA helicase, RuvB subunit. 92.39
TIGR02928365 orc1/cdc6 family replication initiation protein. M 92.37
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 91.99
KOG3864221 consensus Uncharacterized conserved protein [Funct 91.65
TIGR00678188 holB DNA polymerase III, delta' subunit. At positi 91.61
PRK09087226 hypothetical protein; Validated 91.56
PF13173128 AAA_14: AAA domain 91.18
PRK07471365 DNA polymerase III subunit delta'; Validated 91.08
PRK13342413 recombination factor protein RarA; Reviewed 91.06
KOG0473326 consensus Leucine-rich repeat protein [Function un 89.77
PRK08727233 hypothetical protein; Validated 89.22
PRK06645507 DNA polymerase III subunits gamma and tau; Validat 88.91
KOG0473326 consensus Leucine-rich repeat protein [Function un 88.01
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 87.84
PRK09112351 DNA polymerase III subunit delta'; Validated 87.79
PRK05564313 DNA polymerase III subunit delta'; Validated 87.72
smart0037026 LRR Leucine-rich repeats, outliers. 86.7
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 86.7
KOG3864221 consensus Uncharacterized conserved protein [Funct 86.63
PTZ001121164 origin recognition complex 1 protein; Provisional 86.02
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 85.96
PRK05707328 DNA polymerase III subunit delta'; Validated 84.95
PRK14086617 dnaA chromosomal replication initiation protein; P 84.08
PRK14087450 dnaA chromosomal replication initiation protein; P 84.06
PRK07940394 DNA polymerase III subunit delta'; Validated 83.35
PRK07003830 DNA polymerase III subunits gamma and tau; Validat 83.26
TIGR02903615 spore_lon_C ATP-dependent protease, Lon family. Me 82.65
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 82.1
smart0037026 LRR Leucine-rich repeats, outliers. 82.1
PRK06620214 hypothetical protein; Validated 82.03
PRK14963504 DNA polymerase III subunits gamma and tau; Provisi 81.99
PRK08084235 DNA replication initiation factor; Provisional 81.8
PRK12323700 DNA polymerase III subunits gamma and tau; Provisi 81.64
PRK08903227 DnaA regulatory inactivator Hda; Validated 81.41
PRK14959624 DNA polymerase III subunits gamma and tau; Provisi 81.06
PRK14961363 DNA polymerase III subunits gamma and tau; Provisi 80.84
PLN03025319 replication factor C subunit; Provisional 80.6
PRK12402337 replication factor C small subunit 2; Reviewed 80.3
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
Probab=100.00  E-value=1.7e-65  Score=576.99  Aligned_cols=536  Identities=29%  Similarity=0.409  Sum_probs=414.9

Q ss_pred             CeEEecCCCCHHHHHHHHHHHhcCCCCCCc--hHHHHHHHHHHHcCCccEEEEEECCcCCCccchhhhhhhhcCCCCCcE
Q 038430            1 MWVCVSDTFEEISVANAIIEGLGESTSSLS--EFQSLMSHIHRSIEGKKNFLILNDVWDGDYNKWAPFFLCLNHGLHGSK   78 (677)
Q Consensus         1 ~WV~vs~~~~~~~i~~~i~~~l~~~~~~~~--~~~~~~~~i~~~L~~kr~LlVlDdvw~~~~~~~~~l~~~~~~~~~gS~   78 (677)
                      |||+||+.|+...++++|++.++..+....  +.++.+..|.+.|++|||+|||||||+.  .+|+.+..++|...+|||
T Consensus       214 iWV~VSk~f~~~~iq~~Il~~l~~~~~~~~~~~~~~~~~~i~~~L~~krfllvLDDIW~~--~dw~~I~~~~p~~~~g~K  291 (889)
T KOG4658|consen  214 IWVVVSKEFTTRKIQQTILERLGLLDEEWEDKEEDELASKLLNLLEGKRFLLVLDDIWEE--VDWDKIGVPFPSRENGSK  291 (889)
T ss_pred             EEEEEcccccHHhHHHHHHHHhccCCcccchhhHHHHHHHHHHHhccCceEEEEeccccc--ccHHhcCCCCCCccCCeE
Confidence            799999999999999999999988665443  3578999999999999999999999998  679999999999989999


Q ss_pred             EEEEcCchHHHHh-cCCCCeEecCCCChHHHHHHHHHHhhcCCCCCCCcchhHHHHHHHHHhcCCchHHHHHHHHhccCC
Q 038430           79 ILVTTRNELVARM-MGSTNIIFIEQLTEEECWSLFKRLAFFGCSFEDCERLEPIGQKIARKCKGLPIAAKVIGNLLRSKS  157 (677)
Q Consensus        79 IiiTTR~~~v~~~-~~~~~~~~v~~L~~~ea~~LF~~~af~~~~~~~~~~~~~~~~~i~~~c~GlPLal~~ig~~L~~~~  157 (677)
                      |++|||++.|+.. +++...++|++|..+|||+||++.||...... ++.+.++|++|+++|+|+|||++++|+.|+.|.
T Consensus       292 vvlTTRs~~V~~~~m~~~~~~~v~~L~~~eaW~LF~~~v~~~~~~~-~~~i~~lak~v~~kC~GLPLAl~viG~~ma~K~  370 (889)
T KOG4658|consen  292 VVLTTRSEEVCGRAMGVDYPIEVECLTPEEAWDLFQKKVGPNTLGS-HPDIEELAKEVAEKCGGLPLALNVLGGLLACKK  370 (889)
T ss_pred             EEEEeccHhhhhccccCCccccccccCccccHHHHHHhhccccccc-cccHHHHHHHHHHHhCChHHHHHHHHHHhcCCC
Confidence            9999999999999 88888999999999999999999998765533 345999999999999999999999999999999


