Citrus Sinensis ID: 038454


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------36
MKNLERVLQEFNSQKEDIEATLKAEGDRGKKPRTEVKNWLQNVQRINSKAQSIEQEVKKRKYFLCARLGKDVDAKIQEMKDCHQKGCSFISLVIDAPPSSGLILPTTTLVGENTKKIVKKVWEDLMGDKVTKIGVWGMGGFGKTAIMRHINNRPQEETNEFSDVIWVTVSQPLDLVKLQAEIAMALKLSLTEDEDKVSRARRLLGKLKAKKKFVLILDDIDNHTFCWGLRSMGCEEVRVPPLSKEEALNLFLDKVGRNILHVPTLNEEIINSVVEECAGLQLAIFTVVGCMRGVDEIHEWRNALNELRGLVRSFSGINADVLGRLEFSYLRLKDKKVQHCFLYCALYPEDFAISKDELI
cccHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHccccccccEEcccccccccccccccccccHHHHHHHHHHHHccccccEEEEEccccccHHHHHHHHHccccccccccccEEEEEEcccccHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHccccEEEEEccccccccHHHHHcccccEEEcccccHHHHHHHHHHHHccccccccccHHHHHHHHHHHccccHHHHHHHHHHHcccccHHHHHHHHHHHHHcccccccccccHHHHHHcccccccccHHHHHHcccccccccccccccccc
cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccEEEccccccccEEcccccEEccccHHHHHHHHHHccccccEEEEEEccccccHHHHHHHHHccHHHccccccEEEEEEEcccccHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHccccEEEEEEcccccEEEEEEccccccEEEEEcccHHHHHHHHHHHHccccccccccHHHHHHHHHHHHcccHHHHHHHHHHHHccccHHHHHHHHHHHHccHHccccccccccHHHEEcHcccccHHHHHHHHHHHccccccEEEHHHcc
MKNLERVLQEFNSQKEDIEATLKAegdrgkkprtEVKNWLQNVQRINSKAQSIEQEVKKRKYFLCARLGKDVDAKIQEMKDCHQKGCSFIslvidappssglilptttlvgENTKKIVKKVWEDLMGdkvtkigvwgmggfgkTAIMRHInnrpqeetnefSDVIWVTVSQPLDLVKLQAEIAMALKLSLTEDEDKVSRARRLLGKLKAKKKFVLILDDIdnhtfcwglrsmgceevrvpplskEEALNLFLDKvgrnilhvptlneEIINSVVEECAGLQLAIFTVVGCMRGVDEIHEWRNALNELRGLvrsfsginaDVLGRLEFSYLRLKDKKVQHCFLYCALypedfaiskdeli
MKNLERVLQefnsqkedieatlkaegdrgkkprtevknwlqnvqRINSKAQSIEQEVKKRKYFLCARLGKDVDAKIQEMKDCHQKGCSFISLVIDAPPSSGLIlptttlvgentKKIVKKVWEDLMGDKVTKIGVWGMGGFGKTAIMRHINNRPQEETNEFSDVIWVTVSQPLDLVKLQAEIAMALklsltededkvSRARRllgklkakkkfvliLDDIDNHTFCWGLRSMGCEEVRVPPLSKEEALNLFLDKVGRNILHVPTLNEEIINSVVEECAGLQLAIFTVVGCMRGVDEIHEWRNALNELRGLVRSFSGINADVLGRLEFSYLRLKDKKVQHCFLYCALYpedfaiskdeli
MKNLERVLQEFNSQKEDIEATLKAEGDRGKKPRTEVKNWLQNVQRINSKAQSIEQEVKKRKYFLCARLGKDVDAKIQEMKDCHQKGCSFISLVIDAPPSSGLILPTTTLVGENTKKIVKKVWEDLMGDKVTKIGVWGMGGFGKTAIMRHINNRPQEETNEFSDVIWVTVSQPLDLVKLQAEIAMALKLSLTEDEDKVSRARRllgklkakkkfvlilDDIDNHTFCWGLRSMGCEEVRVPPLSKEEALNLFLDKVGRNILHVPTLNEEIINSVVEECAGLQLAIFTVVGCMRGVDEIHEWRNALNELRGLVRSFSGINADVLGRLEFSYLRLKDKKVQHCFLYCALYPEDFAISKDELI
**************************************WL****************VKKRKYFLCARLGKDVDAKIQEMKDCHQKGCSFISLVIDAPPSSGLILPTTTLVGENTKKIVKKVWEDLMGDKVTKIGVWGMGGFGKTAIMRHINNR***ETNEFSDVIWVTVSQPLDLVKLQAEIAMALKLSLTEDEDKVSRARRLLGKLKAKKKFVLILDDIDNHTFCWGLRSMGCEEVRVPPLSKEEALNLFLDKVGRNILHVPTLNEEIINSVVEECAGLQLAIFTVVGCMRGVDEIHEWRNALNELRGLVRSFSGINADVLGRLEFSYLRLKDKKVQHCFLYCALYPEDFAI******
MKNLERVLQEFNSQKEDIEATLKAEGDRGKKPRTEVKNWLQNVQRINSKAQSIEQEVKKRKYFLCARLGKDVDAKI***********************************ENTKKIVKKVWEDLMGDKVTKIGVWGMGGFGKTAIMRHINNRPQEETNEFSDVIWVTVSQPLDLVKLQAEIAMALKL******************LKAKKKFVLILDDIDNHTFCWGLRSMGCEEVRVPPLSKEEALNLFLDKVGRNILHVPTLNEEIINSVVEECAGLQLAIFTVVGCMRGVDEIHEWRNALNELRGL*****GINADVLGRLEFSYLRLKDKKVQHCFLYCALYPEDFAISKDELI
MKNLERVLQEFNSQKEDIEATLKAEGDRGKKPRTEVKNWLQNVQRINSKAQSIEQEVKKRKYFLCARLGKDVDAKIQEMKDCHQKGCSFISLVIDAPPSSGLILPTTTLVGENTKKIVKKVWEDLMGDKVTKIGVWGMGGFGKTAIMRHINNRPQEETNEFSDVIWVTVSQPLDLVKLQAEIAMALKLSLTEDEDKVSRARRLLGKLKAKKKFVLILDDIDNHTFCWGLRSMGCEEVRVPPLSKEEALNLFLDKVGRNILHVPTLNEEIINSVVEECAGLQLAIFTVVGCMRGVDEIHEWRNALNELRGLVRSFSGINADVLGRLEFSYLRLKDKKVQHCFLYCALYPEDFAISKDELI
MKNLERVLQEFNSQKEDIEATLKAEGDRGKKPRTEVKNWLQNVQRINSKAQSIEQEVKKRKYFLCARLGKDVDAKIQEMKDCHQKGCSFISLVIDAPPSSGLILPTTTLVGENTKKIVKKVWEDLMGDKVTKIGVWGMGGFGKTAIMRHINNRPQEETNEFSDVIWVTVSQPLDLVKLQAEIAMALKLSLTEDEDKVSRARRLLGKLKAKKKFVLILDDIDNHTFCWGLRSMGCEEVRVPPLSKEEALNLFLDKVGRNILHVPTLNEEIINSVVEECAGLQLAIFTVVGCMRGVDEIHEWRNALNELRGLVRSFSGINADVLGRLEFSYLRLKDKKVQHCFLYCALYPEDFAISKDEL*
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxGKKPRTExxxxxxxxxxxxxxxxxxxxxVKKRKYFLCARLGKDVDAKIQEMKDCHQKGCSFISLVIDAPPSSGLILPTTTLVGENTKKIVKKVWEDLMGDKVTKIGVWGMGGFGKTAIMRHINNRPQEETNEFSDVIWVTVSQPLDLVKLQAEIAMALKLSxxxxxxxxxxxxxxxxxxxxxKKFVLILDDIDNHTFCWGLRSMGCEEVRVPPLSKEEALNLFLDKVGRNILHVPTLNEEIINSVVEECAGLQLAIFTVVGCMRGVDEIHEWRNALNELRGLVRSFSGINADVLGRLEFSYLRLKDKKVQHCFLYCALYPEDFAISKDELI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query359 2.2.26 [Sep-21-2011]
Q9C8T9 898 Putative disease resistan yes no 0.972 0.388 0.307 2e-36
Q9FG91 848 Probable disease resistan no no 0.980 0.415 0.290 5e-35
Q9LMP6 851 Probable disease resistan no no 0.941 0.397 0.309 7e-35
O82484 892 Putative disease resistan no no 0.974 0.392 0.296 1e-34
Q9T048 985 Disease resistance protei no no 0.972 0.354 0.306 2e-34
Q8RXS5 888 Probable disease resistan no no 0.974 0.394 0.286 6e-34
P60838 894 Probable disease resistan no no 0.919 0.369 0.304 7e-34
O64973 889 Disease resistance protei no no 0.988 0.399 0.290 2e-33
Q9FG90 862 Probable disease resistan no no 0.977 0.407 0.277 2e-33
O64789 925 Probable disease resistan no no 0.988 0.383 0.294 4e-33
>sp|Q9C8T9|DRL19_ARATH Putative disease resistance protein At1g63350 OS=Arabidopsis thaliana GN=At1g63350 PE=2 SV=1 Back     alignment and function desciption
 Score =  153 bits (386), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 122/397 (30%), Positives = 194/397 (48%), Gaps = 48/397 (12%)

Query: 4   LERVLQEFNSQKEDIEATLKAEGDRGKKPRTEVKNWLQNVQRINSKAQSI--EQEVKKRK 61
           LE  ++E  ++++D+   LK E DRG +   E+K WL  V+ I S+   +   +  + ++
Sbjct: 37  LETTMEELKAKRDDLLRKLKREEDRGLQTLGEIKVWLNRVETIESRVNDLLNARNAELQR 96

Query: 62  YFLCA----------RLGKDVDAKIQEMKDCHQKGCSFISLVIDAPPSSGL----ILPTT 107
             LC           R GK V  K++E++   ++    IS   D   +S +    + PT 
Sbjct: 97  LCLCGFCSKSLTTSYRYGKSVFLKLREVEKLERRVFEVIS---DQASTSEVEEQQLQPT- 152

Query: 108 TLVGENTKKIVKKVWEDLMGDKVTKIGVWGMGGFGKTAIMRHINNRPQEETNEFSDVIWV 167
            +VG+ T  ++   W  LM D V  +G++GMGG GKT ++  INN+  +    F  VIWV
Sbjct: 153 -IVGQET--MLDNAWNHLMEDGVGIMGLYGMGGVGKTTLLTQINNKFSKYMCGFDSVIWV 209

Query: 168 TVSQPLDLVKLQAEIAMALKLSLTEDEDKVSRARRL-LGKLKAKKKFVLILDDI------ 220
            VS+ +++  +  EIA  + +S  + + K    + + L     K +FVL LDDI      
Sbjct: 210 VVSKEVNVENILDEIAQKVHISGEKWDTKYKYQKGVYLYNFLRKMRFVLFLDDIWEKVNL 269

Query: 221 -----------DNHTFCWGLR------SMGCEE-VRVPPLSKEEALNLFLDKVGRNILHV 262
                      +     +  R      SMG E+ + V  L+  +A +LF  KVG+  L  
Sbjct: 270 VEIGVPFPTIKNKCKVVFTTRSLDVCTSMGVEKPMEVQCLADNDAYDLFQKKVGQITLGS 329

Query: 263 PTLNEEIINSVVEECAGLQLAIFTVVGCMRGVDEIHEWRNALNELRGLVRSFSGINADVL 322
                E+   V ++C GL LA+  V   M     + EWR+A+  L      FSG++  +L
Sbjct: 330 DPEIRELSRVVAKKCCGLPLALNVVSETMSCKRTVQEWRHAIYVLNSYAAKFSGMDDKIL 389

Query: 323 GRLEFSYLRLKDKKVQHCFLYCALYPEDFAISKDELI 359
             L++SY  LK + V+ C LYCAL+PED  I K+ LI
Sbjct: 390 PLLKYSYDSLKGEDVKMCLLYCALFPEDAKIRKENLI 426




Potential disease resistance protein.
Arabidopsis thaliana (taxid: 3702)
>sp|Q9FG91|DRL32_ARATH Probable disease resistance protein At5g43730 OS=Arabidopsis thaliana GN=At5g43730 PE=2 SV=1 Back     alignment and function description
>sp|Q9LMP6|DRL3_ARATH Probable disease resistance protein At1g15890 OS=Arabidopsis thaliana GN=At1g15890 PE=3 SV=2 Back     alignment and function description
>sp|O82484|DRL23_ARATH Putative disease resistance protein At4g10780 OS=Arabidopsis thaliana GN=At4g10780 PE=2 SV=1 Back     alignment and function description
>sp|Q9T048|DRL27_ARATH Disease resistance protein At4g27190 OS=Arabidopsis thaliana GN=At4g27190 PE=2 SV=1 Back     alignment and function description
>sp|Q8RXS5|DRL40_ARATH Probable disease resistance protein At5g63020 OS=Arabidopsis thaliana GN=At5g63020 PE=2 SV=2 Back     alignment and function description
>sp|P60838|DRL1_ARATH Probable disease resistance protein At1g12280 OS=Arabidopsis thaliana GN=At1g12280 PE=3 SV=1 Back     alignment and function description
>sp|O64973|RPS5_ARATH Disease resistance protein RPS5 OS=Arabidopsis thaliana GN=RPS5 PE=1 SV=2 Back     alignment and function description
>sp|Q9FG90|DRL33_ARATH Probable disease resistance protein At5g43740 OS=Arabidopsis thaliana GN=At5g43740 PE=2 SV=1 Back     alignment and function description
>sp|O64789|DRL18_ARATH Probable disease resistance protein At1g61310 OS=Arabidopsis thaliana GN=At1g61310 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query359
356542242 962 PREDICTED: probable disease resistance p 0.980 0.365 0.393 1e-56
302142868 984 unnamed protein product [Vitis vinifera] 0.988 0.360 0.380 3e-54
225461744 1016 PREDICTED: probable disease resistance p 0.988 0.349 0.380 4e-54
359493997 1276 PREDICTED: probable disease resistance p 0.952 0.268 0.386 4e-54
224128424 954 BED finger-nbs-lrr resistance protein [P 0.807 0.303 0.390 1e-51
15487932246 NBS/LRR resistance protein-like protein 0.601 0.878 0.442 5e-49
224117250 958 nbs-lrr resistance protein [Populus tric 0.754 0.282 0.394 1e-48
15487942250 NBS/LRR resistance protein-like protein 0.601 0.864 0.442 1e-48
15487936243 NBS/LRR resistance protein-like protein 0.601 0.888 0.442 1e-48
15487940250 NBS/LRR resistance protein-like protein 0.596 0.856 0.442 3e-48
>gi|356542242|ref|XP_003539578.1| PREDICTED: probable disease resistance protein At4g27220-like [Glycine max] Back     alignment and taxonomy information
 Score =  226 bits (576), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 150/381 (39%), Positives = 205/381 (53%), Gaps = 29/381 (7%)

Query: 4   LERVLQEFNSQKEDIEATLK-AEGDRGKKPRTEVKNWLQNVQRINSKAQSIEQEVKKRKY 62
           LE  L+E  S + DI   L+ AE  +GKK + EV+NW +NVQR   +   I QE++    
Sbjct: 36  LEMKLEELCSLEYDINKELEIAELQQGKKRKREVENWQRNVQRKKIEVYGIVQELRDCGV 95

Query: 63  FLCARLGKDVDAKIQEMKDCHQKGCSFISLVIDAPPSSGLILPTTTLVGENTKKIVKKVW 122
           F   +L   V   I ++ D  + G     +V  A  S G  L TT L G   +K V K+W
Sbjct: 96  FKHLKLTAQVKKLIGQVTDLVECGRFPKGIVGCAHESRGYALLTTKLAGAMFQKNVAKIW 155

Query: 123 EDLMGDKVTKIGVWGMGGFGKTAIMRHINNRPQEETNEFSDVIWVTVSQPLDLVKLQAEI 182
           + LM D    IGV+GMGG GKT+++ HI+N        F  V WVT+SQ   + KLQ ++
Sbjct: 156 DWLMNDGELIIGVYGMGGVGKTSMLMHIHNMLLTRVTNFDSVFWVTLSQSFSIHKLQCDV 215

Query: 183 AMALKLSLTEDEDKVSRARRLLGKLKAKKKFVLILDDIDNH------------------- 223
           A  + L ++++ D+  RA RL   L  +K+ VL LDD+ ++                   
Sbjct: 216 AKIVGLDISKESDERKRAARLSWTLMRRKRCVLFLDDVWSYFPLEKVGIPVREGLKLVLT 275

Query: 224 ----TFCWGLRSMGCE-EVRVPPLSKEEALNLFLDKVGRNILHVPTLNEEIINSVVEECA 278
                 C   R M C+  V+V PL+KEEA  LFLD +G+     P +  ++  SV +ECA
Sbjct: 276 SRSLEVC---RRMNCQNNVKVEPLAKEEAWTLFLDNLGQQTTLSPEVT-KVARSVAKECA 331

Query: 279 GLQLAIFTVVGCMRGVDEIHEWRNALNELRGLVRSFSGINADVLGRLEFSYLRLKDKKVQ 338
           GL LAI T+   MRGV+EI EWR+AL ELR        +  +VL  L+FSY  L D  +Q
Sbjct: 332 GLPLAIITMARSMRGVEEICEWRHALEELRNTEIRLEEMEMEVLRVLQFSYDHLNDNMLQ 391

Query: 339 HCFLYCALYPEDFAISKDELI 359
            CFL CALYPEDF I +D LI
Sbjct: 392 KCFLCCALYPEDFEIDRDVLI 412




Source: Glycine max

Species: Glycine max

Genus: Glycine

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|302142868|emb|CBI20163.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|225461744|ref|XP_002283414.1| PREDICTED: probable disease resistance protein At4g27220-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|359493997|ref|XP_002283439.2| PREDICTED: probable disease resistance protein At4g27220-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|224128424|ref|XP_002329158.1| BED finger-nbs-lrr resistance protein [Populus trichocarpa] gi|222869827|gb|EEF06958.1| BED finger-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|15487932|gb|AAL01012.1|AF402744_1 NBS/LRR resistance protein-like protein [Theobroma cacao] gi|15487938|gb|AAL01015.1|AF402747_1 NBS/LRR resistance protein-like protein [Theobroma cacao] Back     alignment and taxonomy information
>gi|224117250|ref|XP_002317519.1| nbs-lrr resistance protein [Populus trichocarpa] gi|222860584|gb|EEE98131.1| nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|15487942|gb|AAL01017.1|AF402749_1 NBS/LRR resistance protein-like protein [Theobroma cacao] Back     alignment and taxonomy information
>gi|15487936|gb|AAL01014.1|AF402746_1 NBS/LRR resistance protein-like protein [Theobroma cacao] Back     alignment and taxonomy information
>gi|15487940|gb|AAL01016.1|AF402748_1 NBS/LRR resistance protein-like protein [Theobroma cacao] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query359
TAIR|locus:2031366 898 AT1G63350 "AT1G63350" [Arabido 0.506 0.202 0.296 1.7e-32
TAIR|locus:2036214 851 AT1G15890 [Arabidopsis thalian 0.334 0.141 0.390 9.1e-31
TAIR|locus:2203881 893 AT1G62630 [Arabidopsis thalian 0.504 0.202 0.308 9.1e-31
TAIR|locus:2136447 985 AT4G27190 [Arabidopsis thalian 0.537 0.195 0.292 3.8e-30
TAIR|locus:2170892 848 AT5G43730 [Arabidopsis thalian 0.348 0.147 0.384 1e-29
TAIR|locus:2132741 892 AT4G10780 [Arabidopsis thalian 0.350 0.141 0.396 1.2e-29
TAIR|locus:2201996 889 RPS5 "AT1G12220" [Arabidopsis 0.350 0.141 0.358 2.1e-29
TAIR|locus:2166320 888 AT5G63020 [Arabidopsis thalian 0.487 0.197 0.286 2.2e-29
TAIR|locus:2034770 894 SUMM2 "AT1G12280" [Arabidopsis 0.543 0.218 0.262 3.5e-29
TAIR|locus:2008510 967 AT1G61190 "AT1G61190" [Arabido 0.520 0.193 0.296 1.5e-28
TAIR|locus:2031366 AT1G63350 "AT1G63350" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 219 (82.2 bits), Expect = 1.7e-32, Sum P(2) = 1.7e-32
 Identities = 59/199 (29%), Positives = 101/199 (50%)