Q ss_pred             CHHHHHHHHhhhhhhhh----hcCCCccceeecccccCCCchhhhHHHhhhccCCCCceecHHHHHHHHHHcCCcCc-ch
Q 038430          158 TIKDWQRILDSEMWKAE----EIGKGLLTPLLLSYNDLSSNSMVKRFFSYCAVFPKDYNMYKEELISLWMAQGYLNA-EE  232 (677)
Q Consensus       158 ~~~~w~~~l~~~~~~~~----~~~~~i~~~l~~Sy~~L~~~~~~k~~fl~~a~fp~~~~i~~~~li~~wi~~g~i~~-~~  232 (677)
                      +.++|+++.+...+...    ...+.++.++++|||.|+.  ++|.||+|||+||+|+.|.++.++.+|+||||+.+ ..
T Consensus       371 t~~eW~~~~~~l~s~~~~~~~~~~~~i~~iLklSyd~L~~--~lK~CFLycalFPED~~I~~e~Li~yWiaEGfi~~~~~  448 (889)
T KOG4658|consen  371 TVQEWRRALNVLKSSLAADFSGMEESILPILKLSYDNLPE--ELKSCFLYCALFPEDYEIKKEKLIEYWIAEGFIDPLDG  448 (889)
T ss_pred             cHHHHHHHHccccccccCCCCchhhhhHHhhhccHhhhhH--HHHHHHHhhccCCcccccchHHHHHHHHhccCcCcccc
Confidence            99999999986544422    1246789999999999996  99999999999999999999999999999999988 33


Q ss_pred             hhhHHHhHHHHHHHHHHccCccccccCCCCCeeeEEeChhHHHHHHHHhc-----cccEEEEcC-CccccccccCCCceE
Q 038430          233 YEEKEMTGEECFNILAARSFFQEFEKNDDDDIMSCKMHDIVHDFAQFVSS-----KECLWLEIN-STKESVINAFGGKVR  306 (677)
Q Consensus       233 ~~~~~~~~~~~~~~L~~~sll~~~~~~~~~~~~~~~mhdli~d~~~~~~~-----~~~~~~~~~-~~~~~~~~~~~~~l~  306 (677)
                      +..++++|.+|+.+|++++++......  ++..+|+|||++|+||.+++.     .++.+.... +....+....+..+|
T Consensus       449 ~~~~~d~G~~~i~~LV~~~Ll~~~~~~--~~~~~~kmHDvvRe~al~ias~~~~~~e~~iv~~~~~~~~~~~~~~~~~~r  526 (889)
T KOG4658|consen  449 GETAEDVGYDYIEELVRASLLIEERDE--GRKETVKMHDVVREMALWIASDFGKQEENQIVSDGVGLSEIPQVKSWNSVR  526 (889)
T ss_pred             ccchhcchHHHHHHHHHHHHHhhcccc--cceeEEEeeHHHHHHHHHHhccccccccceEEECCcCccccccccchhhee
Confidence            667899999999999999999876654  667789999999999999999     555444432 233333334467899


Q ss_pred             EEEEEecCCCcccccccCCCcccEEEeCCCCCCCC-CCccCCcc-cCCCCCcCEEEecCcc-ccccchhhccCCCcCEEE
Q 038430          307 HLGLKFKGGASFPMSIHGLNRLRTLLIDDESPPNS-SLDKIPEN-VGKLMHLKYLNLSELH-IERLPKTLCELYNLQKLD  383 (677)
Q Consensus       307 ~L~l~~~~~~~~p~~~~~l~~L~~L~l~~~~l~~~-~~~~lp~~-~~~l~~L~~L~Ls~~~-i~~lp~~i~~l~~L~~L~  383 (677)
                      ++++.++.+..++.... ++.|++|.+..    +. .+..++.. |..|+.|++|||++|. +..+|.+|++|.+|++|+
T Consensus       527 r~s~~~~~~~~~~~~~~-~~~L~tLll~~----n~~~l~~is~~ff~~m~~LrVLDLs~~~~l~~LP~~I~~Li~LryL~  601 (889)
T KOG4658|consen  527 RMSLMNNKIEHIAGSSE-NPKLRTLLLQR----NSDWLLEISGEFFRSLPLLRVLDLSGNSSLSKLPSSIGELVHLRYLD  601 (889)
T ss_pred             EEEEeccchhhccCCCC-CCccceEEEee----cchhhhhcCHHHHhhCcceEEEECCCCCccCcCChHHhhhhhhhccc
Confidence            99999998877775443 44799988886    22 25555543 6789999999999877 778999999999999999


Q ss_pred             ecCCCCccccCcccccccccceeecCccCCCcccCCcCCCCCCCCccCceeeCCCcCCCCcccccccccCCcCCcccccC
Q 038430          384 IRGCRNLRELPTGIGKLKNMRSLLNGLTCSLKYMPIGISKLTSLRTLDKFAVGGGVDGGSTCRLECLKNFQLIRKCGIEG  463 (677)
Q Consensus       384 L~~~~~l~~lp~~i~~l~~L~~L~l~~~~~~~~~p~~i~~l~~L~~L~l~~~~~~~~~~~~~~~~~L~~l~~L~~L~i~~  463 (677)
                      ++++. +..+|.++++|++|.+|++..+.....+|..+..|++|++|.+.......   ....+.++.++.+|+.+.+..
T Consensus       602 L~~t~-I~~LP~~l~~Lk~L~~Lnl~~~~~l~~~~~i~~~L~~Lr~L~l~~s~~~~---~~~~l~el~~Le~L~~ls~~~  677 (889)
T KOG4658|consen  602 LSDTG-ISHLPSGLGNLKKLIYLNLEVTGRLESIPGILLELQSLRVLRLPRSALSN---DKLLLKELENLEHLENLSITI  677 (889)
T ss_pred             ccCCC-ccccchHHHHHHhhheeccccccccccccchhhhcccccEEEeecccccc---chhhHHhhhcccchhhheeec
Confidence            99887 88999999999999999999887766666656668899998887665111   145566666666666655543


Q ss_pred             ccC-----CC----------------ChhHHHHhhccCCcccCceEEEeecCCCCCcccccccccccCCCCCCCCCCCcc
Q 038430          464 LSN-----VS----------------HLDEAERLELKNMENLLHLYLWFEVVDREDEDWEDEEENEDEGGEDEDEDGGYK  522 (677)
Q Consensus       464 ~~~-----~~----------------~~~~~~~~~l~~~~~L~~L~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  522 (677)
                      .+.     +.                .........+..+.+|+.|.+..+..-.....|.                    
T Consensus       678 ~s~~~~e~l~~~~~L~~~~~~l~~~~~~~~~~~~~~~~l~~L~~L~i~~~~~~e~~~~~~--------------------  737 (889)
T KOG4658|consen  678 SSVLLLEDLLGMTRLRSLLQSLSIEGCSKRTLISSLGSLGNLEELSILDCGISEIVIEWE--------------------  737 (889)
T ss_pred             chhHhHhhhhhhHHHHHHhHhhhhcccccceeecccccccCcceEEEEcCCCchhhcccc--------------------
Confidence            221     00                0001122334556777777777662111000000                    


Q ss_pred             cccCCccccchhhhhhcchhhHHHHhhhcCCCCCCcEEEEecCCCCCCChhHhhccCCCeEEEeCCCCCCcCC
Q 038430          523 EEKGGKVVDGEYEERRRKNEKDEQLLEALQPPLNVEKLWILFNGGNILPKWLTSLTNLSDLKLVFCENCEQLP  595 (677)
Q Consensus       523 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~L~~L~l~~~~~~~lp~~~~~l~~L~~L~l~~c~~~~~l~  595 (677)
                                          .......   .++++.++.+.++.....+.|....++|+.|.+..|..++.+.
T Consensus       738 --------------------~~~~~~~---~f~~l~~~~~~~~~~~r~l~~~~f~~~L~~l~l~~~~~~e~~i  787 (889)
T KOG4658|consen  738 --------------------ESLIVLL---CFPNLSKVSILNCHMLRDLTWLLFAPHLTSLSLVSCRLLEDII  787 (889)
T ss_pred             --------------------cccchhh---hHHHHHHHHhhccccccccchhhccCcccEEEEecccccccCC
Confidence                                0000000   1345555555666666677777788888888888887665543



>PLN03210 Resistant to P Back     alignment and domain information
>PF00931 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is the NB-ARC domain, a novel signalling motif found in bacteria and eukaryotes, shared by plant resistance gene products and regulators of cell death in animals [] Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>COG2909 MalT ATP-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK00411 cdc6 cell division control protein 6; Reviewed Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PF05729 NACHT: NACHT domain Back     alignment and domain information
>PRK06893 DNA replication initiation factor; Validated Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PF01637 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 This domain has been found in a number of bacterial and archaeal proteins, all of which contain a conserved P-loop motif that is involved in binding ATP Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda Back     alignment and domain information
>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B Back     alignment and domain information
>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed Back     alignment and domain information
>TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit Back     alignment and domain information
>TIGR02928 orc1/cdc6 family replication initiation protein Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>TIGR00678 holB DNA polymerase III, delta' subunit Back     alignment and domain information
>PRK09087 hypothetical protein; Validated Back     alignment and domain information
>PF13173 AAA_14: AAA domain Back     alignment and domain information
>PRK07471 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK13342 recombination factor protein RarA; Reviewed Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PRK08727 hypothetical protein; Validated Back     alignment and domain information
>PRK06645 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PRK09112 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK05564 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PTZ00112 origin recognition complex 1 protein; Provisional Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PRK05707 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK14086 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK14087 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK07940 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK07003 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR02903 spore_lon_C ATP-dependent protease, Lon family Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>PRK06620 hypothetical protein; Validated Back     alignment and domain information
>PRK14963 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK08084 DNA replication initiation factor; Provisional Back     alignment and domain information
>PRK12323 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK08903 DnaA regulatory inactivator Hda; Validated Back     alignment and domain information
>PRK14959 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14961 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PLN03025 replication factor C subunit; Provisional Back     alignment and domain information
>PRK12402 replication factor C small subunit 2; Reviewed Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query677
4fcg_A328 Structure Of The Leucine-Rich Repeat Domain Of The 2e-04
>pdb|4FCG|A Chain A, Structure Of The Leucine-Rich Repeat Domain Of The Type Iii Effector Xcv3220 (Xopl) Length = 328 Back     alignment and structure