Query:     4 LERVLQEFNSQKEDIEATLKAEGDRGKKPRTEVKNWLQNVQRINSKAQSI--EQEVKKRK 61
             LE  ++E  ++++D+   LK E DRG +   E+K WL  V+ I S+   +   +  + ++
Sbjct:    37 LETTMEELKAKRDDLLRKLKREEDRGLQTLGEIKVWLNRVETIESRVNDLLNARNAELQR 96

Query:    62 YFLCA----------RLGKDVDAKIQEMKDCHQKGCSFIS-LVIDAPPSSGLILPTTTLV 110
               LC           R GK V  K++E++   ++    IS     +      + PT  +V
Sbjct:    97 LCLCGFCSKSLTTSYRYGKSVFLKLREVEKLERRVFEVISDQASTSEVEEQQLQPT--IV 154

Query:   111 GENTKKIVKKVWEDLMGDKVTKIGVWGMGGFGKTAIMRHINNRPQEETNEFSDVIWVTVS 170
             G+ T  ++   W  LM D V  +G++GMGG GKT ++  INN+  +    F  VIWV VS
Sbjct:   155 GQET--MLDNAWNHLMEDGVGIMGLYGMGGVGKTTLLTQINNKFSKYMCGFDSVIWVVVS 212

Query:   171 QPLDLVKLQAEIAMALKLS 189
             + +++  +  EIA  + +S
Sbjct:   213 KEVNVENILDEIAQKVHIS 231


GO:0005575 "cellular_component" evidence=ND
GO:0006952 "defense response" evidence=IEA;ISS
GO:0043531 "ADP binding" evidence=IEA
TAIR|locus:2036214 AT1G15890 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2203881 AT1G62630 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2136447 AT4G27190 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2170892 AT5G43730 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2132741 AT4G10780 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2201996 RPS5 "AT1G12220" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2166320 AT5G63020 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2034770 SUMM2 "AT1G12280" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2008510 AT1G61190 "AT1G61190" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
GSVIVG00027864001
SubName- Full=Chromosome chr19 scaffold_4, whole genome shotgun sequence; (1025 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query359
pfam00931285 pfam00931, NB-ARC, NB-ARC domain 1e-37
pfam13401124 pfam13401, AAA_22, AAA domain 3e-05
>gnl|CDD|216202 pfam00931, NB-ARC, NB-ARC domain Back     alignment and domain information
 Score =  136 bits (344), Expect = 1e-37
 Identities = 78/274 (28%), Positives = 123/274 (44%), Gaps = 33/274 (12%)

Query: 115 KKIVKKVWEDLMGDK--VTKIGVWGMGGFGKTAIMRHINNRPQEETNEFSDVIWVTVSQP 172
           + +++ + E L+     +  +G+ GMGG GKT + + I N      + F  V WV VS+ 
Sbjct: 2   EDMIEALIEKLLEMSDNLGVVGIVGMGGVGKTTLAKQIYNDDSVGGH-FDSVAWVVVSKT 60

Query: 173 LDLVKLQAEIAMALKLSLTE-DEDKVSRARRLLGKLKAKKKFVLILDDIDNHTFCWGL-- 229
               +LQ +I   L L  ++  E   S     + +   +K+F+L+LDD+      W    
Sbjct: 61  YTEFRLQKDILQELGLDDSDWVEKNESELAVKIKEALLRKRFLLVLDDVWE-KNDWDKIG 119

Query: 230 ----------------RSM--------GCEEVRVPPLSKEEALNLFLDKVGRNILHVPTL 265
                           RS           +   V  L  EE+  LF +KV    L     
Sbjct: 120 VPFPDGENGSRVIVTTRSESVAGRMGGTSKPHEVESLEPEESWELFSNKVFEKELPPCPE 179

Query: 266 NEEIINSVVEECAGLQLAIFTVVGCMRGVDEIHEWRNALNELRGLVRSFSGINADVLGRL 325
            EE+   +VE+C GL LA+  + G +     + EW + L +L   +    G+N +VL  L
Sbjct: 180 LEEVAKEIVEKCKGLPLALKVLGGLLAFKSTVQEWEHVLEQLNNELAGRDGLN-EVLSIL 238

Query: 326 EFSYLRLKDKKVQHCFLYCALYPEDFAISKDELI 359
             SY  L    ++ CFLY AL+PED+ I K++LI
Sbjct: 239 SLSYDNLPM-HLKRCFLYLALFPEDYNIRKEQLI 271