Iteration: 1

Score = 44.7 bits (104), Expect = 2e-04, Method: Compositional matrix adjust. Identities = 45/144 (31%), Positives = 63/144 (43%), Gaps = 30/144 (20%) Query: 317 SFPMSIHGLNRLRTLLID-----DESP-PNSSLDKIPENVGKLMHLKYLNLSELHIERLP 370 + P SI LNRLR L I E P P +S D E+ G L++L+ L L I LP Sbjct: 141 ALPASIASLNRLRELSIRACPELTELPEPLASTDASGEHQG-LVNLQSLRLEWTGIRSLP 199 Query: 371 KTLCELYNL-----------------------QKLDIRGCRNLRELPTGIGKLKNMRSLL 407 ++ L NL ++LD+RGC LR P G ++ L+ Sbjct: 200 ASIANLQNLKSLKIRNSPLSALGPAIHHLPKLEELDLRGCTALRNYPPIFGGRAPLKRLI 259 Query: 408 NGLTCSLKYMPIGISKLTSLRTLD 431 +L +P+ I +LT L LD Sbjct: 260 LKDCSNLLTLPLDIHRLTQLEKLD 283

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query677
1z6t_A591 APAF-1, apoptotic protease activating factor 1; ca 2e-69
2a5y_B549 CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis 7e-63
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 7e-34
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-10
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-06
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 4e-19
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-17
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-17
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-14
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 6e-17
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-15
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-13
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 4e-13
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 4e-11
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 5e-10
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-09
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 2e-07
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 3e-06
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-05
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 1e-10
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 3e-09
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 6e-07
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 3e-06
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 8e-05
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 3e-09
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 5e-09
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 2e-08
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 3e-08
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 4e-08
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-06
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 5e-06
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-08
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-05
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 8e-08
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 7e-07
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 3e-06
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 6e-06
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 8e-04
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 1e-07
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-07
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-06
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-05
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-04
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-07
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 8e-06
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 5e-05
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 2e-04
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-04
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 3e-04
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-07
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-05
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-07
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-04
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-07
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-06
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 4e-07
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 7e-06
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 8e-04
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 8e-07
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 9e-07
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 9e-07
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 6e-06
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-04
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 8e-04
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-06
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-06
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-05
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-04
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-06
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 3e-06
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 8e-05
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-04
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-06
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 1e-04
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 7e-04
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 3e-06
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 1e-05
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 1e-04
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 8e-06
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 2e-04
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 9e-06
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-05
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-05
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-04
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-04
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-05
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 7e-05
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-04
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-04
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-05
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-05
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-04
4fmz_A347 Internalin; leucine rich repeat, structural genomi 4e-04
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-05
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 7e-05
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 7e-05
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-04
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 4e-04
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 3e-05
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 4e-05
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 5e-05
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 8e-05
4ezg_A197 Putative uncharacterized protein; internalin-A, le 9e-05
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-04
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-04
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 4e-04
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 1e-04
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 8e-04
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-04
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-04
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 6e-04
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 1e-04
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-04
1o6v_A466 Internalin A; bacterial infection, extracellular r 7e-04
1o6v_A466 Internalin A; bacterial infection, extracellular r 9e-04
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-04
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 4e-04
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 4e-04
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 5e-04
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 5e-04
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 8e-04
>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Length = 591 Back     alignment and structure
 Score =  236 bits (604), Expect = 2e-69
 Identities = 62/411 (15%), Positives = 125/411 (30%), Gaps = 57/411 (13%)

Query: 1   MWVCVSDTF--EEISVANAIIEGLGESTSSLSE----FQSLMSHIHRSIEGKKN--FLIL 52
            WV V        +     +   L +  S         +     +   +  K     LIL
Sbjct: 183 HWVSVGKQDKSGLLMKLQNLCTRLDQDESFSQRLPLNIEEAKDRLRILMLRKHPRSLLIL 242

Query: 53  NDVWDGDYNKWAPFFLCLNHGLHGSKILVTTRNELVARMMGSTNIIF--IEQLTEEECWS 110
           +DVWD            L       +IL+TTR++ V   +     +      L +E+   
Sbjct: 243 DDVWDSWV---------LKAFDSQCQILLTTRDKSVTDSVMGPKYVVPVESSLGKEKGLE 293

Query: 111 LFKRLAFFGCSFEDCERLEPIGQKIARKCKGLPIAAKVIGNLLRSK-STIKDWQRILDSE 169
           +                L      I ++CKG P+   +IG LLR   +  + + + L ++
Sbjct: 294 ILSLFVN-----MKKADLPEQAHSIIKECKGSPLVVSLIGALLRDFPNRWEYYLKQLQNK 348

Query: 170 MWKAEEIGK-----GLLTPLLLSYNDLSSNSMVKRFFSYCAVFPKDYNMYKEELISLWMA 224
            +K            L   + +S   L  +  +K +++  ++  KD  +  + L  LW  
Sbjct: 349 QFKRIRKSSSYDYEALDEAMSISVEMLRED--IKDYYTDLSILQKDVKVPTKVLCILWDM 406

Query: 225 QGYLNAEEYEEKEMTGEECFNILAARSFFQEFEKNDDDDIMSCKMHDIVHDFAQFVSSKE 284
           +               E+       +S       + +       +HD+  DF      K 
Sbjct: 407 ETE-----------EVEDILQEFVNKSLLF---CDRNGKSFRYYLHDLQVDFLT---EKN 449

Query: 285 CLWLEINSTKESVINAFGGKVRHLGLKFKGGASFP-------MSIHGLNRLRTLLIDDES 337
           C  L+    K         +   L    +    +         S      L  L+   + 
Sbjct: 450 CSQLQDLHKKIITQFQRYHQPHTLSPDQEDCMYWYNFLAYHMASAKMHKELCALMFSLDW 509

Query: 338 PPNSSLDKIPENVGKLMHLKYLNLSELHIERLPKTLCELYNLQKLDIRGCR 388
               +    P ++     ++Y ++ +     + +   E  +L    +    
Sbjct: 510 IKAKTELVGPAHLIHEF-VEYRHILDEKDCAVSENFQEFLSLNGHLLGRQP 559


>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Length = 549 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Length = 1249 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query677
2a5y_B549 CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis 100.0
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 99.94
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 99.93
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.89
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.88
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.88
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.88
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.88
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 99.88
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.88
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.88
1z6t_A591 APAF-1, apoptotic protease activating factor 1; ca 99.87
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.87
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.86
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.86
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 99.86
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.86
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.86
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.86
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 99.85
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.85
1o6v_A 466 Internalin A; bacterial infection, extracellular r 99.85
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.84
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.84
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.84
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 99.84
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.84
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.84
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.84
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.83
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.83
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.83
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.82
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.82
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.82
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.82
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 99.82
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 99.82
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.82
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.82
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.82
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.81
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.81
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.81
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.81
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.8
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.79
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 99.78
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 99.78
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.78
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.77
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.77
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.76
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.76
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.76
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.74
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.74
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.73
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.73
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.72
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.72
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.72
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.7
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.7
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.69
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.69
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.68
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.67
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.66
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.65
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.65
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.64
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.64
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.63
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.63
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.62
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.62
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.62
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.61
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.61
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.61
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.59
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.59
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.59
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.59
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.58
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.58
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.58
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.57
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.57
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.54
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.53
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.52
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.51
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.5
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.49
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.49
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.44
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.44
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.43
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.43
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.42
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.42
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.41
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.4
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.38
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.38
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.36
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.35
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.35
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.32
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.31
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 99.31
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.31
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.3
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.3
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.3
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.29
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.29
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.28
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.27
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.26
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.24
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.24
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.2
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.19
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.19
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.16
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.15
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.14
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.13
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.08
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.07
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.06
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.05
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.04
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 98.98
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 98.96
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 98.95
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 98.88
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 98.86
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 98.86
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 98.82
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 98.81
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 98.55
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 98.53
4fdw_A401 Leucine rich hypothetical protein; putative cell s 98.48
4fdw_A401 Leucine rich hypothetical protein; putative cell s 98.32
1w5s_A412 Origin recognition complex subunit 2 ORC2; replica 98.25
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 98.22
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 98.15
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.02
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 97.91
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 97.9
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.87
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 97.71
2qen_A350 Walker-type ATPase; unknown function; HET: ADP; 2. 97.69
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.66
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 97.63
2fna_A357 Conserved hypothetical protein; structural genomic 97.59
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 97.51
2v1u_A387 Cell division control protein 6 homolog; DNA repli 97.48
4gt6_A394 Cell surface protein; leucine rich repeats, putati 97.44
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.41
2qby_B384 CDC6 homolog 3, cell division control protein 6 ho 97.32
1njg_A250 DNA polymerase III subunit gamma; rossman-like fol 97.27
1fnn_A389 CDC6P, cell division control protein 6; ORC1, AAA 97.27
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.24
4gt6_A394 Cell surface protein; leucine rich repeats, putati 96.99
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 96.71
2chg_A226 Replication factor C small subunit; DNA-binding pr 96.33
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 96.06
2qby_A386 CDC6 homolog 1, cell division control protein 6 ho 95.94
1sxj_B323 Activator 1 37 kDa subunit; clamp loader, processi 95.9
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 94.4
1hqc_A324 RUVB; extended AAA-ATPase domain, complex with nuc 93.84
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 93.66
1iqp_A327 RFCS; clamp loader, extended AAA-ATPase domain, co 93.19
1jr3_A373 DNA polymerase III subunit gamma; processivity, pr 91.22
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 90.9
2chq_A319 Replication factor C small subunit; DNA-binding pr 89.01
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 88.71
3bos_A242 Putative DNA replication factor; P-loop containing 88.23
2z4s_A440 Chromosomal replication initiator protein DNAA; AA 85.39
3te6_A318 Regulatory protein SIR3; heterochromatin, gene sil 83.54
1a5t_A334 Delta prime, HOLB; zinc finger, DNA replication; 2 82.68
1sxj_E354 Activator 1 40 kDa subunit; clamp loader, processi 82.6
>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Back     alignment and structure
Probab=100.00  E-value=7.6e-35  Score=322.43  Aligned_cols=261  Identities=17%  Similarity=0.251  Sum_probs=207.2