Length = 285

>gnl|CDD|222104 pfam13401, AAA_22, AAA domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 359
KOG4658 889 consensus Apoptotic ATPase [Signal transduction me 100.0
PF00931287 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is 100.0
PLN03210 1153 Resistant to P. syringae 6; Provisional 100.0
PRK04841 903 transcriptional regulator MalT; Provisional 99.48
TIGR03015269 pepcterm_ATPase putative secretion ATPase, PEP-CTE 99.39
PRK00411394 cdc6 cell division control protein 6; Reviewed 99.36
PF01637234 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 99.35
TIGR02928365 orc1/cdc6 family replication initiation protein. M 99.31
COG2909 894 MalT ATP-dependent transcriptional regulator [Tran 99.23
PF05729166 NACHT: NACHT domain 99.15
TIGR00635305 ruvB Holliday junction DNA helicase, RuvB subunit. 99.05
PRK00080328 ruvB Holliday junction DNA helicase RuvB; Reviewed 99.04
PRK13342 413 recombination factor protein RarA; Reviewed 98.97
COG2256 436 MGS1 ATPase related to the helicase subunit of the 98.93
PRK06893229 DNA replication initiation factor; Validated 98.93
COG3903 414 Predicted ATPase [General function prediction only 98.89
TIGR03420226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Me 98.85
COG1474366 CDC6 Cdc6-related protein, AAA superfamily ATPase 98.85
PF13401131 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S 98.84
PTZ00112 1164 origin recognition complex 1 protein; Provisional 98.77
PRK08727233 hypothetical protein; Validated 98.76
PRK12402337 replication factor C small subunit 2; Reviewed 98.76
COG3899 849 Predicted ATPase [General function prediction only 98.74
cd01128249 rho_factor Transcription termination factor rho is 98.73
KOG2028 554 consensus ATPase related to the helicase subunit o 98.72
PRK08084235 DNA replication initiation factor; Provisional 98.69
PRK14949 944 DNA polymerase III subunits gamma and tau; Provisi 98.69
PF05496233 RuvB_N: Holliday junction DNA helicase ruvB N-term 98.68
PRK07003 830 DNA polymerase III subunits gamma and tau; Validat 98.67
PRK14961363 DNA polymerase III subunits gamma and tau; Provisi 98.66
PF05621302 TniB: Bacterial TniB protein; InterPro: IPR008868 98.66
PLN03025319 replication factor C subunit; Provisional 98.64
PTZ00202550 tuzin; Provisional 98.63
PF13191185 AAA_16: AAA ATPase domain; PDB: 2V1U_A. 98.62
PRK14960 702 DNA polymerase III subunits gamma and tau; Provisi 98.62
PRK09112351 DNA polymerase III subunit delta'; Validated 98.61
PRK05564313 DNA polymerase III subunit delta'; Validated 98.61
PRK00440319 rfc replication factor C small subunit; Reviewed 98.6
PF00308219 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 98.6
PRK12323 700 DNA polymerase III subunits gamma and tau; Provisi 98.6
PRK07471365 DNA polymerase III subunit delta'; Validated 98.59
PRK04195 482 replication factor C large subunit; Provisional 98.59
PRK09376416 rho transcription termination factor Rho; Provisio 98.59
PRK14963 504 DNA polymerase III subunits gamma and tau; Provisi 98.59
PRK09087226 hypothetical protein; Validated 98.57
PRK14956 484 DNA polymerase III subunits gamma and tau; Provisi 98.56
PRK07940 394 DNA polymerase III subunit delta'; Validated 98.56
PRK13341 725 recombination factor protein RarA/unknown domain f 98.56
PRK14087450 dnaA chromosomal replication initiation protein; P 98.53
PF13173128 AAA_14: AAA domain 98.52
PF14516331 AAA_35: AAA-like domain 98.51
PRK14957 546 DNA polymerase III subunits gamma and tau; Provisi 98.51
PRK14964 491 DNA polymerase III subunits gamma and tau; Provisi 98.5
PRK14951 618 DNA polymerase III subunits gamma and tau; Provisi 98.5
PRK07994 647 DNA polymerase III subunits gamma and tau; Validat 98.5
TIGR00767415 rho transcription termination factor Rho. Members 98.48
PRK05642234 DNA replication initiation factor; Validated 98.48
PRK14962 472 DNA polymerase III subunits gamma and tau; Provisi 98.47
PRK14958 509 DNA polymerase III subunits gamma and tau; Provisi 98.46
PRK08691 709 DNA polymerase III subunits gamma and tau; Validat 98.46
TIGR03345 852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. M 98.46
PRK08903227 DnaA regulatory inactivator Hda; Validated 98.46
PRK06645 507 DNA polymerase III subunits gamma and tau; Validat 98.45
TIGR00678188 holB DNA polymerase III, delta' subunit. At positi 98.44
PRK05896 605 DNA polymerase III subunits gamma and tau; Validat 98.44
cd00009151 AAA The AAA+ (ATPases Associated with a wide varie 98.43
TIGR02639 731 ClpA ATP-dependent Clp protease ATP-binding subuni 98.43
CHL00095 821 clpC Clp protease ATP binding subunit 98.38
PRK14088440 dnaA chromosomal replication initiation protein; P 98.38
TIGR00362405 DnaA chromosomal replication initiator protein Dna 98.38
PRK14970367 DNA polymerase III subunits gamma and tau; Provisi 98.36
TIGR02397355 dnaX_nterm DNA polymerase III, subunit gamma and t 98.35
PRK14955397 DNA polymerase III subunits gamma and tau; Provisi 98.34
PRK00149450 dnaA chromosomal replication initiation protein; R 98.34
PRK09111 598 DNA polymerase III subunits gamma and tau; Validat 98.34
PRK06620214 hypothetical protein; Validated 98.32
PRK14969 527 DNA polymerase III subunits gamma and tau; Provisi 98.3
TIGR02903 615 spore_lon_C ATP-dependent protease, Lon family. Me 98.3
PRK14952 584 DNA polymerase III subunits gamma and tau; Provisi 98.29
PRK07764 824 DNA polymerase III subunits gamma and tau; Validat 98.28
TIGR01242364 26Sp45 26S proteasome subunit P45 family. Many pro 98.27
PRK11034 758 clpA ATP-dependent Clp protease ATP-binding subuni 98.27
PRK14959 624 DNA polymerase III subunits gamma and tau; Provisi 98.27
PRK14086617 dnaA chromosomal replication initiation protein; P 98.25
PRK08451 535 DNA polymerase III subunits gamma and tau; Validat 98.25
PRK14950 585 DNA polymerase III subunits gamma and tau; Provisi 98.22
PRK11331459 5-methylcytosine-specific restriction enzyme subun 98.21
PRK03992389 proteasome-activating nucleotidase; Provisional 98.2
PHA02544316 44 clamp loader, small subunit; Provisional 98.19
PRK06305 451 DNA polymerase III subunits gamma and tau; Validat 98.18
KOG2543 438 consensus Origin recognition complex, subunit 5 [R 98.18
PRK07133 725 DNA polymerase III subunits gamma and tau; Validat 98.18
PRK14971 614 DNA polymerase III subunits gamma and tau; Provisi 98.18
PRK14954 620 DNA polymerase III subunits gamma and tau; Provisi 98.17
PRK14953 486 DNA polymerase III subunits gamma and tau; Provisi 98.16
PRK12422445 chromosomal replication initiation protein; Provis 98.15
COG3267269 ExeA Type II secretory pathway, component ExeA (pr 98.15
TIGR03346 852 chaperone_ClpB ATP-dependent chaperone ClpB. Membe 98.11
KOG2227529 consensus Pre-initiation complex, subunit CDC6, AA 98.1
PRK06647 563 DNA polymerase III subunits gamma and tau; Validat 98.1
KOG0989346 consensus Replication factor C, subunit RFC4 [Repl 98.09
PRK07399314 DNA polymerase III subunit delta'; Validated 98.05
PRK14965 576 DNA polymerase III subunits gamma and tau; Provisi 98.04
TIGR02880284 cbbX_cfxQ probable Rubsico expression protein CbbX 98.03
TIGR02881261 spore_V_K stage V sporulation protein K. Members o 98.03
PRK10865 857 protein disaggregation chaperone; Provisional 98.02
PRK14948 620 DNA polymerase III subunits gamma and tau; Provisi 98.01
PTZ00361438 26 proteosome regulatory subunit 4-like protein; P 97.97
PRK05563 559 DNA polymerase III subunits gamma and tau; Validat 97.96
smart00382148 AAA ATPases associated with a variety of cellular 97.96
CHL00181287 cbbX CbbX; Provisional 97.96
PRK05707328 DNA polymerase III subunit delta'; Validated 97.95
COG1222406 RPT1 ATP-dependent 26S proteasome regulatory subun 97.95
PF05673249 DUF815: Protein of unknown function (DUF815); Inte 97.92
PRK08116268 hypothetical protein; Validated 97.92
PTZ00454398 26S protease regulatory subunit 6B-like protein; P 97.9
TIGR03689512 pup_AAA proteasome ATPase. In the Actinobacteria, 97.89
COG0593408 DnaA ATPase involved in DNA replication initiation 97.88
PRK08118167 topology modulation protein; Reviewed 97.86
PF10443431 RNA12: RNA12 protein; InterPro: IPR018850 Mitochon 97.85
PRK12377248 putative replication protein; Provisional 97.84
PRK08181269 transposase; Validated 97.84
COG2255332 RuvB Holliday junction resolvasome, helicase subun 97.81
KOG0991333 consensus Replication factor C, subunit RFC2 [Repl 97.81
PRK06835329 DNA replication protein DnaC; Validated 97.8
PF04665241 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 97.8
PRK08769319 DNA polymerase III subunit delta'; Validated 97.79
CHL00176 638 ftsH cell division protein; Validated 97.79
TIGR01241 495 FtsH_fam ATP-dependent metalloprotease FtsH. HflB( 97.79
PF00004132 AAA: ATPase family associated with various cellula 97.78
PRK07261171 topology modulation protein; Provisional 97.77
PRK06526254 transposase; Provisional 97.76
PHA00729226 NTP-binding motif containing protein 97.72
PRK12608380 transcription termination factor Rho; Provisional 97.71
TIGR00763 775 lon ATP-dependent protease La. This protein is ind 97.7
TIGR02237209 recomb_radB DNA repair and recombination protein R 97.7
PRK08058329 DNA polymerase III subunit delta'; Validated 97.67
PF01695178 IstB_IS21: IstB-like ATP binding protein; InterPro 97.66
PRK09183259 transposase/IS protein; Provisional 97.64
TIGR00602 637 rad24 checkpoint protein rad24. This family is bas 97.62
PRK07952244 DNA replication protein DnaC; Validated 97.61
TIGR02640262 gas_vesic_GvpN gas vesicle protein GvpN. Members o 97.56
COG1223368 Predicted ATPase (AAA+ superfamily) [General funct 97.56
cd01123235 Rad51_DMC1_radA Rad51_DMC1_radA,B. This group of r 97.56
COG0466 782 Lon ATP-dependent Lon protease, bacterial type [Po 97.55
KOG0731 774 consensus AAA+-type ATPase containing the peptidas 97.53
cd01393226 recA_like RecA is a bacterial enzyme which has rol 97.52
PRK06871325 DNA polymerase III subunit delta'; Validated 97.52
KOG0734 752 consensus AAA+-type ATPase containing the peptidas 97.52
PRK14722374 flhF flagellar biosynthesis regulator FlhF; Provis 97.5
KOG0733 802 consensus Nuclear AAA ATPase (VCP subfamily) [Post 97.5
PF00448196 SRP54: SRP54-type protein, GTPase domain; InterPro 97.5
COG0542 786 clpA ATP-binding subunits of Clp protease and DnaK 97.5
PF10236309 DAP3: Mitochondrial ribosomal death-associated pro 97.49
KOG0744423 consensus AAA+-type ATPase [Posttranslational modi 97.49
PRK08939306 primosomal protein DnaI; Reviewed 97.48
PRK09361225 radB DNA repair and recombination protein RadB; Pr 97.47
KOG0743457 consensus AAA+-type ATPase [Posttranslational modi 97.47
PF13207121 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6 97.46
PRK06921266 hypothetical protein; Provisional 97.44
TIGR02012321 tigrfam_recA protein RecA. This model describes or 97.44
PRK05541176 adenylylsulfate kinase; Provisional 97.43
PF13177162 DNA_pol3_delta2: DNA polymerase III, delta subunit 97.42
KOG0735 952 consensus AAA+-type ATPase [Posttranslational modi 97.42
KOG1514767 consensus Origin recognition complex, subunit 1, a 97.41
cd00983325 recA RecA is a bacterial enzyme which has roles in 97.41
TIGR02902 531 spore_lonB ATP-dependent protease LonB. Members of 97.4
cd01394218 radB RadB. The archaeal protein radB shares simila 97.37
TIGR01243733 CDC48 AAA family ATPase, CDC48 subfamily. This sub 97.36
PRK09354349 recA recombinase A; Provisional 97.36
PRK10787 784 DNA-binding ATP-dependent protease La; Provisional 97.36
cd01120165 RecA-like_NTPases RecA-like NTPases. This family i 97.35
KOG2228408 consensus Origin recognition complex, subunit 4 [R 97.34
PRK06090319 DNA polymerase III subunit delta'; Validated 97.33
PRK10865857 protein disaggregation chaperone; Provisional 97.33
COG1373 398 Predicted ATPase (AAA+ superfamily) [General funct 97.32
PF08423256 Rad51: Rad51; InterPro: IPR013632 This domain is f 97.32
KOG0728404 consensus 26S proteasome regulatory complex, ATPas 97.31
PRK07993334 DNA polymerase III subunit delta'; Validated 97.3
TIGR03877237 thermo_KaiC_1 KaiC domain protein, Ph0284 family. 97.3
KOG0741744 consensus AAA+-type ATPase [Posttranslational modi 97.29
PHA02244383 ATPase-like protein 97.28
PRK05703424 flhF flagellar biosynthesis regulator FlhF; Valida 97.26
COG1484254 DnaC DNA replication protein [DNA replication, rec 97.26
PRK00771 437 signal recognition particle protein Srp54; Provisi 97.25
TIGR02639731 ClpA ATP-dependent Clp protease ATP-binding subuni 97.24
PRK04296190 thymidine kinase; Provisional 97.22
CHL00195489 ycf46 Ycf46; Provisional 97.22
COG0470325 HolB ATPase involved in DNA replication [DNA repli 97.19
TIGR03499282 FlhF flagellar biosynthetic protein FlhF. 97.18
cd01133274 F1-ATPase_beta F1 ATP synthase beta subunit, nucle 97.17
TIGR02238313 recomb_DMC1 meiotic recombinase Dmc1. This model d 97.16
KOG1969 877 consensus DNA replication checkpoint protein CHL12 97.16
TIGR03345852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. M 97.15
PRK04132846 replication factor C small subunit; Provisional 97.15
PRK12727559 flagellar biosynthesis regulator FlhF; Provisional 97.14
KOG0733802 consensus Nuclear AAA ATPase (VCP subfamily) [Post 97.13
smart00763361 AAA_PrkA PrkA AAA domain. This is a family of PrkA 97.11
PRK06067234 flagellar accessory protein FlaH; Validated 97.1
COG0542786 clpA ATP-binding subunits of Clp protease and DnaK 97.09
PRK11889436 flhF flagellar biosynthesis regulator FlhF; Provis 97.07
PRK06696223 uridine kinase; Validated 97.07
cd03115173 SRP The signal recognition particle (SRP) mediates 97.06
PRK06547172 hypothetical protein; Provisional 97.04
PRK06964342 DNA polymerase III subunit delta'; Validated 97.02
KOG0730693 consensus AAA+-type ATPase [Posttranslational modi 97.01
cd00544169 CobU Adenosylcobinamide kinase / adenosylcobinamid 97.0
PRK04301317 radA DNA repair and recombination protein RadA; Va 96.99
TIGR01243 733 CDC48 AAA family ATPase, CDC48 subfamily. This sub 96.99
PTZ00494664 tuzin-like protein; Provisional 96.98
PLN03186342 DNA repair protein RAD51 homolog; Provisional 96.97
TIGR02236310 recomb_radA DNA repair and recombination protein R 96.97
KOG0727408 consensus 26S proteasome regulatory complex, ATPas 96.96
KOG0726440 consensus 26S proteasome regulatory complex, ATPas 96.95
COG0468279 RecA RecA/RadA recombinase [DNA replication, recom 96.95
PF14532138 Sigma54_activ_2: Sigma-54 interaction domain; PDB: 96.94
PRK14974336 cell division protein FtsY; Provisional 96.93
PRK06995484 flhF flagellar biosynthesis regulator FlhF; Valida 96.93
TIGR03878259 thermo_KaiC_2 KaiC domain protein, AF_0795 family. 96.93
PLN03187344 meiotic recombination protein DMC1 homolog; Provis 96.92
PRK10867 433 signal recognition particle protein; Provisional 96.91
PRK05800170 cobU adenosylcobinamide kinase/adenosylcobinamide- 96.91
TIGR00959428 ffh signal recognition particle protein. This mode 96.9
COG0541 451 Ffh Signal recognition particle GTPase [Intracellu 96.9
PF13238129 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB 96.89
PRK04328249 hypothetical protein; Provisional 96.89
COG1618179 Predicted nucleotide kinase [Nucleotide transport 96.87
TIGR02239316 recomb_RAD51 DNA repair protein RAD51. This eukary 96.87
PRK09270229 nucleoside triphosphate hydrolase domain-containin 96.86
TIGR03346852 chaperone_ClpB ATP-dependent chaperone ClpB. Membe 96.86
TIGR01359183 UMP_CMP_kin_fam UMP-CMP kinase family. This subfam 96.85
PRK05480209 uridine/cytidine kinase; Provisional 96.85
PF06745226 KaiC: KaiC; InterPro: IPR014774 This entry represe 96.84
PF01583156 APS_kinase: Adenylylsulphate kinase; InterPro: IPR 96.83
PF00154322 RecA: recA bacterial DNA recombination protein; In 96.82
cd02027149 APSK Adenosine 5'-phosphosulfate kinase (APSK) cat 96.82
KOG2004 906 consensus Mitochondrial ATP-dependent protease PIM 96.81
COG0563178 Adk Adenylate kinase and related kinases [Nucleoti 96.81
PF00485194 PRK: Phosphoribulokinase / Uridine kinase family; 96.81
PRK08233182 hypothetical protein; Provisional 96.8
COG4608268 AppF ABC-type oligopeptide transport system, ATPas 96.8
PRK08699325 DNA polymerase III subunit delta'; Validated 96.79
PTZ00035337 Rad51 protein; Provisional 96.79
PRK12726407 flagellar biosynthesis regulator FlhF; Provisional 96.78
PRK15429686 formate hydrogenlyase transcriptional activator Fh 96.78
COG2812 515 DnaX DNA polymerase III, gamma/tau subunits [DNA r 96.77
cd02025220 PanK Pantothenate kinase (PanK) catalyzes the phos 96.77
CHL00095821 clpC Clp protease ATP binding subunit 96.77
PRK10733 644 hflB ATP-dependent metalloprotease; Reviewed 96.76
cd01131198 PilT Pilus retraction ATPase PilT. PilT is a nucle 96.75
COG1102179 Cmk Cytidylate kinase [Nucleotide transport and me 96.73
PRK08533230 flagellar accessory protein FlaH; Reviewed 96.73
TIGR02974329 phageshock_pspF psp operon transcriptional activat 96.73
COG2607287 Predicted ATPase (AAA+ superfamily) [General funct 96.73
PF13671143 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1 96.72
PRK11034758 clpA ATP-dependent Clp protease ATP-binding subuni 96.72
cd01124187 KaiC KaiC is a circadian clock protein primarily f 96.72
KOG0739439 consensus AAA+-type ATPase [Posttranslational modi 96.71
PRK12723388 flagellar biosynthesis regulator FlhF; Provisional 96.7
PRK15455 644 PrkA family serine protein kinase; Provisional 96.7
PRK06762166 hypothetical protein; Provisional 96.68
PRK05973237 replicative DNA helicase; Provisional 96.68
TIGR03881229 KaiC_arch_4 KaiC domain protein, PAE1156 family. M 96.67
COG0529197 CysC Adenylylsulfate kinase and related kinases [I 96.66
cd0201969 NK Nucleoside/nucleotide kinase (NK) is a protein 96.66
PF13481193 AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C. 96.64
COG1126240 GlnQ ABC-type polar amino acid transport system, A 96.64
PRK12724432 flagellar biosynthesis regulator FlhF; Provisional 96.64
PTZ00301210 uridine kinase; Provisional 96.63
TIGR01425429 SRP54_euk signal recognition particle protein SRP5 96.63
PRK12678672 transcription termination factor Rho; Provisional 96.63
PF00006215 ATP-synt_ab: ATP synthase alpha/beta family, nucle 96.63
PTZ00088229 adenylate kinase 1; Provisional 96.62
TIGR00235207 udk uridine kinase. Model contains a number of lon 96.62
PRK14527191 adenylate kinase; Provisional 96.61
TIGR00064272 ftsY signal recognition particle-docking protein F 96.6
cd01121372 Sms Sms (bacterial radA) DNA repair protein. This 96.6
cd03214180 ABC_Iron-Siderophores_B12_Hemin ABC transporters, 96.59
PRK09519 790 recA DNA recombination protein RecA; Reviewed 96.59
PRK07667193 uridine kinase; Provisional 96.58
TIGR01360188 aden_kin_iso1 adenylate kinase, isozyme 1 subfamil 96.57
PF08433270 KTI12: Chromatin associated protein KTI12 ; InterP 96.57
PRK08972444 fliI flagellum-specific ATP synthase; Validated 96.57
PRK06217183 hypothetical protein; Validated 96.57
PRK03839180 putative kinase; Provisional 96.57
PF07728139 AAA_5: AAA domain (dynein-related subfamily); Inte 96.56
PRK06002450 fliI flagellum-specific ATP synthase; Validated 96.56
PRK00889175 adenylylsulfate kinase; Provisional 96.56
cd01135276 V_A-ATPase_B V/A-type ATP synthase (non-catalytic) 96.55
COG0464494 SpoVK ATPases of the AAA+ class [Posttranslational 96.55
PLN00020413 ribulose bisphosphate carboxylase/oxygenase activa 96.54
cd03238176 ABC_UvrA The excision repair protein UvrA; Nucleot 96.53
TIGR02858270 spore_III_AA stage III sporulation protein AA. Mem 96.52
TIGR02655484 circ_KaiC circadian clock protein KaiC. Members of 96.52
cd03247178 ABCC_cytochrome_bd The CYD subfamily implicated in 96.52
TIGR00554290 panK_bact pantothenate kinase, bacterial type. Sho 96.52
TIGR00390 441 hslU ATP-dependent protease HslVU, ATPase subunit. 96.46
TIGR01817534 nifA Nif-specific regulatory protein. This model r 96.46
PRK03846198 adenylylsulfate kinase; Provisional 96.45
PRK13765 637 ATP-dependent protease Lon; Provisional 96.45
PRK00131175 aroK shikimate kinase; Reviewed 96.44
cd03222177 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibi 96.42
PF03205140 MobB: Molybdopterin guanine dinucleotide synthesis 96.42
PRK08149428 ATP synthase SpaL; Validated 96.42
PRK04040188 adenylate kinase; Provisional 96.41
COG0572218 Udk Uridine kinase [Nucleotide transport and metab 96.41
KOG0729435 consensus 26S proteasome regulatory complex, ATPas 96.41
TIGR03498418 FliI_clade3 flagellar protein export ATPase FliI. 96.39
KOG2035351 consensus Replication factor C, subunit RFC3 [Cell 96.39
PRK13531 498 regulatory ATPase RavA; Provisional 96.38
KOG1970 634 consensus Checkpoint RAD17-RFC complex, RAD17/RAD2 96.38
cd00561159 CobA_CobO_BtuR ATP:corrinoid adenosyltransferase B 96.38
cd03216163 ABC_Carb_Monos_I This family represents the domain 96.37
PRK14721420 flhF flagellar biosynthesis regulator FlhF; Provis 96.37
PRK00625173 shikimate kinase; Provisional 96.36
cd02023198 UMPK Uridine monophosphate kinase (UMPK, EC 2.7.1. 96.35
KOG0738491 consensus AAA+-type ATPase [Posttranslational modi 96.35
cd01132274 F1_ATPase_alpha F1 ATP synthase alpha, central dom 96.34
PRK05439311 pantothenate kinase; Provisional 96.34
KOG0652424 consensus 26S proteasome regulatory complex, ATPas 96.34
cd03246173 ABCC_Protease_Secretion This family represents the 96.33
CHL00081350 chlI Mg-protoporyphyrin IX chelatase 96.33
cd03230173 ABC_DR_subfamily_A This family of ATP-binding prot 96.33
PRK05922434 type III secretion system ATPase; Validated 96.32
COG0465 596 HflB ATP-dependent Zn proteases [Posttranslational 96.32
COG1066 456 Sms Predicted ATP-dependent serine protease [Postt 96.31
PRK14723 767 flhF flagellar biosynthesis regulator FlhF; Provis 96.31
COG2842297 Uncharacterized ATPase, putative transposase [Gene 96.3
PRK08927442 fliI flagellum-specific ATP synthase; Validated 96.3
PF00910107 RNA_helicase: RNA helicase; InterPro: IPR000605 He 96.3
TIGR02030337 BchI-ChlI magnesium chelatase ATPase subunit I. Th 96.3
PF12775272 AAA_7: P-loop containing dynein motor region D3; P 96.3
TIGR02322179 phosphon_PhnN phosphonate metabolism protein/1,5-b 96.29
cd00227175 CPT Chloramphenicol (Cm) phosphotransferase (CPT). 96.29
COG1419407 FlhF Flagellar GTP-binding protein [Cell motility 96.28
PRK07594433 type III secretion system ATPase SsaN; Validated 96.28
PRK06936439 type III secretion system ATPase; Provisional 96.27
cd03223166 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cass 96.27
cd00984242 DnaB_C DnaB helicase C terminal domain. The hexame 96.26
PRK10536262 hypothetical protein; Provisional 96.26
cd02021150 GntK Gluconate kinase (GntK) catalyzes the phospho 96.24
TIGR02655 484 circ_KaiC circadian clock protein KaiC. Members of 96.24
PRK12597461 F0F1 ATP synthase subunit beta; Provisional 96.23
cd02024187 NRK1 Nicotinamide riboside kinase (NRK) is an enzy 96.22
PRK05022509 anaerobic nitric oxide reductase transcription reg 96.2
cd01134369 V_A-ATPase_A V/A-type ATP synthase catalytic subun 96.19
TIGR00764 608 lon_rel lon-related putative ATP-dependent proteas 96.19
COG0467260 RAD55 RecA-superfamily ATPases implicated in signa 96.18
cd01122271 GP4d_helicase GP4d_helicase is a homohexameric 5'- 96.18
COG1121254 ZnuC ABC-type Mn/Zn transport systems, ATPase comp 96.18
PF07726131 AAA_3: ATPase family associated with various cellu 96.17
PRK05201 443 hslU ATP-dependent protease ATP-binding subunit Hs 96.16
TIGR03263180 guanyl_kin guanylate kinase. Members of this famil 96.16
PTZ00185 574 ATPase alpha subunit; Provisional 96.15
cd01136326 ATPase_flagellum-secretory_path_III Flagellum-spec 96.15
TIGR03575 340 selen_PSTK_euk L-seryl-tRNA(Sec) kinase, eukaryoti 96.14
PRK09302 509 circadian clock protein KaiC; Reviewed 96.13
PRK10751173 molybdopterin-guanine dinucleotide biosynthesis pr 96.12
TIGR03880224 KaiC_arch_3 KaiC domain protein, AF_0351 family. T 96.11
TIGR03305449 alt_F1F0_F1_bet alternate F1F0 ATPase, F1 subunit 96.1
cd02028179 UMPK_like Uridine monophosphate kinase_like (UMPK_ 96.09
TIGR02329526 propionate_PrpR propionate catabolism operon regul 96.09
PRK09302509 circadian clock protein KaiC; Reviewed 96.08
cd02020147 CMPK Cytidine monophosphate kinase (CMPK) catalyze 96.08
COG1124252 DppF ABC-type dipeptide/oligopeptide/nickel transp 96.07
TIGR00150133 HI0065_YjeE ATPase, YjeE family. Members of this f 96.07
KOG3347176 consensus Predicted nucleotide kinase/nuclear prot 96.06
PRK10463290 hydrogenase nickel incorporation protein HypB; Pro 96.06
KOG1532 366 consensus GTPase XAB1, interacts with DNA repair p 96.06
PRK10416318 signal recognition particle-docking protein FtsY; 96.05
cd03228171 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein 96.05
PF13086236 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV 96.05
cd01129264 PulE-GspE PulE/GspE The type II secretory pathway 96.05
PF08477119 Miro: Miro-like protein; InterPro: IPR013684 Mitoc 96.04
TIGR00073207 hypB hydrogenase accessory protein HypB. HypB is i 96.04
PRK13947171 shikimate kinase; Provisional 96.04
COG1703323 ArgK Putative periplasmic protein kinase ArgK and 96.02
PF03193161 DUF258: Protein of unknown function, DUF258; Inter 96.02
PRK06851367 hypothetical protein; Provisional 96.01
cd00267157 ABC_ATPase ABC (ATP-binding cassette) transporter 96.01
PF00625183 Guanylate_kin: Guanylate kinase; InterPro: IPR0081 96.01
PRK13407334 bchI magnesium chelatase subunit I; Provisional 95.99
PRK00300205 gmk guanylate kinase; Provisional 95.99
PF13479213 AAA_24: AAA domain 95.98
) proteins. It has been suggested that torsins play a role in effectively managing protein folding and that possible breakdown in a neuroprotective mechanism that is, in part, mediated by torsins may be responsible for the neuronal dysfunction associated with dystonia [].; GO: 0005524 ATP binding, 0051085 chaperone mediated protein folding requiring cofactor" target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=PF06309">PF06309127 Torsin: Torsin; InterPro: IPR010448 This family co 95.98
TIGR00416 454 sms DNA repair protein RadA. The gene protuct code 95.96
PF1324576 AAA_19: Part of AAA domain 95.95
PRK12339197 2-phosphoglycerate kinase; Provisional 95.95
PRK13949169 shikimate kinase; Provisional 95.95
PRK11823 446 DNA repair protein RadA; Provisional 95.95
TIGR01313163 therm_gnt_kin carbohydrate kinase, thermoresistant 95.94
TIGR00708173 cobA cob(I)alamin adenosyltransferase. Alternate n 95.94
PRK10078186 ribose 1,5-bisphosphokinase; Provisional 95.93
PRK14530215 adenylate kinase; Provisional 95.93
TIGR01420343 pilT_fam pilus retraction protein PilT. This model 95.93
COG1936180 Predicted nucleotide kinase (related to CMP and AM 95.92
COG1428216 Deoxynucleoside kinases [Nucleotide transport and 95.92
PF03308266 ArgK: ArgK protein; InterPro: IPR005129 Bacterial 95.91
TIGR03496411 FliI_clade1 flagellar protein export ATPase FliI. 95.9
TIGR01040466 V-ATPase_V1_B V-type (H+)-ATPase V1, B subunit. Th 95.9
cd00464154 SK Shikimate kinase (SK) is the fifth enzyme in th 95.9
PF03266168 NTPase_1: NTPase; InterPro: IPR004948 This entry r 95.9
PRK14737186 gmk guanylate kinase; Provisional 95.89
PRK09099441 type III secretion system ATPase; Provisional 95.89
cd00071137 GMPK Guanosine monophosphate kinase (GMPK, EC 2.7. 95.89
PF00158168 Sigma54_activat: Sigma-54 interaction domain; Inte 95.88
PRK07132299 DNA polymerase III subunit delta'; Validated 95.86
PRK14529223 adenylate kinase; Provisional 95.86
PF02562205 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH 95.85
PRK09280463 F0F1 ATP synthase subunit beta; Validated 95.84
COG3640255 CooC CO dehydrogenase maturation factor [Cell divi 95.84
PRK15453290 phosphoribulokinase; Provisional 95.82
PRK07721438 fliI flagellum-specific ATP synthase; Validated 95.82
PRK06820440 type III secretion system ATPase; Validated 95.81
PRK05057172 aroK shikimate kinase I; Reviewed 95.79
cd03221144 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is 95.77
PRK06793432 fliI flagellum-specific ATP synthase; Validated 95.76
TIGR01039461 atpD ATP synthase, F1 beta subunit. The sequences 95.75
PRK13948182 shikimate kinase; Provisional 95.73
COG0714329 MoxR-like ATPases [General function prediction onl 95.72
PRK05688451 fliI flagellum-specific ATP synthase; Validated 95.72
KOG0736953 consensus Peroxisome assembly factor 2 containing 95.7
PRK07196434 fliI flagellum-specific ATP synthase; Validated 95.7
cd03213194 ABCG_EPDR ABCG transporters are involved in eye pi 95.7
PRK14738206 gmk guanylate kinase; Provisional 95.68
TIGR01650327 PD_CobS cobaltochelatase, CobS subunit. This model 95.67
PLN02200234 adenylate kinase family protein 95.67
PRK11388638 DNA-binding transcriptional regulator DhaR; Provis 95.67
TIGR00455184 apsK adenylylsulfate kinase (apsK). Important resi 95.67
COG0055468 AtpD F0F1-type ATP synthase, beta subunit [Energy 95.67
PRK13946184 shikimate kinase; Provisional 95.66
TIGR01069 771 mutS2 MutS2 family protein. Function of MutS2 is u 95.66
PRK06761282 hypothetical protein; Provisional 95.66
PRK13975196 thymidylate kinase; Provisional 95.64
cd00820107 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPC 95.63
cd01672200 TMPK Thymidine monophosphate kinase (TMPK), also k 95.63
cd01125239 repA Hexameric Replicative Helicase RepA. RepA is 95.62
PRK04182180 cytidylate kinase; Provisional 95.62
TIGR02546422 III_secr_ATP type III secretion apparatus H+-trans 95.62
KOG0651388 consensus 26S proteasome regulatory complex, ATPas 95.59
PF13521163 AAA_28: AAA domain; PDB: 1LW7_A. 95.58
TIGR03497413 FliI_clade2 flagellar protein export ATPase FliI. 95.58
COG3598402 RepA RecA-family ATPase [DNA replication, recombin 95.57
PRK14532188 adenylate kinase; Provisional 95.57
TIGR00176155 mobB molybdopterin-guanine dinucleotide biosynthes 95.56
PRK09825176 idnK D-gluconate kinase; Provisional 95.56
PF03215 519 Rad17: Rad17 cell cycle checkpoint protein 95.54
COG0003322 ArsA Predicted ATPase involved in chromosome parti 95.54
COG0194191 Gmk Guanylate kinase [Nucleotide transport and met 95.52
TIGR01041458 ATP_syn_B_arch ATP synthase archaeal, B subunit. A 95.51
COG2274709 SunT ABC-type bacteriocin/lantibiotic exporters, c 95.51
cd01428194 ADK Adenylate kinase (ADK) catalyzes the reversibl 95.49
PRK08472434 fliI flagellum-specific ATP synthase; Validated 95.49
TIGR02868529 CydC thiol reductant ABC exporter, CydC subunit. T 95.49
COG1116248 TauB ABC-type nitrate/sulfonate/bicarbonate transp 95.49
PRK06731270 flhF flagellar biosynthesis regulator FlhF; Valida 95.48
PF03969362 AFG1_ATPase: AFG1-like ATPase; InterPro: IPR005654 95.48
TIGR02173171 cyt_kin_arch cytidylate kinase, putative. Proteins 95.47
PLN02165334 adenylate isopentenyltransferase 95.46
PF02374305 ArsA_ATPase: Anion-transporting ATPase; PDB: 2WOO_ 95.46
COG2884223 FtsE Predicted ATPase involved in cell division [C 95.44
TIGR00041195 DTMP_kinase thymidylate kinase. Function: phosphor 95.44
TIGR03574249 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal. Mem 95.43
COG2019189 AdkA Archaeal adenylate kinase [Nucleotide transpo 95.43
PF01078206 Mg_chelatase: Magnesium chelatase, subunit ChlI; I 95.43
TIGR03600421 phage_DnaB phage replicative helicase, DnaB family 95.43
PF03029238 ATP_bind_1: Conserved hypothetical ATP binding pro 95.42
COG1100219 GTPase SAR1 and related small G proteins [General 95.42
PLN02348 395 phosphoribulokinase 95.41
COG3854308 SpoIIIAA ncharacterized protein conserved in bacte 95.39
PF00005137 ABC_tran: ABC transporter This structure is on hol 95.38
CHL00059 485 atpA ATP synthase CF1 alpha subunit 95.37
PF09848 352 DUF2075: Uncharacterized conserved protein (DUF207 95.36
PRK03731171 aroL shikimate kinase II; Reviewed 95.35
PF06068 398 TIP49: TIP49 C-terminus; InterPro: IPR010339 This 95.34
PRK13343502 F0F1 ATP synthase subunit alpha; Provisional 95.33
COG4088261 Predicted nucleotide kinase [Nucleotide transport 95.33
TIGR03324497 alt_F1F0_F1_al alternate F1F0 ATPase, F1 subunit a 95.32
TIGR01026440 fliI_yscN ATPase FliI/YscN family. This family of 95.32
PRK13695174 putative NTPase; Provisional 95.31
PHA02530300 pseT polynucleotide kinase; Provisional 95.3
COG1157441 FliI Flagellar biosynthesis/type III secretory pat 95.29
CHL00060494 atpB ATP synthase CF1 beta subunit 95.29
PRK14531183 adenylate kinase; Provisional 95.28
PRK10875 615 recD exonuclease V subunit alpha; Provisional 95.28
TIGR01287275 nifH nitrogenase iron protein. This model describe 95.28
TIGR00665434 DnaB replicative DNA helicase. This model describe 95.28
smart00178184 SAR Sar1p-like members of the Ras-family of small 95.27
PF01926116 MMR_HSR1: 50S ribosome-binding GTPase; InterPro: I 95.27
KOG0735952 consensus AAA+-type ATPase [Posttranslational modi 95.26
cd02022179 DPCK Dephospho-coenzyme A kinase (DPCK, EC 2.7.1.2 95.26
cd02029277 PRK_like Phosphoribulokinase-like (PRK-like) is a 95.25
PRK07960455 fliI flagellum-specific ATP synthase; Validated 95.25
COG0237201 CoaE Dephospho-CoA kinase [Coenzyme metabolism] 95.23
PRK08356195 hypothetical protein; Provisional 95.19
cd04139164 RalA_RalB RalA/RalB subfamily. The Ral (Ras-like) 95.19
PRK00409 782 recombination and DNA strand exchange inhibitor pr 95.18
COG0703172 AroK Shikimate kinase [Amino acid transport and me 95.17
PRK06851 367 hypothetical protein; Provisional 95.17
cd03282204 ABC_MSH4_euk MutS4 homolog in eukaryotes. The MutS 95.15
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
Probab=100.00  E-value=3.7e-53  Score=429.78  Aligned_cols=351  Identities=34%  Similarity=0.537  Sum_probs=286.4