Q ss_pred             CeEEecCCC--CHHHHHHHHHHHhcCCCC-------CCchHHHHHHHHHHHcCCc-cEEEEEECCcCCCccchhhhhhhh
Q 038430            1 MWVCVSDTF--EEISVANAIIEGLGESTS-------SLSEFQSLMSHIHRSIEGK-KNFLILNDVWDGDYNKWAPFFLCL   70 (677)
Q Consensus         1 ~WV~vs~~~--~~~~i~~~i~~~l~~~~~-------~~~~~~~~~~~i~~~L~~k-r~LlVlDdvw~~~~~~~~~l~~~~   70 (677)
                      +||+|++.+  ++.+++++|+++++....       +..+.+.++..+++.|+++ ||||||||||+.++..|..     
T Consensus       188 ~wv~vs~~~~~~~~~~~~~il~~l~~~~~~~~~~~~~~~~~~~l~~~l~~~L~~~kr~LlVLDdv~~~~~~~~~~-----  262 (549)
T 2a5y_B          188 VWLKDSGTAPKSTFDLFTDILLMLKSEDDLLNFPSVEHVTSVVLKRMICNALIDRPNTLFVFDDVVQEETIRWAQ-----  262 (549)
T ss_dssp             EEEECCCCSTTHHHHHHHHHHHHHTTTSCCTTCCCCTTCCHHHHHHHHHHHHTTSTTEEEEEEEECCHHHHHHHH-----
T ss_pred             EEEEECCCCCCCHHHHHHHHHHHHhcCcccccccccccccHHHHHHHHHHHHcCCCcEEEEEECCCCchhhcccc-----
Confidence            599999985  899999999999987521       2235677889999999996 9999999999863222332     


Q ss_pred             cCCCCCcEEEEEcCchHHHHhcC-CCCeEecCCCChHHHHHHHHHHhhcCCCCCCCcchhHHHHHHHHHhcCCchHHHHH
Q 038430           71 NHGLHGSKILVTTRNELVARMMG-STNIIFIEQLTEEECWSLFKRLAFFGCSFEDCERLEPIGQKIARKCKGLPIAAKVI  149 (677)
Q Consensus        71 ~~~~~gS~IiiTTR~~~v~~~~~-~~~~~~v~~L~~~ea~~LF~~~af~~~~~~~~~~~~~~~~~i~~~c~GlPLal~~i  149 (677)
                         .+||+||||||++.++..++ ...+|+|++|+.+|||+||+++||+...   .+.+.+++++|+++|+|+||||+++
T Consensus       263 ---~~gs~ilvTTR~~~v~~~~~~~~~~~~l~~L~~~ea~~Lf~~~a~~~~~---~~~~~~~~~~I~~~c~GlPLAl~~~  336 (549)
T 2a5y_B          263 ---ELRLRCLVTTRDVEISNAASQTCEFIEVTSLEIDECYDFLEAYGMPMPV---GEKEEDVLNKTIELSSGNPATLMMF  336 (549)
T ss_dssp             ---HTTCEEEEEESBGGGGGGCCSCEEEEECCCCCHHHHHHHHHHTSCCCC-----CHHHHHHHHHHHHHTTCHHHHHHH
T ss_pred             ---cCCCEEEEEcCCHHHHHHcCCCCeEEECCCCCHHHHHHHHHHHhcCCCC---chhHHHHHHHHHHHhCCChHHHHHH
Confidence               16999999999999998876 4468999999999999999999986532   3678889999999999999999999


Q ss_pred             HHHhccCCCHHHHHHHHhhhhhhhhhcCCCccceeecccccCCCchhhhHHHh-----------hhccCCCCceecHHHH
Q 038430          150 GNLLRSKSTIKDWQRILDSEMWKAEEIGKGLLTPLLLSYNDLSSNSMVKRFFS-----------YCAVFPKDYNMYKEEL  218 (677)
Q Consensus       150 g~~L~~~~~~~~w~~~l~~~~~~~~~~~~~i~~~l~~Sy~~L~~~~~~k~~fl-----------~~a~fp~~~~i~~~~l  218 (677)
                      |+.|+.+ +++ |...+....+..  ....+..++.+||+.|+.  ++|.||+           |||+||+++.++    
T Consensus       337 g~~l~~~-~w~-~~~~l~~~l~~~--~~~~i~~~l~~Sy~~L~~--~lk~~f~~Ls~~er~l~~~ls~fp~~~~i~----  406 (549)
T 2a5y_B          337 FKSCEPK-TFE-KMAQLNNKLESR--GLVGVECITPYSYKSLAM--ALQRCVEVLSDEDRSALAFAVVMPPGVDIP----  406 (549)
T ss_dssp             HTTCCSS-SHH-HHHHHHHHHHHH--CSSTTCCCSSSSSSSHHH--HHHHHHHTSCHHHHHHTTGGGSSCTTCCEE----
T ss_pred             HHHhccc-hHH-HHHHhHHHhhcc--cHHHHHHHHhcccccccH--HHHHHHhccchhhhhHhhheeeeCCCCeee----
Confidence            9999776 332 223333322211  356799999999999998  9999999           999999999998    


Q ss_pred             HHHHHHc--CCcCcch-hhhHHHhHHHHHHHHHHccCccccccCCCCCeeeEEeChhHHHHHHHHhccccE
Q 038430          219 ISLWMAQ--GYLNAEE-YEEKEMTGEECFNILAARSFFQEFEKNDDDDIMSCKMHDIVHDFAQFVSSKECL  286 (677)
Q Consensus       219 i~~wi~~--g~i~~~~-~~~~~~~~~~~~~~L~~~sll~~~~~~~~~~~~~~~mhdli~d~~~~~~~~~~~  286 (677)
                      +.+|+++  ||+.... ..+.++.+. ++++|+++++++....+   ....|+|||+++++++.++..++.
T Consensus       407 i~~w~a~~~G~i~~~~~~~~~~~~~~-~l~~L~~rsLl~~~~~~---~~~~~~mHdlv~~~a~~~~~~~~~  473 (549)
T 2a5y_B          407 VKLWSCVIPVDICSNEEEQLDDEVAD-RLKRLSKRGALLSGKRM---PVLTFKIDHIIHMFLKHVVDAQTI  473 (549)
T ss_dssp             HHHHHHHSCC-------CCCTHHHHH-HHHHTTTBSSCSEEECS---SSCEEECCHHHHHHHHTTSCTHHH
T ss_pred             eeeeeeeccceeccCCCCCCHHHHHH-HHHHHHHcCCeeEecCC---CceEEEeChHHHHHHHHHHHHHHH
Confidence            8899999  9997665 444666676 99999999999987643   345799999999999988877654



>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>2qen_A Walker-type ATPase; unknown function; HET: ADP; 2.25A {Pyrococcus abyssi} Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>2fna_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE ADP; 2.00A {Sulfolobus solfataricus} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A Back     alignment and structure
>2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* Back     alignment and structure
>3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>1a5t_A Delta prime, HOLB; zinc finger, DNA replication; 2.20A {Escherichia coli K12} SCOP: a.80.1.1 c.37.1.20 PDB: 1jr3_E* 1xxh_E* 1xxi_E* 3glf_E* 3glg_E* 3glh_E* 3gli_E* Back     alignment and structure
>1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 677
d2a5yb3277 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenor 1e-24
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 4e-04
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 0.003
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 6e-04
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 0.001
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 0.002
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: CED-4, NB-ARC domain
species: Caenorhabditis elegans [TaxId: 6239]
 Score =  101 bits (253), Expect = 1e-24
 Identities = 30/214 (14%), Positives = 61/214 (28%), Gaps = 28/214 (13%)

Query: 1   MWVCVSDTFEEISVANAIIEGLGE----------STSSLSEFQSLMSHIHRSIEGKKNFL 50
           +W+  S T  + +        L            S   ++         +  I+      
Sbjct: 80  VWLKDSGTAPKSTFDLFTDILLMLKSEDDLLNFPSVEHVTSVVLKRMICNALIDRPNTLF 139

Query: 51  ILNDVWDGDYNKWAPFFLCLNHGLHGSKILVTTRNELVARMMGSTNIIF-IEQLTEEECW 109
           + +DV   +  +WA             + LVTTR+  ++     T     +  L  +EC+
Sbjct: 140 VFDDVVQEETIRWAQEL--------RLRCLVTTRDVEISNAASQTCEFIEVTSLEIDECY 191

Query: 110 SLFKRLAFFGCSFEDCERLEPIGQKIARKCKGLPIAAKVIGNLLRSKSTIKDWQRILDSE 169
              +         E  E    +  K      G P    +       K+    ++++    
Sbjct: 192 DFLEAYGMPMPVGEKEE---DVLNKTIELSSGNPATLMMFFKSCEPKT----FEKMAQLN 244

Query: 170 MWKAEEIGKGLLTPLLLSYNDLSSNSMVKRFFSY 203
                    G+      SY  L+    ++R    
Sbjct: 245 NKLESRGLVGVECITPYSYKSLAMA--LQRCVEV 276