Q ss_pred             hhHHHHHHHHHHhHHHHHHHHH-HhhhcCCCCchhHHHHHHHHHHHHHHHHHHHHHHhhCC-------------------
Q 038454            2 KNLERVLQEFNSQKEDIEATLK-AEGDRGKKPRTEVKNWLQNVQRINSKAQSIEQEVKKRK-------------------   61 (359)
Q Consensus         2 ~~l~~~~~~L~~~l~~i~~~l~-a~~~~~~~~~~~~~~W~~~l~~~~~~~ed~~d~~~~~~-------------------   61 (359)
                      .+.++.+..|++.+..++.+++ ++..+..  ...+..|...+++++|++++.++.+.-..                   
T Consensus        24 ~~~~~~i~~Lk~~L~~l~~~l~d~~a~~~~--~~~~~~~~e~~~~~~~~~e~~~~~~~v~~~~~~~~~~l~~~~~~~~~~  101 (889)
T KOG4658|consen   24 DGKDNYILELKENLKALQSALEDLDAKRDD--LERRVNWEEDVGDLVYLAEDIIWLFLVEEIERKANDLLSTRSVERQRL  101 (889)
T ss_pred             hchHHHHHHHHHHHHHHHHHHHHHHhhcch--HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhHHhhhhHHHHHHH
Confidence            3567789999999999999999 7764443  56889999999999999999988764110                   


Q ss_pred             --cc-------ccccchhhHHHHHHHHHHHHhccCCcccccccCCCC---CcccCCcccccccchHHHHHHHHHHhcCCC
Q 038454           62 --YF-------LCARLGKDVDAKIQEMKDCHQKGCSFISLVIDAPPS---SGLILPTTTLVGENTKKIVKKVWEDLMGDK  129 (359)
Q Consensus        62 --~~-------~~~~~~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~---~~~~~~~~~~vGr~~~~~~~~l~~~l~~~~  129 (359)
                        +.       .-+.+.+++-.+++.++.+..++.+........++.   ..+..+... ||.+.  .++++++.|.+++
T Consensus       102 c~~~~~~~~~~~~~~~~~rv~~~l~~ve~l~~~~~~~~~~~~~~~~~~~e~~~~~~~~~-VG~e~--~~~kl~~~L~~d~  178 (889)
T KOG4658|consen  102 CLCGFCSKNVSDSYKYGKRVSKVLREVESLGSKGVFEVVGESLDPREKVETRPIQSESD-VGLET--MLEKLWNRLMEDD  178 (889)
T ss_pred             hhhhhHhHhhhhhHhHHHHHHHHHHHHHHhccccceecccccccchhhcccCCCCcccc-ccHHH--HHHHHHHHhccCC
Confidence              01       112455666666666666665544433222111111   112222333 99977  9999999999988


Q ss_pred             ccEEEEEcCCCCcHHHHHHHHHcCcccccCCCccEEEEEeCCCcCHHHHHHHHHHHhcCCCCC--CccHHHHHHHHHHHH
Q 038454          130 VTKIGVWGMGGFGKTAIMRHINNRPQEETNEFSDVIWVTVSQPLDLVKLQAEIAMALKLSLTE--DEDKVSRARRLLGKL  207 (359)
Q Consensus       130 ~~vi~I~G~gGiGKTtLa~~v~~~~~~~~~~F~~~~wv~~~~~~~~~~~~~~i~~~l~~~~~~--~~~~~~~~~~l~~~l  207 (359)
                      ..+++|+||||+||||||++++|++..+.++|+.++||+||+.++...++.+|+..++.....  .......+..+.+.|
T Consensus       179 ~~iv~i~GMGGvGKTTL~~qi~N~~~~v~~~Fd~~iWV~VSk~f~~~~iq~~Il~~l~~~~~~~~~~~~~~~~~~i~~~L  258 (889)
T KOG4658|consen  179 VGIVGIYGMGGVGKTTLARQIFNKFDEVGNHFDGVIWVVVSKEFTTRKIQQTILERLGLLDEEWEDKEEDELASKLLNLL  258 (889)
T ss_pred             CCEEEEECCCcccHHHHHHHHhcccchhcccCceEEEEEEcccccHHhHHHHHHHHhccCCcccchhhHHHHHHHHHHHh
Confidence            899999999999999999999999544899999999999999999999999999999874332  233468889999999


Q ss_pred             hcCCcEEEEEecC----------------CCC-eEEEeec-------ccce-eeeecCCCChHHHHHHHHHhhcCCCCCC
Q 038454          208 KAKKKFVLILDDI----------------DNH-TFCWGLR-------SMGC-EEVRVPPLSKEEALNLFLDKVGRNILHV  262 (359)
Q Consensus       208 ~~~k~~LlVlDdv----------------~~g-~ilvTtr-------~~~~-~~~~l~~L~~~ea~~lf~~~~~~~~~~~  262 (359)
                      .+ +|||||||||                .+| +|++|||       .++. ..++++.|+.+|||.||++.+|......
T Consensus       259 ~~-krfllvLDDIW~~~dw~~I~~~~p~~~~g~KvvlTTRs~~V~~~~m~~~~~~~v~~L~~~eaW~LF~~~v~~~~~~~  337 (889)
T KOG4658|consen  259 EG-KRFLLVLDDIWEEVDWDKIGVPFPSRENGSKVVLTTRSEEVCGRAMGVDYPIEVECLTPEEAWDLFQKKVGPNTLGS  337 (889)
T ss_pred             cc-CceEEEEecccccccHHhcCCCCCCccCCeEEEEEeccHhhhhccccCCccccccccCccccHHHHHHhhccccccc
Confidence            98 9999999999                577 9999999       2554 5699999999999999999998875545


Q ss_pred             CCchHHHHHHHHHHcCCchhHHHHHHHhhcCCCChhHHHHHHHHHhhc-ccccCCChhhHhhHHHHhhhcCCCcchhHHH
Q 038454          263 PTLNEEIINSVVEECAGLQLAIFTVVGCMRGVDEIHEWRNALNELRGL-VRSFSGINADVLGRLEFSYLRLKDKKVQHCF  341 (359)
Q Consensus       263 ~~~~~~~~~~i~~~c~g~Plai~~~~~~L~~~~~~~~w~~~l~~~~~~-~~~~~~~~~~~~~~l~~sy~~L~~~~~k~cf  341 (359)
                      .+.++++|++++++|+|+|||++++|+.|+.+.+..+|+++++.+.+. ..+.++..+.++++|.+||+.| |+++|.||
T Consensus       338 ~~~i~~lak~v~~kC~GLPLAl~viG~~ma~K~t~~eW~~~~~~l~s~~~~~~~~~~~~i~~iLklSyd~L-~~~lK~CF  416 (889)
T KOG4658|consen  338 HPDIEELAKEVAEKCGGLPLALNVLGGLLACKKTVQEWRRALNVLKSSLAADFSGMEESILPILKLSYDNL-PEELKSCF  416 (889)
T ss_pred             cccHHHHHHHHHHHhCChHHHHHHHHHHhcCCCcHHHHHHHHccccccccCCCCchhhhhHHhhhccHhhh-hHHHHHHH
Confidence            566999999999999999999999999999999999999999999876 3455566789999999999999 69999999


Q ss_pred             hhccccCCCCccCCCCCC
Q 038454          342 LYCALYPEDFAISKDELI  359 (359)
Q Consensus       342 ~~~s~fp~~~~i~~~~Li  359 (359)
                      +|||+||+||.|+++.||
T Consensus       417 LycalFPED~~I~~e~Li  434 (889)
T KOG4658|consen  417 LYCALFPEDYEIKKEKLI  434 (889)
T ss_pred             HhhccCCcccccchHHHH
Confidence            999999999999999885



>PF00931 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is the NB-ARC domain, a novel signalling motif found in bacteria and eukaryotes, shared by plant resistance gene products and regulators of cell death in animals [] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily Back     alignment and domain information
>PRK00411 cdc6 cell division control protein 6; Reviewed Back     alignment and domain information
>PF01637 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 This domain has been found in a number of bacterial and archaeal proteins, all of which contain a conserved P-loop motif that is involved in binding ATP Back     alignment and domain information
>TIGR02928 orc1/cdc6 family replication initiation protein Back     alignment and domain information
>COG2909 MalT ATP-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>PF05729 NACHT: NACHT domain Back     alignment and domain information
>TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit Back     alignment and domain information
>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed Back     alignment and domain information
>PRK13342 recombination factor protein RarA; Reviewed Back     alignment and domain information
>COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK06893 DNA replication initiation factor; Validated Back     alignment and domain information
>COG3903 Predicted ATPase [General function prediction only] Back     alignment and domain information
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda Back     alignment and domain information
>COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B Back     alignment and domain information
>PTZ00112 origin recognition complex 1 protein; Provisional Back     alignment and domain information
>PRK08727 hypothetical protein; Validated Back     alignment and domain information
>PRK12402 replication factor C small subunit 2; Reviewed Back     alignment and domain information
>COG3899 Predicted ATPase [General function prediction only] Back     alignment and domain information
>cd01128 rho_factor Transcription termination factor rho is a bacterial ATP-dependent RNA/DNA helicase Back     alignment and domain information
>KOG2028 consensus ATPase related to the helicase subunit of the Holliday junction resolvase [Replication, recombination and repair] Back     alignment and domain information
>PRK08084 DNA replication initiation factor; Provisional Back     alignment and domain information
>PRK14949 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair Back     alignment and domain information
>PRK07003 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14961 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF05621 TniB: Bacterial TniB protein; InterPro: IPR008868 This family consists of several bacterial TniB NTP-binding proteins Back     alignment and domain information
>PLN03025 replication factor C subunit; Provisional Back     alignment and domain information
>PTZ00202 tuzin; Provisional Back     alignment and domain information
>PF13191 AAA_16: AAA ATPase domain; PDB: 2V1U_A Back     alignment and domain information
>PRK14960 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK09112 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK05564 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK00440 rfc replication factor C small subunit; Reviewed Back     alignment and domain information
>PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication Back     alignment and domain information
>PRK12323 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK07471 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK04195 replication factor C large subunit; Provisional Back     alignment and domain information
>PRK09376 rho transcription termination factor Rho; Provisional Back     alignment and domain information
>PRK14963 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK09087 hypothetical protein; Validated Back     alignment and domain information
>PRK14956 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK07940 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed Back     alignment and domain information
>PRK14087 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PF13173 AAA_14: AAA domain Back     alignment and domain information
>PF14516 AAA_35: AAA-like domain Back     alignment and domain information
>PRK14957 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14964 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14951 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK07994 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR00767 rho transcription termination factor Rho Back     alignment and domain information
>PRK05642 DNA replication initiation factor; Validated Back     alignment and domain information
>PRK14962 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14958 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK08691 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family Back     alignment and domain information
>PRK08903 DnaA regulatory inactivator Hda; Validated Back     alignment and domain information
>PRK06645 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR00678 holB DNA polymerase III, delta' subunit Back     alignment and domain information
>PRK05896 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>CHL00095 clpC Clp protease ATP binding subunit Back     alignment and domain information
>PRK14088 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>TIGR00362 DnaA chromosomal replication initiator protein DnaA Back     alignment and domain information
>PRK14970 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau Back     alignment and domain information
>PRK14955 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK00149 dnaA chromosomal replication initiation protein; Reviewed Back     alignment and domain information
>PRK09111 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK06620 hypothetical protein; Validated Back     alignment and domain information
>PRK14969 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR02903 spore_lon_C ATP-dependent protease, Lon family Back     alignment and domain information
>PRK14952 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK07764 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR01242 26Sp45 26S proteasome subunit P45 family Back     alignment and domain information
>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14959 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14086 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK08451 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14950 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional Back     alignment and domain information
>PRK03992 proteasome-activating nucleotidase; Provisional Back     alignment and domain information
>PHA02544 44 clamp loader, small subunit; Provisional Back     alignment and domain information
>PRK06305 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>KOG2543 consensus Origin recognition complex, subunit 5 [Replication, recombination and repair] Back     alignment and domain information
>PRK07133 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14971 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14954 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14953 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK12422 chromosomal replication initiation protein; Provisional Back     alignment and domain information
>COG3267 ExeA Type II secretory pathway, component ExeA (predicted ATPase) [Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB Back     alignment and domain information
>KOG2227 consensus Pre-initiation complex, subunit CDC6, AAA+ superfamily ATPase [Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK06647 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>KOG0989 consensus Replication factor C, subunit RFC4 [Replication, recombination and repair] Back     alignment and domain information
>PRK07399 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK14965 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX Back     alignment and domain information
>TIGR02881 spore_V_K stage V sporulation protein K Back     alignment and domain information
>PRK10865 protein disaggregation chaperone; Provisional Back     alignment and domain information
>PRK14948 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PTZ00361 26 proteosome regulatory subunit 4-like protein; Provisional Back     alignment and domain information
>PRK05563 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>CHL00181 cbbX CbbX; Provisional Back     alignment and domain information
>PRK05707 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>COG1222 RPT1 ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF05673 DUF815: Protein of unknown function (DUF815); InterPro: IPR008533 This domain consists of several bacterial proteins of unknown function Back     alignment and domain information
>PRK08116 hypothetical protein; Validated Back     alignment and domain information
>PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional Back     alignment and domain information
>TIGR03689 pup_AAA proteasome ATPase Back     alignment and domain information
>COG0593 DnaA ATPase involved in DNA replication initiation [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK08118 topology modulation protein; Reviewed Back     alignment and domain information
>PF10443 RNA12: RNA12 protein; InterPro: IPR018850 Mitochondrial escape protein 2 (also known as RNA12) plays a role in maintaining the mitochondrial genome and in controlling mtDNA escape [, ] Back     alignment and domain information
>PRK12377 putative replication protein; Provisional Back     alignment and domain information
>PRK08181 transposase; Validated Back     alignment and domain information
>COG2255 RuvB Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0991 consensus Replication factor C, subunit RFC2 [Replication, recombination and repair] Back     alignment and domain information
>PRK06835 DNA replication protein DnaC; Validated Back     alignment and domain information
>PF04665 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 This entry contains uncharacterised proteins belonging to the B354L family which include the pox virus A32 protein Back     alignment and domain information
>PRK08769 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>CHL00176 ftsH cell division protein; Validated Back     alignment and domain information
>TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH Back     alignment and domain information
>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport Back     alignment and domain information
>PRK07261 topology modulation protein; Provisional Back     alignment and domain information
>PRK06526 transposase; Provisional Back     alignment and domain information
>PHA00729 NTP-binding motif containing protein Back     alignment and domain information
>PRK12608 transcription termination factor Rho; Provisional Back     alignment and domain information
>TIGR00763 lon ATP-dependent protease La Back     alignment and domain information
>TIGR02237 recomb_radB DNA repair and recombination protein RadB Back     alignment and domain information
>PRK08058 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif Back     alignment and domain information
>PRK09183 transposase/IS protein; Provisional Back     alignment and domain information
>TIGR00602 rad24 checkpoint protein rad24 Back     alignment and domain information
>PRK07952 DNA replication protein DnaC; Validated Back     alignment and domain information
>TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN Back     alignment and domain information
>COG1223 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>cd01123 Rad51_DMC1_radA Rad51_DMC1_radA,B Back     alignment and domain information
>COG0466 Lon ATP-dependent Lon protease, bacterial type [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0731 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd01393 recA_like RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response Back     alignment and domain information
>PRK06871 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>KOG0734 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF10236 DAP3: Mitochondrial ribosomal death-associated protein 3; InterPro: IPR019368 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>KOG0744 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK08939 primosomal protein DnaI; Reviewed Back     alignment and domain information
>PRK09361 radB DNA repair and recombination protein RadB; Provisional Back     alignment and domain information
>KOG0743 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A Back     alignment and domain information
>PRK06921 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02012 tigrfam_recA protein RecA Back     alignment and domain information
>PRK05541 adenylylsulfate kinase; Provisional Back     alignment and domain information
>PF13177 DNA_pol3_delta2: DNA polymerase III, delta subunit; PDB: 1NJF_B 3GLG_G 1XXH_I 1NJG_A 3GLF_B 3GLI_G 1IQP_E 2GNO_A 1SXJ_E 1A5T_A Back     alignment and domain information
>KOG0735 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1514 consensus Origin recognition complex, subunit 1, and related proteins [Replication, recombination and repair] Back     alignment and domain information
>cd00983 recA RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response Back     alignment and domain information
>TIGR02902 spore_lonB ATP-dependent protease LonB Back     alignment and domain information
>cd01394 radB RadB Back     alignment and domain information
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>PRK09354 recA recombinase A; Provisional Back     alignment and domain information
>PRK10787 DNA-binding ATP-dependent protease La; Provisional Back     alignment and domain information
>cd01120 RecA-like_NTPases RecA-like NTPases Back     alignment and domain information
>KOG2228 consensus Origin recognition complex, subunit 4 [Replication, recombination and repair] Back     alignment and domain information
>PRK06090 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK10865 protein disaggregation chaperone; Provisional Back     alignment and domain information
>COG1373 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>PF08423 Rad51: Rad51; InterPro: IPR013632 This domain is found at the C terminus of the DNA repair and recombination protein Rad51 Back     alignment and domain information
>KOG0728 consensus 26S proteasome regulatory complex, ATPase RPT6 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK07993 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR03877 thermo_KaiC_1 KaiC domain protein, Ph0284 family Back     alignment and domain information
>KOG0741 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA02244 ATPase-like protein Back     alignment and domain information
>PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK00771 signal recognition particle protein Srp54; Provisional Back     alignment and domain information
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>PRK04296 thymidine kinase; Provisional Back     alignment and domain information
>CHL00195 ycf46 Ycf46; Provisional Back     alignment and domain information
>COG0470 HolB ATPase involved in DNA replication [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR03499 FlhF flagellar biosynthetic protein FlhF Back     alignment and domain information
>cd01133 F1-ATPase_beta F1 ATP synthase beta subunit, nucleotide-binding domain Back     alignment and domain information
>TIGR02238 recomb_DMC1 meiotic recombinase Dmc1 Back     alignment and domain information
>KOG1969 consensus DNA replication checkpoint protein CHL12/CTF18 [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] Back     alignment and domain information
>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family Back     alignment and domain information
>PRK04132 replication factor C small subunit; Provisional Back     alignment and domain information
>PRK12727 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00763 AAA_PrkA PrkA AAA domain Back     alignment and domain information
>PRK06067 flagellar accessory protein FlaH; Validated Back     alignment and domain information
>COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK06696 uridine kinase; Validated Back     alignment and domain information
>cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes Back     alignment and domain information
>PRK06547 hypothetical protein; Provisional Back     alignment and domain information
>PRK06964 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>KOG0730 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd00544 CobU Adenosylcobinamide kinase / adenosylcobinamide phosphate guanyltransferase (CobU) Back     alignment and domain information
>PRK04301 radA DNA repair and recombination protein RadA; Validated Back     alignment and domain information
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>PTZ00494 tuzin-like protein; Provisional Back     alignment and domain information
>PLN03186 DNA repair protein RAD51 homolog; Provisional Back     alignment and domain information
>TIGR02236 recomb_radA DNA repair and recombination protein RadA Back     alignment and domain information
>KOG0727 consensus 26S proteasome regulatory complex, ATPase RPT3 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0726 consensus 26S proteasome regulatory complex, ATPase RPT2 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0468 RecA RecA/RadA recombinase [DNA replication, recombination, and repair] Back     alignment and domain information
>PF14532 Sigma54_activ_2: Sigma-54 interaction domain; PDB: 3CO5_B 3N70_H Back     alignment and domain information
>PRK14974 cell division protein FtsY; Provisional Back     alignment and domain information
>PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>TIGR03878 thermo_KaiC_2 KaiC domain protein, AF_0795 family Back     alignment and domain information
>PLN03187 meiotic recombination protein DMC1 homolog; Provisional Back     alignment and domain information
>PRK10867 signal recognition particle protein; Provisional Back     alignment and domain information
>PRK05800 cobU adenosylcobinamide kinase/adenosylcobinamide-phosphate guanylyltransferase; Validated Back     alignment and domain information
>TIGR00959 ffh signal recognition particle protein Back     alignment and domain information
>COG0541 Ffh Signal recognition particle GTPase [Intracellular trafficking and secretion] Back     alignment and domain information
>PF13238 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB_A 3IIM_A 2AXP_A 3KB2_A 1KHT_A 1NKS_A 3H86_C Back     alignment and domain information
>PRK04328 hypothetical protein; Provisional Back     alignment and domain information
>COG1618 Predicted nucleotide kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>TIGR02239 recomb_RAD51 DNA repair protein RAD51 Back     alignment and domain information
>PRK09270 nucleoside triphosphate hydrolase domain-containing protein; Reviewed Back     alignment and domain information
>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB Back     alignment and domain information
>TIGR01359 UMP_CMP_kin_fam UMP-CMP kinase family Back     alignment and domain information
>PRK05480 uridine/cytidine kinase; Provisional Back     alignment and domain information
>PF06745 KaiC: KaiC; InterPro: IPR014774 This entry represents a domain within bacterial and archaeal proteins, most of which are hypothetical Back     alignment and domain information
>PF01583 APS_kinase: Adenylylsulphate kinase; InterPro: IPR002891 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases Back     alignment and domain information
>PF00154 RecA: recA bacterial DNA recombination protein; InterPro: IPR013765 The recA gene product is a multifunctional enzyme that plays a role in homologous recombination, DNA repair and induction of the SOS response [] Back     alignment and domain information
>cd02027 APSK Adenosine 5'-phosphosulfate kinase (APSK) catalyzes the phosphorylation of adenosine 5'-phosphosulfate to form 3'-phosphoadenosine 5'-phosphosulfate (PAPS) Back     alignment and domain information
>KOG2004 consensus Mitochondrial ATP-dependent protease PIM1/LON [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0563 Adk Adenylate kinase and related kinases [Nucleotide transport and metabolism] Back     alignment and domain information
>PF00485 PRK: Phosphoribulokinase / Uridine kinase family; InterPro: IPR006083 Phosphoribulokinase (PRK) 2 Back     alignment and domain information
>PRK08233 hypothetical protein; Provisional Back     alignment and domain information
>COG4608 AppF ABC-type oligopeptide transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>PRK08699 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PTZ00035 Rad51 protein; Provisional Back     alignment and domain information
>PRK12726 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK15429 formate hydrogenlyase transcriptional activator FhlA; Provisional Back     alignment and domain information
>COG2812 DnaX DNA polymerase III, gamma/tau subunits [DNA replication, recombination, and repair] Back     alignment and domain information
>cd02025 PanK Pantothenate kinase (PanK) catalyzes the phosphorylation of pantothenic acid to form 4'-phosphopantothenic, which is the first of five steps in coenzyme A (CoA) biosynthetic pathway Back     alignment and domain information
>CHL00095 clpC Clp protease ATP binding subunit Back     alignment and domain information
>PRK10733 hflB ATP-dependent metalloprotease; Reviewed Back     alignment and domain information
>cd01131 PilT Pilus retraction ATPase PilT Back     alignment and domain information
>COG1102 Cmk Cytidylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK08533 flagellar accessory protein FlaH; Reviewed Back     alignment and domain information
>TIGR02974 phageshock_pspF psp operon transcriptional activator PspF Back     alignment and domain information
>COG2607 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B Back     alignment and domain information
>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional Back     alignment and domain information
>cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs Back     alignment and domain information
>KOG0739 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK12723 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK15455 PrkA family serine protein kinase; Provisional Back     alignment and domain information
>PRK06762 hypothetical protein; Provisional Back     alignment and domain information
>PRK05973 replicative DNA helicase; Provisional Back     alignment and domain information
>TIGR03881 KaiC_arch_4 KaiC domain protein, PAE1156 family Back     alignment and domain information
>COG0529 CysC Adenylylsulfate kinase and related kinases [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd02019 NK Nucleoside/nucleotide kinase (NK) is a protein superfamily consisting of multiple families of enzymes that share structural similarity and are functionally related to the catalysis of the reversible phosphate group transfer from nucleoside triphosphates to nucleosides/nucleotides, nucleoside monophosphates, or sugars Back     alignment and domain information
>PF13481 AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C Back     alignment and domain information
>COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>PRK12724 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PTZ00301 uridine kinase; Provisional Back     alignment and domain information
>TIGR01425 SRP54_euk signal recognition particle protein SRP54 Back     alignment and domain information
>PRK12678 transcription termination factor Rho; Provisional Back     alignment and domain information
>PF00006 ATP-synt_ab: ATP synthase alpha/beta family, nucleotide-binding domain This Pfam entry corresponds to chains a,b,c,d,e and f; InterPro: IPR000194 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane Back     alignment and domain information
>PTZ00088 adenylate kinase 1; Provisional Back     alignment and domain information
>TIGR00235 udk uridine kinase Back     alignment and domain information
>PRK14527 adenylate kinase; Provisional Back     alignment and domain information
>TIGR00064 ftsY signal recognition particle-docking protein FtsY Back     alignment and domain information
>cd01121 Sms Sms (bacterial radA) DNA repair protein Back     alignment and domain information
>cd03214 ABC_Iron-Siderophores_B12_Hemin ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea Back     alignment and domain information
>PRK09519 recA DNA recombination protein RecA; Reviewed Back     alignment and domain information
>PRK07667 uridine kinase; Provisional Back     alignment and domain information
>TIGR01360 aden_kin_iso1 adenylate kinase, isozyme 1 subfamily Back     alignment and domain information
>PF08433 KTI12: Chromatin associated protein KTI12 ; InterPro: IPR013641 This is a family of chromatin associated proteins which interact with the Elongator complex, a component of the elongating form of RNA polymerase II [] Back     alignment and domain information
>PRK08972 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>PRK06217 hypothetical protein; Validated Back     alignment and domain information
>PRK03839 putative kinase; Provisional Back     alignment and domain information
>PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>PRK06002 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>PRK00889 adenylylsulfate kinase; Provisional Back     alignment and domain information
>cd01135 V_A-ATPase_B V/A-type ATP synthase (non-catalytic) subunit B Back     alignment and domain information
>COG0464 SpoVK ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN00020 ribulose bisphosphate carboxylase/oxygenase activase -RuBisCO activase (RCA); Provisional Back     alignment and domain information
>cd03238 ABC_UvrA The excision repair protein UvrA; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion Back     alignment and domain information
>TIGR02858 spore_III_AA stage III sporulation protein AA Back     alignment and domain information
>TIGR02655 circ_KaiC circadian clock protein KaiC Back     alignment and domain information
>cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis Back     alignment and domain information
>TIGR00554 panK_bact pantothenate kinase, bacterial type Back     alignment and domain information
>TIGR00390 hslU ATP-dependent protease HslVU, ATPase subunit Back     alignment and domain information
>TIGR01817 nifA Nif-specific regulatory protein Back     alignment and domain information
>PRK03846 adenylylsulfate kinase; Provisional Back     alignment and domain information
>PRK13765 ATP-dependent protease Lon; Provisional Back     alignment and domain information
>PRK00131 aroK shikimate kinase; Reviewed Back     alignment and domain information
>cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids Back     alignment and domain information
>PF03205 MobB: Molybdopterin guanine dinucleotide synthesis protein B; PDB: 2F1R_B 1P9N_A 1NP6_B 2NPI_A 1XJC_A Back     alignment and domain information
>PRK08149 ATP synthase SpaL; Validated Back     alignment and domain information
>PRK04040 adenylate kinase; Provisional Back     alignment and domain information
>COG0572 Udk Uridine kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>KOG0729 consensus 26S proteasome regulatory complex, ATPase RPT1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03498 FliI_clade3 flagellar protein export ATPase FliI Back     alignment and domain information
>KOG2035 consensus Replication factor C, subunit RFC3 [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] Back     alignment and domain information
>PRK13531 regulatory ATPase RavA; Provisional Back     alignment and domain information
>KOG1970 consensus Checkpoint RAD17-RFC complex, RAD17/RAD24 component [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] Back     alignment and domain information
>cd00561 CobA_CobO_BtuR ATP:corrinoid adenosyltransferase BtuR/CobO/CobP Back     alignment and domain information
>cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>PRK14721 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK00625 shikimate kinase; Provisional Back     alignment and domain information
>cd02023 UMPK Uridine monophosphate kinase (UMPK, EC 2 Back     alignment and domain information
>KOG0738 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd01132 F1_ATPase_alpha F1 ATP synthase alpha, central domain Back     alignment and domain information
>PRK05439 pantothenate kinase; Provisional Back     alignment and domain information
>KOG0652 consensus 26S proteasome regulatory complex, ATPase RPT5 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03246 ABCC_Protease_Secretion This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain Back     alignment and domain information
>CHL00081 chlI Mg-protoporyphyrin IX chelatase Back     alignment and domain information
>cd03230 ABC_DR_subfamily_A This family of ATP-binding proteins belongs to a multisubunit transporter involved in drug resistance (BcrA and DrrA), nodulation, lipid transport, and lantibiotic immunity Back     alignment and domain information
>PRK05922 type III secretion system ATPase; Validated Back     alignment and domain information
>COG0465 HflB ATP-dependent Zn proteases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1066 Sms Predicted ATP-dependent serine protease [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14723 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>COG2842 Uncharacterized ATPase, putative transposase [General function prediction only] Back     alignment and domain information
>PRK08927 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>PF00910 RNA_helicase: RNA helicase; InterPro: IPR000605 Helicases have been classified in 5 superfamilies (SF1-SF5) Back     alignment and domain information
>TIGR02030 BchI-ChlI magnesium chelatase ATPase subunit I Back     alignment and domain information
>PF12775 AAA_7: P-loop containing dynein motor region D3; PDB: 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A 3VKH_A 3VKG_A Back     alignment and domain information
>TIGR02322 phosphon_PhnN phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN Back     alignment and domain information
>cd00227 CPT Chloramphenicol (Cm) phosphotransferase (CPT) Back     alignment and domain information
>COG1419 FlhF Flagellar GTP-binding protein [Cell motility and secretion] Back     alignment and domain information
>PRK07594 type III secretion system ATPase SsaN; Validated Back     alignment and domain information
>PRK06936 type III secretion system ATPase; Provisional Back     alignment and domain information
>cd03223 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette transporter (Pat) is involved in the import of very long-chain fatty acids (VLCFA) into the peroxisome Back     alignment and domain information
>cd00984 DnaB_C DnaB helicase C terminal domain Back     alignment and domain information
>PRK10536 hypothetical protein; Provisional Back     alignment and domain information
>cd02021 GntK Gluconate kinase (GntK) catalyzes the phosphoryl transfer from ATP to gluconate Back     alignment and domain information
>TIGR02655 circ_KaiC circadian clock protein KaiC Back     alignment and domain information
>PRK12597 F0F1 ATP synthase subunit beta; Provisional Back     alignment and domain information
>cd02024 NRK1 Nicotinamide riboside kinase (NRK) is an enzyme involved in the metabolism of nicotinamide adenine dinucleotide (NAD+) Back     alignment and domain information
>PRK05022 anaerobic nitric oxide reductase transcription regulator; Provisional Back     alignment and domain information
>cd01134 V_A-ATPase_A V/A-type ATP synthase catalytic subunit A Back     alignment and domain information
>TIGR00764 lon_rel lon-related putative ATP-dependent protease Back     alignment and domain information
>COG0467 RAD55 RecA-superfamily ATPases implicated in signal transduction [Signal transduction mechanisms] Back     alignment and domain information
>cd01122 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' helicases Back     alignment and domain information
>COG1121 ZnuC ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF07726 AAA_3: ATPase family associated with various cellular activities (AAA); InterPro: IPR011703 This entry includes some of the AAA proteins not detected by the IPR003959 from INTERPRO model Back     alignment and domain information
>PRK05201 hslU ATP-dependent protease ATP-binding subunit HslU; Provisional Back     alignment and domain information
>TIGR03263 guanyl_kin guanylate kinase Back     alignment and domain information
>PTZ00185 ATPase alpha subunit; Provisional Back     alignment and domain information
>cd01136 ATPase_flagellum-secretory_path_III Flagellum-specific ATPase/type III secretory pathway virulence-related protein Back     alignment and domain information
>TIGR03575 selen_PSTK_euk L-seryl-tRNA(Sec) kinase, eukaryotic Back     alignment and domain information
>PRK09302 circadian clock protein KaiC; Reviewed Back     alignment and domain information
>PRK10751 molybdopterin-guanine dinucleotide biosynthesis protein B; Provisional Back     alignment and domain information
>TIGR03880 KaiC_arch_3 KaiC domain protein, AF_0351 family Back     alignment and domain information
>TIGR03305 alt_F1F0_F1_bet alternate F1F0 ATPase, F1 subunit beta Back     alignment and domain information
>cd02028 UMPK_like Uridine monophosphate kinase_like (UMPK_like) is a family of proteins highly similar to the uridine monophosphate kinase (UMPK, EC 2 Back     alignment and domain information
>TIGR02329 propionate_PrpR propionate catabolism operon regulatory protein PrpR Back     alignment and domain information
>PRK09302 circadian clock protein KaiC; Reviewed Back     alignment and domain information
>cd02020 CMPK Cytidine monophosphate kinase (CMPK) catalyzes the reversible phosphorylation of cytidine monophosphate (CMP) to produce cytidine diphosphate (CDP), using ATP as the preferred phosphoryl donor Back     alignment and domain information
>COG1124 DppF ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR00150 HI0065_YjeE ATPase, YjeE family Back     alignment and domain information
>KOG3347 consensus Predicted nucleotide kinase/nuclear protein involved oxidative stress response [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK10463 hydrogenase nickel incorporation protein HypB; Provisional Back     alignment and domain information
>KOG1532 consensus GTPase XAB1, interacts with DNA repair protein XPA [Replication, recombination and repair] Back     alignment and domain information
>PRK10416 signal recognition particle-docking protein FtsY; Provisional Back     alignment and domain information
>cd03228 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export Back     alignment and domain information
>PF13086 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A Back     alignment and domain information
>cd01129 PulE-GspE PulE/GspE The type II secretory pathway is the main terminal branch of the general secretory pathway (GSP) Back     alignment and domain information
>PF08477 Miro: Miro-like protein; InterPro: IPR013684 Mitochondrial Rho proteins (Miro-1, Q8IXI2 from SWISSPROT and Miro-2, Q8IXI1 from SWISSPROT) are atypical Rho GTPases Back     alignment and domain information
>TIGR00073 hypB hydrogenase accessory protein HypB Back     alignment and domain information
>PRK13947 shikimate kinase; Provisional Back     alignment and domain information
>COG1703 ArgK Putative periplasmic protein kinase ArgK and related GTPases of G3E family [Amino acid transport and metabolism] Back     alignment and domain information
>PF03193 DUF258: Protein of unknown function, DUF258; InterPro: IPR004881 This entry contains Escherichia coli (strain K12) RsgA, which may play a role in 30S ribosomal subunit biogenesis Back     alignment and domain information
>PRK06851 hypothetical protein; Provisional Back     alignment and domain information
>cd00267 ABC_ATPase ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>PF00625 Guanylate_kin: Guanylate kinase; InterPro: IPR008144 Guanylate kinase (2 Back     alignment and domain information
>PRK13407 bchI magnesium chelatase subunit I; Provisional Back     alignment and domain information
>PRK00300 gmk guanylate kinase; Provisional Back     alignment and domain information
>PF13479 AAA_24: AAA domain Back     alignment and domain information
>PF06309 Torsin: Torsin; InterPro: IPR010448 This family consists of several eukaryotic torsin proteins Back     alignment and domain information
>TIGR00416 sms DNA repair protein RadA Back     alignment and domain information
>PF13245 AAA_19: Part of AAA domain Back     alignment and domain information
>PRK12339 2-phosphoglycerate kinase; Provisional Back     alignment and domain information
>PRK13949 shikimate kinase; Provisional Back     alignment and domain information
>PRK11823 DNA repair protein RadA; Provisional Back     alignment and domain information
>TIGR01313 therm_gnt_kin carbohydrate kinase, thermoresistant glucokinase family Back     alignment and domain information
>TIGR00708 cobA cob(I)alamin adenosyltransferase Back     alignment and domain information
>PRK10078 ribose 1,5-bisphosphokinase; Provisional Back     alignment and domain information
>PRK14530 adenylate kinase; Provisional Back     alignment and domain information
>TIGR01420 pilT_fam pilus retraction protein PilT Back     alignment and domain information
>COG1936 Predicted nucleotide kinase (related to CMP and AMP kinases) [Nucleotide transport and metabolism] Back     alignment and domain information
>COG1428 Deoxynucleoside kinases [Nucleotide transport and metabolism] Back     alignment and domain information
>PF03308 ArgK: ArgK protein; InterPro: IPR005129 Bacterial periplasmic transport systems require the function of a specific substrate-binding protein, located in the periplasm, and several cytoplasmic membrane transport components Back     alignment and domain information
>TIGR03496 FliI_clade1 flagellar protein export ATPase FliI Back     alignment and domain information
>TIGR01040 V-ATPase_V1_B V-type (H+)-ATPase V1, B subunit Back     alignment and domain information
>cd00464 SK Shikimate kinase (SK) is the fifth enzyme in the shikimate pathway, a seven-step biosynthetic pathway which converts erythrose-4-phosphate to chorismic acid, found in bacteria, fungi and plants Back     alignment and domain information
>PF03266 NTPase_1: NTPase; InterPro: IPR004948 This entry represents a family of nucleoside-triphosphatases which have activity towards ATP, GTP, CTP, TTP and UTP and may hydrolyse nucleoside diphosphates with lower efficiency [] Back     alignment and domain information
>PRK14737 gmk guanylate kinase; Provisional Back     alignment and domain information
>PRK09099 type III secretion system ATPase; Provisional Back     alignment and domain information
>cd00071 GMPK Guanosine monophosphate kinase (GMPK, EC 2 Back     alignment and domain information
>PF00158 Sigma54_activat: Sigma-54 interaction domain; InterPro: IPR002078 Some bacterial regulatory proteins activate the expression of genes from promoters recognised by core RNA polymerase associated with the alternative sigma-54 factor Back     alignment and domain information
>PRK07132 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK14529 adenylate kinase; Provisional Back     alignment and domain information
>PF02562 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH is a cytoplasmic protein and predicted ATPase that is induced by phosphate starvation and belongings to the phosphate regulon (pho) in Escherichia coli [] Back     alignment and domain information
>PRK09280 F0F1 ATP synthase subunit beta; Validated Back     alignment and domain information
>COG3640 CooC CO dehydrogenase maturation factor [Cell division and chromosome partitioning] Back     alignment and domain information
>PRK15453 phosphoribulokinase; Provisional Back     alignment and domain information
>PRK07721 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>PRK06820 type III secretion system ATPase; Validated Back     alignment and domain information
>PRK05057 aroK shikimate kinase I; Reviewed Back     alignment and domain information
>cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth Back     alignment and domain information
>PRK06793 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>TIGR01039 atpD ATP synthase, F1 beta subunit Back     alignment and domain information
>PRK13948 shikimate kinase; Provisional Back     alignment and domain information
>COG0714 MoxR-like ATPases [General function prediction only] Back     alignment and domain information
>PRK05688 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>KOG0736 consensus Peroxisome assembly factor 2 containing the AAA+-type ATPase domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK07196 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>cd03213 ABCG_EPDR ABCG transporters are involved in eye pigment (EP) precursor transport, regulation of lipid-trafficking mechanisms, and pleiotropic drug resistance (DR) Back     alignment and domain information
>PRK14738 gmk guanylate kinase; Provisional Back     alignment and domain information
>TIGR01650 PD_CobS cobaltochelatase, CobS subunit Back     alignment and domain information
>PLN02200 adenylate kinase family protein Back     alignment and domain information
>PRK11388 DNA-binding transcriptional regulator DhaR; Provisional Back     alignment and domain information
>TIGR00455 apsK adenylylsulfate kinase (apsK) Back     alignment and domain information
>COG0055 AtpD F0F1-type ATP synthase, beta subunit [Energy production and conversion] Back     alignment and domain information
>PRK13946 shikimate kinase; Provisional Back     alignment and domain information
>TIGR01069 mutS2 MutS2 family protein Back     alignment and domain information
>PRK06761 hypothetical protein; Provisional Back     alignment and domain information
>PRK13975 thymidylate kinase; Provisional Back     alignment and domain information
>cd00820 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPCK), a critical gluconeogenic enzyme, catalyzes the first committed step in the diversion of tricarboxylic acid cycle intermediates toward gluconeogenesis Back     alignment and domain information
>cd01672 TMPK Thymidine monophosphate kinase (TMPK), also known as thymidylate kinase, catalyzes the phosphorylation of thymidine monophosphate (TMP) to thymidine diphosphate (TDP) utilizing ATP as its preferred phophoryl donor Back     alignment and domain information
>cd01125 repA Hexameric Replicative Helicase RepA Back     alignment and domain information
>PRK04182 cytidylate kinase; Provisional Back     alignment and domain information
>TIGR02546 III_secr_ATP type III secretion apparatus H+-transporting two-sector ATPase Back     alignment and domain information
>KOG0651 consensus 26S proteasome regulatory complex, ATPase RPT4 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13521 AAA_28: AAA domain; PDB: 1LW7_A Back     alignment and domain information
>TIGR03497 FliI_clade2 flagellar protein export ATPase FliI Back     alignment and domain information
>COG3598 RepA RecA-family ATPase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK14532 adenylate kinase; Provisional Back     alignment and domain information
>TIGR00176 mobB molybdopterin-guanine dinucleotide biosynthesis protein MobB Back     alignment and domain information
>PRK09825 idnK D-gluconate kinase; Provisional Back     alignment and domain information
>PF03215 Rad17: Rad17 cell cycle checkpoint protein Back     alignment and domain information
>COG0003 ArsA Predicted ATPase involved in chromosome partitioning [Cell division and chromosome partitioning] Back     alignment and domain information
>COG0194 Gmk Guanylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>TIGR01041 ATP_syn_B_arch ATP synthase archaeal, B subunit Back     alignment and domain information
>COG2274 SunT ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms] Back     alignment and domain information
>cd01428 ADK Adenylate kinase (ADK) catalyzes the reversible phosphoryl transfer from adenosine triphosphates (ATP) to adenosine monophosphates (AMP) and to yield adenosine diphosphates (ADP) Back     alignment and domain information
>PRK08472 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>TIGR02868 CydC thiol reductant ABC exporter, CydC subunit Back     alignment and domain information
>COG1116 TauB ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK06731 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>PF03969 AFG1_ATPase: AFG1-like ATPase; InterPro: IPR005654 ATPase family gene 1 (AFG1) ATPase is a 377 amino acid putative protein with an ATPase motif typical of the protein family including SEC18p PAS1, CDC48-VCP and TBP Back     alignment and domain information
>TIGR02173 cyt_kin_arch cytidylate kinase, putative Back     alignment and domain information
>PLN02165 adenylate isopentenyltransferase Back     alignment and domain information
>PF02374 ArsA_ATPase: Anion-transporting ATPase; PDB: 2WOO_A 3IBG_B 3SJA_A 3H84_B 3SJD_A 3ZS9_A 3A37_A 2WOJ_A 3SJC_B 3A36_B Back     alignment and domain information
>COG2884 FtsE Predicted ATPase involved in cell division [Cell division and chromosome partitioning] Back     alignment and domain information
>TIGR00041 DTMP_kinase thymidylate kinase Back     alignment and domain information
>TIGR03574 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal Back     alignment and domain information
>COG2019 AdkA Archaeal adenylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PF01078 Mg_chelatase: Magnesium chelatase, subunit ChlI; InterPro: IPR000523 Magnesium-chelatase is a three-component enzyme that catalyses the insertion of Mg2+ into protoporphyrin IX Back     alignment and domain information
>TIGR03600 phage_DnaB phage replicative helicase, DnaB family, HK022 subfamily Back     alignment and domain information
>PF03029 ATP_bind_1: Conserved hypothetical ATP binding protein; InterPro: IPR004130 Members of this family are found in a range of archaea and eukaryotes and have hypothesised ATP binding activity Back     alignment and domain information
>COG1100 GTPase SAR1 and related small G proteins [General function prediction only] Back     alignment and domain information
>PLN02348 phosphoribulokinase Back     alignment and domain information
>COG3854 SpoIIIAA ncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF00005 ABC_tran: ABC transporter This structure is on hold until Dec 1999; InterPro: IPR003439 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems Back     alignment and domain information
>CHL00059 atpA ATP synthase CF1 alpha subunit Back     alignment and domain information
>PF09848 DUF2075: Uncharacterized conserved protein (DUF2075); InterPro: IPR018647 This domain, found in putative ATP/GTP binding proteins, has no known function Back     alignment and domain information
>PRK03731 aroL shikimate kinase II; Reviewed Back     alignment and domain information
>PF06068 TIP49: TIP49 C-terminus; InterPro: IPR010339 This family consists of the C-terminal region of several eukaryotic and archaeal RuvB-like 1 (Pontin or TIP49a) and RuvB-like 2 (Reptin or TIP49b) proteins Back     alignment and domain information
>PRK13343 F0F1 ATP synthase subunit alpha; Provisional Back     alignment and domain information
>COG4088 Predicted nucleotide kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>TIGR03324 alt_F1F0_F1_al alternate F1F0 ATPase, F1 subunit alpha Back     alignment and domain information
>TIGR01026 fliI_yscN ATPase FliI/YscN family Back     alignment and domain information
>PRK13695 putative NTPase; Provisional Back     alignment and domain information
>PHA02530 pseT polynucleotide kinase; Provisional Back     alignment and domain information
>COG1157 FliI Flagellar biosynthesis/type III secretory pathway ATPase [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>CHL00060 atpB ATP synthase CF1 beta subunit Back     alignment and domain information
>PRK14531 adenylate kinase; Provisional Back     alignment and domain information
>PRK10875 recD exonuclease V subunit alpha; Provisional Back     alignment and domain information
>TIGR01287 nifH nitrogenase iron protein Back     alignment and domain information
>TIGR00665 DnaB replicative DNA helicase Back     alignment and domain information
>smart00178 SAR Sar1p-like members of the Ras-family of small GTPases Back     alignment and domain information
>PF01926 MMR_HSR1: 50S ribosome-binding GTPase; InterPro: IPR002917 Human HSR1, has been localized to the human MHC class I region and is highly homologous to a putative GTP-binding protein, MMR1 from mouse Back     alignment and domain information
>KOG0735 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd02022 DPCK Dephospho-coenzyme A kinase (DPCK, EC 2 Back     alignment and domain information
>cd02029 PRK_like Phosphoribulokinase-like (PRK-like) is a family of proteins similar to phosphoribulokinase (PRK), the enzyme involved in the Benson-Calvin cycle in chloroplasts or photosynthetic prokaryotes Back     alignment and domain information
>PRK07960 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>COG0237 CoaE Dephospho-CoA kinase [Coenzyme metabolism] Back     alignment and domain information
>PRK08356 hypothetical protein; Provisional Back     alignment and domain information
>cd04139 RalA_RalB RalA/RalB subfamily Back     alignment and domain information
>PRK00409 recombination and DNA strand exchange inhibitor protein; Reviewed Back     alignment and domain information
>COG0703 AroK Shikimate kinase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK06851 hypothetical protein; Provisional Back     alignment and domain information
>cd03282 ABC_MSH4_euk MutS4 homolog in eukaryotes Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query359
2a5y_B 549 CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis 4e-38
1z6t_A 591 APAF-1, apoptotic protease activating factor 1; ca 3e-33
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-26
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-04
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 8e-14
>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Length = 549 Back     alignment and structure
 Score =  142 bits (358), Expect = 4e-38
 Identities = 53/396 (13%), Positives = 113/396 (28%), Gaps = 46/396 (11%)

Query: 2   KNLERVLQEFNSQKEDIEATLKAEGDRGKKPRTEVKNWLQNVQRINSKAQSIEQEVKKRK 61
           ++    L+  N   ED    +     R ++    + N+L+  +R  S+   +        
Sbjct: 24  RDALTYLEGKNIFTEDHSELISKMSTRLER----IANFLRIYRRQASELGPLIDFFNYNN 79

Query: 62  YFLCARLGKDVDAKIQEMKDCHQKGC---SFISLVIDAPPSSGLILPTTTLVG-ENTKKI 117
               A   +D         D  +       F   ++D     G +    T    E     
Sbjct: 80  QSHLADFLEDYIDFAINEPDLLRPVVIAPQFSRQMLDRKLLLGNVPKQMTCYIREYHVDR 139

Query: 118 VKKVWEDLMGDKVTKIGVWGMGGFGKTAIMRHI-NNRPQEETNEFSDVIWVTVSQPL--- 173
           V K  +++       + + G  G GK+ I     +   Q     +  ++W+  S      
Sbjct: 140 VIKKLDEMCDLDSFFLFLHGRAGSGKSVIASQALSKSDQLIGINYDSIVWLKDSGTAPKS 199

Query: 174 ------DLVKLQAEIAMALKLSLTEDEDKVSRARRLLGKLKAKKKFVLILDDIDNHTFCW 227
                 D++ +       L     E    V   R +   L  +   + + DD+       
Sbjct: 200 TFDLFTDILLMLKSEDDLLNFPSVEHVTSVVLKRMICNALIDRPNTLFVFDDVVQEETIR 259

Query: 228 GLRSMGC-------------------EEVRVPPLSKEEALNLFLDKVGRNILHVPTLNEE 268
             + +                     E + V  L  +E  +            V    E+
Sbjct: 260 WAQELRLRCLVTTRDVEISNAASQTCEFIEVTSLEIDECYDFLEAYGMPM--PVGEKEED 317

Query: 269 IINSVVEECAGLQLAIFTVVGCM---RGVDEIHEWRNALN--ELRGLVRSFSGINADVLG 323
           ++N  +E  +G    +  +       +  +++ +  N L    L G+          +  
Sbjct: 318 VLNKTIELSSGNPATL-MMFFKSCEPKTFEKMAQLNNKLESRGLVGVECITPYSYKSLAM 376

Query: 324 RLEFSYLRLKDKKVQHCFLYCALYPEDFAISKDELI 359
            L+     L D + +    +  + P    I      
Sbjct: 377 ALQRCVEVLSD-EDRSALAFAVVMPPGVDIPVKLWS 411


>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Length = 591 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Length = 1249 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query359
2a5y_B 549 CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis 100.0
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 100.0
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 100.0
1z6t_A 591 APAF-1, apoptotic protease activating factor 1; ca 99.98
2fna_A357 Conserved hypothetical protein; structural genomic 99.56
2qen_A350 Walker-type ATPase; unknown function; HET: ADP; 2. 99.54
1w5s_A412 Origin recognition complex subunit 2 ORC2; replica 99.53
2qby_A386 CDC6 homolog 1, cell division control protein 6 ho 99.41
2qby_B384 CDC6 homolog 3, cell division control protein 6 ho 99.39
2v1u_A387 Cell division control protein 6 homolog; DNA repli 99.38
1fnn_A389 CDC6P, cell division control protein 6; ORC1, AAA 99.37
1njg_A250 DNA polymerase III subunit gamma; rossman-like fol 99.33
2chg_A226 Replication factor C small subunit; DNA-binding pr 99.32
3qfl_A115 MLA10; coiled-coil, (CC) domain, NLRS, nucleotide- 99.18
1sxj_B323 Activator 1 37 kDa subunit; clamp loader, processi 99.13
1iqp_A327 RFCS; clamp loader, extended AAA-ATPase domain, co 98.99
3te6_A318 Regulatory protein SIR3; heterochromatin, gene sil 98.92
2chq_A319 Replication factor C small subunit; DNA-binding pr 98.85
1jbk_A195 CLPB protein; beta barrel, chaperone; 1.80A {Esche 98.84
1hqc_A324 RUVB; extended AAA-ATPase domain, complex with nuc 98.82
1jr3_A373 DNA polymerase III subunit gamma; processivity, pr 98.79
1sxj_D353 Activator 1 41 kDa subunit; clamp loader, processi 98.74
3bos_A242 Putative DNA replication factor; P-loop containing 98.69
3pvs_A 447 Replication-associated recombination protein A; ma 98.62
3h4m_A285 Proteasome-activating nucleotidase; ATPase, PAN, A 98.6
2z4s_A440 Chromosomal replication initiator protein DNAA; AA 98.58
1sxj_E354 Activator 1 40 kDa subunit; clamp loader, processi 98.57
1sxj_A 516 Activator 1 95 kDa subunit; clamp loader, processi 98.56
3uk6_A368 RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding 98.52
3pfi_A338 Holliday junction ATP-dependent DNA helicase RUVB; 98.48
1l8q_A324 Chromosomal replication initiator protein DNAA; AA 98.42
3d8b_A357 Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s 98.42
1xwi_A322 SKD1 protein; VPS4B, AAA ATPase, protein transport 98.41
2qz4_A262 Paraplegin; AAA+, SPG7, protease, ADP, structural 98.41
1a5t_A334 Delta prime, HOLB; zinc finger, DNA replication; 2 98.41
2p65_A187 Hypothetical protein PF08_0063; CLPB, malaria, str 98.4
1sxj_C340 Activator 1 40 kDa subunit; clamp loader, processi 98.39
3u61_B324 DNA polymerase accessory protein 44; AAA+, ATP hyd 98.38
3b9p_A297 CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc 98.34
3eie_A322 Vacuolar protein sorting-associated protein 4; AAA 98.33
1d2n_A272 N-ethylmaleimide-sensitive fusion protein; hexamer 98.3
2qp9_X355 Vacuolar protein sorting-associated protein 4; ATP 98.28
3vfd_A389 Spastin; ATPase, microtubule severing, hydrolase; 98.27
4b4t_J405 26S protease regulatory subunit 8 homolog; hydrola 98.21
2w58_A202 DNAI, primosome component (helicase loader); ATP-b 98.2
3pxg_A468 Negative regulator of genetic competence CLPC/MEC; 98.18
3syl_A309 Protein CBBX; photosynthesis, rubisco activase, AA 98.17
2zan_A444 Vacuolar protein sorting-associating protein 4B; S 98.17
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 98.15
3n70_A145 Transport activator; sigma-54, ntpase, PSI, MCSG, 98.15
4b4t_L437 26S protease subunit RPT4; hydrolase, AAA-atpases, 98.13
4b4t_I437 26S protease regulatory subunit 4 homolog; hydrola 98.12
1qvr_A 854 CLPB protein; coiled coil, AAA ATPase, chaperone; 98.12
4b4t_H467 26S protease regulatory subunit 7 homolog; hydrola 98.09
3cf0_A301 Transitional endoplasmic reticulum ATPase; AAA, P9 98.08
1lv7_A257 FTSH; alpha/beta domain, four helix bundle, hydrol 98.07
4b4t_M434 26S protease regulatory subunit 6A; hydrolase, AAA 98.07
1r6b_X 758 CLPA protein; AAA+, N-terminal domain, CLPS, cryst 98.04
4b4t_K428 26S protease regulatory subunit 6B homolog; hydrol 97.99
3pxi_A 758 Negative regulator of genetic competence CLPC/MEC; 97.97
2gno_A305 DNA polymerase III, gamma subunit-related protein; 97.89
3hu3_A489 Transitional endoplasmic reticulum ATPase; VCP, tr 97.86
1in4_A334 RUVB, holliday junction DNA helicase RUVB; AAA+-cl 97.85
3cf2_A 806 TER ATPase, transitional endoplasmic reticulum ATP 97.84
2ce7_A 476 Cell division protein FTSH; metalloprotease; HET: 97.8
3co5_A143 Putative two-component system transcriptional RES 97.71
4fcw_A311 Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 97.69
1ojl_A304 Transcriptional regulatory protein ZRAR; response 97.68
2kjq_A149 DNAA-related protein; solution structure, NESG, st 97.68
2vhj_A331 Ntpase P4, P4; non- hydrolysable ATP analogue, hyd 97.4
3hr8_A356 Protein RECA; alpha and beta proteins (A/B, A+B), 97.37
2qgz_A308 Helicase loader, putative primosome component; str 97.35
1n0w_A243 DNA repair protein RAD51 homolog 1; DNA repair, ho 97.35
2z43_A324 DNA repair and recombination protein RADA; archaea 97.33
1ypw_A 806 Transitional endoplasmic reticulum ATPase; AAA, P9 97.32
3io5_A333 Recombination and repair protein; storage dimer, i 97.27
3pxi_A758 Negative regulator of genetic competence CLPC/MEC; 97.27
1v5w_A343 DMC1, meiotic recombination protein DMC1/LIM15 hom 97.27
2cvh_A220 DNA repair and recombination protein RADB; filamen 97.24
2i1q_A322 DNA repair and recombination protein RADA; ATPase, 97.21
2zr9_A349 Protein RECA, recombinase A; recombination, RECA m 97.21
2w0m_A235 SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus 97.2
1xp8_A366 RECA protein, recombinase A; recombination, radior 97.18
1u94_A356 RECA protein, recombinase A; homologous recombinat 97.09
3t15_A293 Ribulose bisphosphate carboxylase/oxygenase activ 97.01
3dm5_A 443 SRP54, signal recognition 54 kDa protein; protein- 96.97
3c8u_A208 Fructokinase; YP_612366.1, putative fructose trans 96.92
2r62_A268 Cell division protease FTSH homolog; ATPase domain 96.85
4a74_A231 DNA repair and recombination protein RADA; hydrola 96.85
1ofh_A310 ATP-dependent HSL protease ATP-binding subunit HSL 96.85
2bjv_A265 PSP operon transcriptional activator; AAA, transcr 96.79
3m6a_A 543 ATP-dependent protease LA 1; alpha, beta, ATP-bind 96.78
2px0_A296 Flagellar biosynthesis protein FLHF; SRP GTPase, f 96.77
3bh0_A315 DNAB-like replicative helicase; ATPase, replicatio 96.74
3lda_A400 DNA repair protein RAD51; DNA binding protein, ATP 96.73
3ice_A422 Transcription termination factor RHO; transcriptio 96.71
3kl4_A 433 SRP54, signal recognition 54 kDa protein; signal r 96.68
1qhx_A178 CPT, protein (chloramphenicol phosphotransferase); 96.66
1r6b_X758 CLPA protein; AAA+, N-terminal domain, CLPS, cryst 96.64
2x8a_A274 Nuclear valosin-containing protein-like; nuclear p 96.62
3lw7_A179 Adenylate kinase related protein (ADKA-like); AMP, 96.6
2r6a_A454 DNAB helicase, replicative helicase; replication, 96.6
3kb2_A173 SPBC2 prophage-derived uncharacterized protein YOR 96.59
2xxa_A 433 Signal recognition particle protein; protein trans 96.59
1rz3_A201 Hypothetical protein rbstp0775; MCSG, structural g 96.57
1vma_A306 Cell division protein FTSY; TM0570, structural gen 96.57
2c9o_A 456 RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP- 96.56
1sky_E473 F1-ATPase, F1-ATP synthase; F1FO ATP synthase, alp 96.54
1ly1_A181 Polynucleotide kinase; PNK, phosphatase, transfera 96.53
2dr3_A247 UPF0273 protein PH0284; RECA superfamily ATPase, h 96.53
1g8p_A350 Magnesium-chelatase 38 kDa subunit; parallel beta 96.52
2q6t_A444 DNAB replication FORK helicase; hydrolase; 2.90A { 96.51
1ixz_A254 ATP-dependent metalloprotease FTSH; AAA domain fol 96.5
4a1f_A338 DNAB helicase, replicative DNA helicase; hydrolase 96.48
1zp6_A191 Hypothetical protein ATU3015; alpha-beta protein., 96.48
1fx0_B498 ATP synthase beta chain; latent ATPase, thermal st 96.47
3uie_A200 Adenylyl-sulfate kinase 1, chloroplastic; rossmann 96.47
1kag_A173 SKI, shikimate kinase I; transferase, structural g 96.44
3vaa_A199 Shikimate kinase, SK; structural genomics, center 96.44
2b8t_A223 Thymidine kinase; deoxyribonucleoside kinase, zinc 96.43
4eun_A200 Thermoresistant glucokinase; putative sugar kinase 96.42
3trf_A185 Shikimate kinase, SK; amino acid biosynthesis, tra 96.42
1kgd_A180 CASK, peripheral plasma membrane CASK; maguk, guan 96.4
2ck3_D482 ATP synthase subunit beta\, mitochondrial; hydrola 96.38
1pzn_A349 RAD51, DNA repair and recombination protein RAD51, 96.37
2r44_A331 Uncharacterized protein; putative ATPase, structur 96.36
2hf9_A226 Probable hydrogenase nickel incorporation protein 96.32
3cmu_A 2050 Protein RECA, recombinase A; homologous recombinat 96.31
1iy2_A278 ATP-dependent metalloprotease FTSH; AAA domain fol 96.31
3t61_A202 Gluconokinase; PSI-biology, structural genomics, p 96.31
1ex7_A186 Guanylate kinase; substrate-induced FIT, domain mo 96.3
3tau_A208 Guanylate kinase, GMP kinase; structural genomics, 96.27
1nks_A194 Adenylate kinase; thermophilic, transferase; HET: 96.27
2rhm_A193 Putative kinase; P-loop containing nucleoside trip 96.26
3e70_C328 DPA, signal recognition particle receptor; FTSY, S 96.26
2ffh_A425 Protein (FFH); SRP54, signal recognition particle, 96.25
2wsm_A221 Hydrogenase expression/formation protein (HYPB); m 96.25
1odf_A290 YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser 96.25
1qvr_A854 CLPB protein; coiled coil, AAA ATPase, chaperone; 96.24
1uf9_A203 TT1252 protein; P-loop, nucleotide binding domain, 96.24
3iij_A180 Coilin-interacting nuclear ATPase protein; alpha a 96.23
1kht_A192 Adenylate kinase; phosphotransferase, signaling pr 96.22
3nbx_X 500 ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structu 96.22
2yvu_A186 Probable adenylyl-sulfate kinase; transferase, str 96.22
3hws_A363 ATP-dependent CLP protease ATP-binding subunit CL; 96.2
1y63_A184 LMAJ004144AAA protein; structural genomics, protei 96.2
1knq_A175 Gluconate kinase; ALFA/beta structure, transferase 96.19
3tr0_A205 Guanylate kinase, GMP kinase; purines, pyrimidines 96.18
2qor_A204 Guanylate kinase; phosphotransferase, purine metab 96.14
1tev_A196 UMP-CMP kinase; ploop, NMP binding region, LID reg 96.14
1via_A175 Shikimate kinase; structural genomics, transferase 96.13
3asz_A211 Uridine kinase; cytidine phosphorylation, transfer 96.13
3a00_A186 Guanylate kinase, GMP kinase; domain movement, dim 96.13
1j8m_F297 SRP54, signal recognition 54 kDa protein; signalin 96.12
3cf2_A806 TER ATPase, transitional endoplasmic reticulum ATP 96.12
2iyv_A184 Shikimate kinase, SK; transferase, aromatic amino 96.12
1zuh_A168 Shikimate kinase; alpha-beta protein, transferase; 96.11
2c95_A196 Adenylate kinase 1; transferase, AP4A, nucleotide 96.11
2bdt_A189 BH3686; alpha-beta protein, structural genomics, P 96.1
2jaq_A205 Deoxyguanosine kinase; transferase, deoxyribonucle 96.1
2ga8_A 359 Hypothetical 39.9 kDa protein; YFR007W, YFH7, unkn 96.09
1gvn_B287 Zeta; postsegregational killing system, plasmid; 1 96.09
2j41_A207 Guanylate kinase; GMP, GMK, transferase, ATP-bindi 96.08
1um8_A376 ATP-dependent CLP protease ATP-binding subunit CL; 96.07
1ukz_A203 Uridylate kinase; transferase; HET: ADP AMP; 1.90A 96.07
2j37_W 504 Signal recognition particle 54 kDa protein (SRP54) 96.07
2ze6_A253 Isopentenyl transferase; crown GALL tumor, cytokin 96.07
2if2_A204 Dephospho-COA kinase; alpha-beta protein, structur 96.06
2dhr_A 499 FTSH; AAA+ protein, hexameric Zn metalloprotease, 96.05
4gp7_A171 Metallophosphoesterase; polynucleotide kinase phos 96.04
1cke_A227 CK, MSSA, protein (cytidine monophosphate kinase); 96.03
2bwj_A199 Adenylate kinase 5; phosphoryl transfer reaction, 96.02
2qt1_A207 Nicotinamide riboside kinase 1; non-protein kinase 96.02
1e6c_A173 Shikimate kinase; phosphoryl transfer, ADP, shikim 96.01
1jjv_A206 Dephospho-COA kinase; P-loop nucleotide-binding fo 96.01
1qf9_A194 UMP/CMP kinase, protein (uridylmonophosphate/cytid 96.0
1ye8_A178 Protein THEP1, hypothetical UPF0334 kinase-like pr 95.97
3cm0_A186 Adenylate kinase; ATP-binding, cytoplasm, nucleoti 95.97
2cdn_A201 Adenylate kinase; phosphoryl transfer, associative 95.96
2vli_A183 Antibiotic resistance protein; transferase, tunica 95.96
1q57_A503 DNA primase/helicase; dntpase, DNA replication, tr 95.96
1ls1_A295 Signal recognition particle protein; FFH, SRP54, S 95.95
2plr_A213 DTMP kinase, probable thymidylate kinase; TMP-bind 95.94
3a4m_A260 L-seryl-tRNA(SEC) kinase; P-loop motif, walker A m 95.94
1lvg_A198 Guanylate kinase, GMP kinase; transferase; HET: AD 95.93
2bbw_A246 Adenylate kinase 4, AK4; nucleotide kinase, nucleo 95.93
3umf_A217 Adenylate kinase; rossmann fold, transferase; 2.05 95.91
2pt5_A168 Shikimate kinase, SK; aromatic amino acid biosynth 95.88
2pbr_A195 DTMP kinase, thymidylate kinase; transferase, nucl 95.86
1g5t_A196 COB(I)alamin adenosyltransferase; P-loop protein, 95.85
2p5t_B253 PEZT; postsegregational killing system, phosphoryl 95.85
2wwf_A212 Thymidilate kinase, putative; transferase, malaria 95.84
3zvl_A416 Bifunctional polynucleotide phosphatase/kinase; hy 95.83
1aky_A220 Adenylate kinase; ATP:AMP phosphotransferase, myok 95.82
1nn5_A215 Similar to deoxythymidylate kinase (thymidylate K; 95.81
1xjc_A169 MOBB protein homolog; structural genomics, midwest 95.8
1uj2_A252 Uridine-cytidine kinase 2; alpha/beta mononucleoti 95.8
3fwy_A314 Light-independent protochlorophyllide reductase I 95.8
3ney_A197 55 kDa erythrocyte membrane protein; structural ge 95.79
1znw_A207 Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans 95.78
2grj_A192 Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosp 95.78
2v54_A204 DTMP kinase, thymidylate kinase; nucleotide biosyn 95.75
1jr3_D343 DNA polymerase III, delta subunit; processivity, p 95.74
3cmu_A 2050 Protein RECA, recombinase A; homologous recombinat 95.74
1zd8_A227 GTP:AMP phosphotransferase mitochondrial; ATP:AMP 95.72
3upu_A 459 ATP-dependent DNA helicase DDA; RECA-like domain, 95.72
3fb4_A216 Adenylate kinase; psychrophIle, phosphotransferase 95.7
3l0o_A427 Transcription termination factor RHO; helicase, RH 95.69
2z0h_A197 DTMP kinase, thymidylate kinase; ATP-binding, nucl 95.69
3cmw_A 1706 Protein RECA, recombinase A; homologous recombinat 95.68
1z6g_A218 Guanylate kinase; structural genomics, SGC, struct 95.67
3aez_A312 Pantothenate kinase; transferase, homodimer, COA b 95.67
3tqc_A321 Pantothenate kinase; biosynthesis of cofactors, pr 95.65
2jeo_A245 Uridine-cytidine kinase 1; UCK, transferase, ATP-b 95.64
1zak_A222 Adenylate kinase; ATP:AMP-phosphotransferase, tran 95.63
2zts_A251 Putative uncharacterized protein PH0186; KAIC like 95.63
3dl0_A216 Adenylate kinase; phosphotransferase, zinc coordin 95.62
1rj9_A304 FTSY, signal recognition protein; SRP-GTPase domai 95.6
4e22_A252 Cytidylate kinase; P-loop, CMP/ATP binding, transf 95.6
1tue_A212 Replication protein E1; helicase, replication, E1E 95.58
1g41_A 444 Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dep 95.57
2qe7_A502 ATP synthase subunit alpha; blockage of ATP hydrol 95.56
2r9v_A515 ATP synthase subunit alpha; TM1612, structural gen 95.56
2f6r_A281 COA synthase, bifunctional coenzyme A synthase; 18 95.53
1s96_A219 Guanylate kinase, GMP kinase; E.coli, dimer, SAD, 95.53
2pez_A179 Bifunctional 3'-phosphoadenosine 5'- phosphosulfat 95.52
3tlx_A243 Adenylate kinase 2; structural genomics, structura 95.51
1htw_A158 HI0065; nucleotide-binding fold, structural genomi 95.5
1gtv_A214 TMK, thymidylate kinase; transferase, transferase 95.5
1vht_A218 Dephospho-COA kinase; structural genomics, transfe 95.47
2ehv_A251 Hypothetical protein PH0186; KAIC, RECA ATPase, un 95.45
1m7g_A211 Adenylylsulfate kinase; APS kinase, transferase, s 95.42
1a7j_A290 Phosphoribulokinase; transferase, calvin cycle; 2. 95.42
3p32_A355 Probable GTPase RV1496/MT1543; structural genomics 95.42
3vr4_D465 V-type sodium ATPase subunit D; V-ATPase, rotary m 95.4
3cmw_A1706 Protein RECA, recombinase A; homologous recombinat 95.38
3nwj_A250 ATSK2; P loop, shikimate, nucleoside monophosphate 95.36
3lnc_A231 Guanylate kinase, GMP kinase; ALS collaborative cr 95.36
3ake_A208 Cytidylate kinase; CMP kinase, CMP complex, open c 95.35
3a8t_A339 Adenylate isopentenyltransferase; rossmann fold pr 95.27
1np6_A174 Molybdopterin-guanine dinucleotide biosynthesis pr 95.25
2i3b_A189 HCR-ntpase, human cancer-related ntpase; AAA, ross 95.25
3k1j_A 604 LON protease, ATP-dependent protease LON; ATP-bind 95.24
2f1r_A171 Molybdopterin-guanine dinucleotide biosynthesis pr 95.23
1e4v_A214 Adenylate kinase; transferase(phosphotransferase); 95.22
3lv8_A236 DTMP kinase, thymidylate kinase; structural genomi 95.22
3be4_A217 Adenylate kinase; malaria, cryptosporidium parvum 95.21
1sq5_A308 Pantothenate kinase; P-loop, transferase; HET: PAU 95.21
2onk_A240 Molybdate/tungstate ABC transporter, ATP-binding p 95.2
3sr0_A206 Adenylate kinase; phosphoryl transfer analogue, AL 95.19
3bgw_A444 DNAB-like replicative helicase; ATPase, replicatio 95.17
2xb4_A223 Adenylate kinase; ATP-binding, nucleotide-binding, 95.16
3exa_A322 TRNA delta(2)-isopentenylpyrophosphate transferase 95.14
3tif_A235 Uncharacterized ABC transporter ATP-binding prote; 95.14
3d3q_A 340 TRNA delta(2)-isopentenylpyrophosphate transferase 95.13
3r20_A233 Cytidylate kinase; structural genomics, seattle st 95.12
2pcj_A224 ABC transporter, lipoprotein-releasing system ATP- 95.12
4tmk_A213 Protein (thymidylate kinase); ATP:DTMP phosphotran 95.11
1ak2_A233 Adenylate kinase isoenzyme-2; nucleoside monophosp 95.1
3b9q_A302 Chloroplast SRP receptor homolog, alpha subunit CP 95.08
1ltq_A301 Polynucleotide kinase; phosphatase, alpha/beta, P- 95.08
1cr0_A296 DNA primase/helicase; RECA-type protein fold, tran 95.08
3b85_A208 Phosphate starvation-inducible protein; PHOH2, ATP 95.03
3crm_A323 TRNA delta(2)-isopentenylpyrophosphate transferase 95.02
2ck3_A510 ATP synthase subunit alpha\, mitochondrial; hydrol 95.02
1oix_A191 RAS-related protein RAB-11A; small G protein, intr 94.98
2dyk_A161 GTP-binding protein; GTPase, ribosome-binding prot 94.97
2wji_A165 Ferrous iron transport protein B homolog; membrane 94.95
2cbz_A237 Multidrug resistance-associated protein 1; ABC pro 94.95
3gqb_B464 V-type ATP synthase beta chain; A3B3, V-ATPase, AT 94.94
1fx0_A 507 ATP synthase alpha chain; latent ATPase, thermal s 94.93
1yrb_A262 ATP(GTP)binding protein; GTPase, P-loop, rossman f 94.9
1b0u_A262 Histidine permease; ABC transporter, transport pro 94.89
2qmh_A205 HPR kinase/phosphorylase; V267F mutation, ATP-bind 94.88
3gfo_A275 Cobalt import ATP-binding protein CBIO 1; structur 94.87
4eaq_A229 DTMP kinase, thymidylate kinase; structural genomi 94.87
2zej_A184 Dardarin, leucine-rich repeat kinase 2; parkinson' 94.87
3ld9_A223 DTMP kinase, thymidylate kinase; ssgcid, NIH, niai 94.87
2c61_A469 A-type ATP synthase non-catalytic subunit B; hydro 94.84
2d2e_A250 SUFC protein; ABC-ATPase, SUF protein, 310-helix, 94.83
1fzq_A181 ADP-ribosylation factor-like protein 3; protein-GD 94.8
1ji0_A240 ABC transporter; ATP binding protein, structural g 94.8
1g6h_A257 High-affinity branched-chain amino acid transport 94.79
4g1u_C266 Hemin import ATP-binding protein HMUV; membrane tr 94.79
3foz_A316 TRNA delta(2)-isopentenylpyrophosphate transferas; 94.77
1nlf_A279 Regulatory protein REPA; replicative DNA helicase 94.77
4akg_A 2695 Glutathione S-transferase class-MU 26 kDa isozyme 94.77
2og2_A359 Putative signal recognition particle receptor; nuc 94.76
1sgw_A214 Putative ABC transporter; structural genomics, P p 94.76
3f9v_A595 Minichromosome maintenance protein MCM; replicativ 94.75
2pze_A229 Cystic fibrosis transmembrane conductance regulat; 94.75
2olj_A263 Amino acid ABC transporter; ABC domain, ATPase, hy 94.75
3oaa_A 513 ATP synthase subunit alpha; rossmann fold, hydrola 94.74
1u0j_A267 DNA replication protein; AAA+ protein, P-loop atpa 94.74
2ff7_A247 Alpha-hemolysin translocation ATP-binding protein 94.73
1zj6_A187 ADP-ribosylation factor-like protein 5; ARL, GTP-b 94.73
2zu0_C267 Probable ATP-dependent transporter SUFC; iron-sulf 94.73
2ce2_X166 GTPase HRAS; signaling protein, guanine nucleotide 94.72
2eyu_A261 Twitching motility protein PILT; pilus retraction 94.71
2ged_A193 SR-beta, signal recognition particle receptor beta 94.7
3end_A307 Light-independent protochlorophyllide reductase ir 94.7
1moz_A183 ARL1, ADP-ribosylation factor-like protein 1; GTP- 94.7
1mv5_A243 LMRA, multidrug resistance ABC transporter ATP-bin 94.69
2f9l_A199 RAB11B, member RAS oncogene family; RAB11B GTPase, 94.69
1zu4_A320 FTSY; GTPase, signal recognition particle, SRP, re 94.68
3mfy_A 588 V-type ATP synthase alpha chain; A-type ATP syntha 94.66
3io3_A 348 DEHA2D07832P; chaperone, membrane traffic, ATPase; 94.64
1vpl_A256 ABC transporter, ATP-binding protein; TM0544, stru 94.63
2ghi_A260 Transport protein; multidrug resistance protein, M 94.62
2wjg_A188 FEOB, ferrous iron transport protein B homolog; me 94.61
2ixe_A271 Antigen peptide transporter 1; ABC ATPase, hydrola 94.61
2lkc_A178 Translation initiation factor IF-2; NMR {Geobacill 94.6
2v9p_A305 Replication protein E1; AAA+ molecular motor, DNA 94.6
1z2a_A168 RAS-related protein RAB-23; RAB GTPase, vesicular 94.58
1q3t_A236 Cytidylate kinase; nucleotide monophosphate kinase 94.56
2qi9_C249 Vitamin B12 import ATP-binding protein BTUD; inner 94.55
2r8r_A228 Sensor protein; KDPD, PFAM02702, MCSG, structural 94.52
1svi_A195 GTP-binding protein YSXC; ENGB, GTPase, GDP, hydro 94.52
2yz2_A266 Putative ABC transporter ATP-binding protein TM_0; 94.52
3iqw_A334 Tail-anchored protein targeting factor GET3; ATPas 94.52
4edh_A213 DTMP kinase, thymidylate kinase; structural genomi 94.48
2nq2_C253 Hypothetical ABC transporter ATP-binding protein H 94.46
2ihy_A279 ABC transporter, ATP-binding protein; ATPase, ABC 94.46
1nrj_B218 SR-beta, signal recognition particle receptor beta 94.42
3con_A190 GTPase NRAS; structural genomics consortium, SGC, 94.41
2www_A349 Methylmalonic aciduria type A protein, mitochondri 94.4
1u8z_A168 RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNH 94.4
3geh_A462 MNME, tRNA modification GTPase MNME; G protein, U3 94.38
2nzj_A175 GTP-binding protein REM 1; GDP/GTP binding, GTP hy 94.37
3sop_A270 Neuronal-specific septin-3; hydrolase; HET: GDP; 2 94.37
2yhs_A503 FTSY, cell division protein FTSY; cell cycle, prot 94.37
1f6b_A198 SAR1; gtpases, N-terminal helix, Mg-containing com 94.37
2ocp_A241 DGK, deoxyguanosine kinase; protein-nucleotide com 94.36
3hjn_A197 DTMP kinase, thymidylate kinase; ATP-binding, nucl 94.34
2gj8_A172 MNME, tRNA modification GTPase TRME; G-domain dime 94.33
1svm_A377 Large T antigen; AAA+ fold, viral protein; HET: AT 94.33
2erx_A172 GTP-binding protein DI-RAS2; GTP hydrolysis, trans 94.26
3vr4_A 600 V-type sodium ATPase catalytic subunit A; V-ATPase 94.26
1z08_A170 RAS-related protein RAB-21; RAB GTPase, vesicular 94.25
1kao_A167 RAP2A; GTP-binding protein, small G protein, GDP, 94.25
3q72_A166 GTP-binding protein RAD; G-domain, CAV2 beta, sign 94.25
1c1y_A167 RAS-related protein RAP-1A; GTP-binding proteins, 94.24
1ek0_A170 Protein (GTP-binding protein YPT51); vesicular tra 94.24
1z0j_A170 RAB-22, RAS-related protein RAB-22A; RAB GTPase, R 94.21
1m7b_A184 RND3/RHOE small GTP-binding protein; small GTPase, 94.21
2vp4_A230 Deoxynucleoside kinase; ATP-binding, DNA synthesis 94.17
3pqc_A195 Probable GTP-binding protein ENGB; rossmann fold, 94.16
1ky3_A182 GTP-binding protein YPT7P; vesicular traffic, GTP 94.15
1nij_A318 Hypothetical protein YJIA; structural genomics, P- 94.13
3q85_A169 GTP-binding protein REM 2; G-domain, CAV2 beta, si 94.13
2pjz_A263 Hypothetical protein ST1066; ATP binding protein, 94.12
2v3c_C 432 SRP54, signal recognition 54 kDa protein; nucleoti 94.12
3ihw_A184 Centg3; RAS, centaurin, GTPase, structural genomic 94.11
2fn4_A181 P23, RAS-related protein R-RAS; GDP/GTP binding, G 94.09
1wms_A177 RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, p 94.08
3fvq_A359 Fe(3+) IONS import ATP-binding protein FBPC; nucle 94.07
1g16_A170 RAS-related protein SEC4; G protein RAB, signaling 94.06
2cxx_A190 Probable GTP-binding protein ENGB; structural geno 94.05
2b6h_A192 ADP-ribosylation factor 5; membrane trafficking, G 94.03
2hxs_A178 RAB-26, RAS-related protein RAB-28; GTPase, signal 94.01
2orw_A184 Thymidine kinase; TMTK, TP4A, transferase; HET: 4T 94.0
3c5c_A187 RAS-like protein 12; GDP, GTPase, structural genom 94.0
3kta_A182 Chromosome segregation protein SMC; structural mai 93.99
4gzl_A204 RAS-related C3 botulinum toxin substrate 1; rossma 93.99
1r2q_A170 RAS-related protein RAB-5A; GTPase, GNP, atomic re 93.98
3eph_A 409 TRNA isopentenyltransferase; transferase, alternat 93.98
1r8s_A164 ADP-ribosylation factor 1; protein transport/excha 93.96
1p5z_B263 DCK, deoxycytidine kinase; nucleoside kinase, P-lo 93.93
2h92_A219 Cytidylate kinase; rossmann fold, transferase; HET 93.93
1m2o_B190 GTP-binding protein SAR1, GTP binding protein; zin 93.92
1z0f_A179 RAB14, member RAS oncogene family; RAB GTPase, ves 93.91
2bbs_A290 Cystic fibrosis transmembrane conductance regulato 93.89
3nh6_A306 ATP-binding cassette SUB-family B member 6, mitoc; 93.89
1upt_A171 ARL1, ADP-ribosylation factor-like protein 1; hydr 93.89
3tw8_B181 RAS-related protein RAB-35; longin domain, RAB GTP 93.88
2axn_A 520 6-phosphofructo-2-kinase/fructose-2,6- biphosphata 93.88
4dsu_A189 GTPase KRAS, isoform 2B; small G-protein, signalin 93.87
1ksh_A186 ARF-like protein 2; small GTPase, small GTP-bindin 93.86
3kkq_A183 RAS-related protein M-RAS; GTP-binding, GTPase, si 93.85
2bme_A186 RAB4A, RAS-related protein RAB4A; GTP-binding prot 93.84
3tui_C366 Methionine import ATP-binding protein METN; ABC-tr 93.82
1z47_A355 CYSA, putative ABC-transporter ATP-binding protein 93.82
2y8e_A179 RAB-protein 6, GH09086P, RAB6; hydrolase, nucleoti 93.82
3jvv_A356 Twitching mobility protein; hexameric P-loop ATPas 93.81
1cp2_A269 CP2, nitrogenase iron protein; oxidoreductase; 1.9 93.79
1mh1_A186 RAC1; GTP-binding, GTPase, small G-protein, RHO fa 93.76
3bc1_A195 RAS-related protein RAB-27A; RAB27, GTPase, RAB, s 93.76
2iwr_A178 Centaurin gamma 1; ANK repeat, zinc-finger, GTP-bi 93.74
1g8f_A511 Sulfate adenylyltransferase; alpha-beta protein, b 93.74
2a9k_A187 RAS-related protein RAL-A; bacterial ADP-ribosyltr 93.73
1p9r_A418 General secretion pathway protein E; bacterial typ 93.73
2yv5_A302 YJEQ protein; hydrolase, GTPase, permutation, stru 93.72
2oil_A193 CATX-8, RAS-related protein RAB-25; G-protein, GDP 93.7
3bwd_D182 RAC-like GTP-binding protein ARAC6; G domain, cyto 93.7
2yyz_A 359 Sugar ABC transporter, ATP-binding protein; sugar 93.7
3rlf_A 381 Maltose/maltodextrin import ATP-binding protein M; 93.69
3t1o_A198 Gliding protein MGLA; G domain containing protein, 93.67
3t5g_A181 GTP-binding protein RHEB; immunoglobulin-like beta 93.67
2efe_B181 Small GTP-binding protein-like; GEF, GTPase, VPS9, 93.66
2atv_A196 RERG, RAS-like estrogen-regulated growth inhibitor 93.65
4b3f_X 646 DNA-binding protein smubp-2; hydrolase, helicase; 93.65
2it1_A 362 362AA long hypothetical maltose/maltodextrin trans 93.65
2bov_A206 RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, 93.64
2g6b_A180 RAS-related protein RAB-26; G-protein, GTP analogu 93.6
1g29_1 372 MALK, maltose transport protein MALK; ATPase, acti 93.6
2afh_E289 Nitrogenase iron protein 1; nitrogen fixation, iro 93.6
1vg8_A207 RAS-related protein RAB-7; GTP-binding protein, pr 93.58
1lw7_A365 Transcriptional regulator NADR; NMN, NMN adenylyl 93.57
2cjw_A192 GTP-binding protein GEM; nucleotide-binding, small 93.56
1v43_A 372 Sugar-binding transport ATP-binding protein; ATPas 93.55
3llu_A196 RAS-related GTP-binding protein C; structural geno 93.54
1pui_A210 ENGB, probable GTP-binding protein ENGB; structura 93.54
1zbd_A203 Rabphilin-3A; G protein, effector, RABCDR, synapti 93.52
1gwn_A205 RHO-related GTP-binding protein RHOE; GTPase, inac 93.51
2ewv_A372 Twitching motility protein PILT; pilus retraction 93.5
2h57_A190 ADP-ribosylation factor-like protein 6; GTP, GTPas 93.5
2fh5_B214 SR-beta, signal recognition particle receptor beta 93.49
3cbq_A195 GTP-binding protein REM 2; FLJ38964A, structural g 93.49
2fg5_A192 RAB-22B, RAS-related protein RAB-31; G-protein, GT 93.48
2qm8_A337 GTPase/ATPase; G protein, G3E, metallochaperone, c 93.48
2qu8_A228 Putative nucleolar GTP-binding protein 1; GTPase, 93.47
2ew1_A201 RAS-related protein RAB-30; G-protein, GTP analogu 93.46
3clv_A208 RAB5 protein, putative; malaria, GTPase, structura 93.46
3oes_A201 GTPase rhebl1; small GTPase, structural genomics, 93.45
1zd9_A188 ADP-ribosylation factor-like 10B; transport protei 93.43
2gf9_A189 RAS-related protein RAB-3D; G-protein, structural 93.42
4hlc_A205 DTMP kinase, thymidylate kinase; TMK, MRSA, pipiri 93.4
3reg_A194 RHO-like small GTPase; cytoskeleton, nucleotide-bi 93.4
3tkl_A196 RAS-related protein RAB-1A; vesicle trafficking, p 93.37
2a5j_A191 RAS-related protein RAB-2B; GTPase, signal transdu 93.36
4dkx_A216 RAS-related protein RAB-6A; GTP binding fold, memb 93.35
3d31_A348 Sulfate/molybdate ABC transporter, ATP-binding pro 93.34
3v9p_A227 DTMP kinase, thymidylate kinase; ssgcid, STRU geno 93.34
3kjh_A254 CO dehydrogenase/acetyl-COA synthase complex, acce 93.33
3gmt_A230 Adenylate kinase; ssgcid, ATP-BIN cytoplasm, nucle 93.33
2q3h_A201 RAS homolog gene family, member U; GTPase, structu 93.33
3tqf_A181 HPR(Ser) kinase; transferase, hydrolase; 2.80A {Co 93.31
3fdi_A201 Uncharacterized protein; cytidylate kinase like pr 93.31
2o52_A200 RAS-related protein RAB-4B; G-protein, GDP, struct 93.29
1z06_A189 RAS-related protein RAB-33B; RAB GTPase, RAB33B GT 93.26
4bas_A199 ADP-ribosylation factor, putative (small GTPase, p 93.26
2p5s_A199 RAS and EF-hand domain containing; G-protein, RAB, 93.25
2gza_A361 Type IV secretion system protein VIRB11; ATPase, h 93.24
3lxx_A239 GTPase IMAP family member 4; structural genomics c 93.24
1x3s_A195 RAS-related protein RAB-18; GTPase, GNP, structura 93.23
3dz8_A191 RAS-related protein RAB-3B; GDP, GTPase, structura 93.23
3dzd_A368 Transcriptional regulator (NTRC family); sigma43 a 93.19
2gf0_A199 GTP-binding protein DI-RAS1; GDP/GTP binding, GTP 93.19
2bcg_Y206 Protein YP2, GTP-binding protein YPT1; RABGTPase, 93.17
3gd7_A 390 Fusion complex of cystic fibrosis transmembrane co 93.17
1bif_A 469 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; 93.16
2h17_A181 ADP-ribosylation factor-like protein 5A; GDP, GTPa 93.16
2qnr_A301 Septin-2, protein NEDD5; structural genomics conso 93.15
1tq4_A 413 IIGP1, interferon-inducible GTPase; interferon gam 93.13
2p67_A341 LAO/AO transport system kinase; ARGK, structural G 93.13
2g3y_A211 GTP-binding protein GEM; small GTPase, GDP, inacti 93.11
1c9k_A180 COBU, adenosylcobinamide kinase; alpha/beta struct 93.11
1ega_A301 Protein (GTP-binding protein ERA); GTPase, RNA-bin 93.1
2j1l_A214 RHO-related GTP-binding protein RHOD; GTPase, memb 93.09
1oxx_K353 GLCV, glucose, ABC transporter