>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query677
d2a5yb3277 CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI 99.94
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.8
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.73
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.73
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.7
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.67
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.65
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.64
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.55
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.53
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.52
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.5
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.5
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.47
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.46
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.44
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.39
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.35
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.35
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.32
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.31
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.28
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.28
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.2
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.19
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.17
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.09
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 98.96
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 98.91
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 98.9
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 98.86
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.75
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 98.64
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 98.6
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.58
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 98.57
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 98.27
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.29
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 96.98
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 95.89
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 95.28
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 94.31
d2fnaa2283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 93.49
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 92.88
d1a5ta2207 delta prime subunit of DNA polymerase III, N-domai 92.14
d1njfa_239 delta prime subunit of DNA polymerase III, N-domai 85.23
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: CED-4, NB-ARC domain
species: Caenorhabditis elegans [TaxId: 6239]
Probab=99.94  E-value=7.2e-27  Score=232.05  Aligned_cols=186  Identities=16%  Similarity=0.123  Sum_probs=148.1

Q ss_pred             CeEEecCCCCHHHHHHHHHHHh---cCCC-------CCCchHHHHHHHHHHHcCCccEEEEEECCcCCCccchhhhhhhh
Q 038430            1 MWVCVSDTFEEISVANAIIEGL---GEST-------SSLSEFQSLMSHIHRSIEGKKNFLILNDVWDGDYNKWAPFFLCL   70 (677)
Q Consensus         1 ~WV~vs~~~~~~~i~~~i~~~l---~~~~-------~~~~~~~~~~~~i~~~L~~kr~LlVlDdvw~~~~~~~~~l~~~~   70 (677)
                      +||+|++.++...+...+...+   +...       ....+.......+.+.+.++|+|+||||||+.  ..|..+.   
T Consensus        80 ~Wv~vs~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~L~~kr~LlVLDDv~~~--~~~~~~~---  154 (277)
T d2a5yb3          80 VWLKDSGTAPKSTFDLFTDILLMLKSEDDLLNFPSVEHVTSVVLKRMICNALIDRPNTLFVFDDVVQE--ETIRWAQ---  154 (277)
T ss_dssp             EEEECCCCSTTHHHHHHHHHHHHHTTTSCCTTCCCCTTCCHHHHHHHHHHHHTTSTTEEEEEEEECCH--HHHHHHH---
T ss_pred             EEEEecCCCCHHHHHHHHHHHHHHhcchhhcCCccchhhhhHHHHHHHHHHHhccCCeeEecchhhHH--hhhhhhc---
Confidence            5999999999888877765543   2221       12234555667788999999999999999987  4444332   


Q ss_pred             cCCCCCcEEEEEcCchHHHHhcCCC-CeEecCCCChHHHHHHHHHHhhcCCCCCCCcchhHHHHHHHHHhcCCchHHHHH
Q 038430           71 NHGLHGSKILVTTRNELVARMMGST-NIIFIEQLTEEECWSLFKRLAFFGCSFEDCERLEPIGQKIARKCKGLPIAAKVI  149 (677)
Q Consensus        71 ~~~~~gS~IiiTTR~~~v~~~~~~~-~~~~v~~L~~~ea~~LF~~~af~~~~~~~~~~~~~~~~~i~~~c~GlPLal~~i  149 (677)
                         ..|||||||||++.++..+... ..|+|++|+.+|||+||+++||....+   +..++++++|+++|+|+||||+++
T Consensus       155 ---~~~srilvTTR~~~v~~~~~~~~~~~~l~~L~~~ea~~Lf~~~~~~~~~~---~~~~~~~~~iv~~c~GlPLAl~~i  228 (277)
T d2a5yb3         155 ---ELRLRCLVTTRDVEISNAASQTCEFIEVTSLEIDECYDFLEAYGMPMPVG---EKEEDVLNKTIELSSGNPATLMMF  228 (277)
T ss_dssp             ---HTTCEEEEEESBGGGGGGCCSCEEEEECCCCCHHHHHHHHHHTSCCCC-----CHHHHHHHHHHHHHTTCHHHHHHH
T ss_pred             ---ccCceEEEEeehHHHHHhcCCCCceEECCCCCHHHHHHHHHHHhCCccCc---hhhHHHHHHHHHHhCCCHHHHHHH
Confidence               2489999999999999887654 689999999999999999999865442   456889999999999999999999


Q ss_pred             HHHhccCCCHHHHHHHHhhhhhhhhhcCCCccceeecccccCCCchhhhHHHhh
Q 038430          150 GNLLRSKSTIKDWQRILDSEMWKAEEIGKGLLTPLLLSYNDLSSNSMVKRFFSY  203 (677)
Q Consensus       150 g~~L~~~~~~~~w~~~l~~~~~~~~~~~~~i~~~l~~Sy~~L~~~~~~k~~fl~  203 (677)
                      |+.|+.+ +.+.|.+..+...   .....++..++..||+.||+  ++|.||.+
T Consensus       229 g~~l~~k-~~~~~~~~~~~L~---~~~~~~v~~il~~sY~~L~~--~lk~c~~~  276 (277)
T d2a5yb3         229 FKSCEPK-TFEKMAQLNNKLE---SRGLVGVECITPYSYKSLAM--ALQRCVEV  276 (277)
T ss_dssp             HTTCCSS-SHHHHHHHHHHHH---HHCSSTTCCCSSSSSSSHHH--HHHHHHHT
T ss_pred             HHHhccC-CHHHHHHHHHHHh---cCcHHHHHHHHHHHHhcccH--HHHHHHHh
Confidence            9999877 5888888766422   23457899999999999999  99999975



>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure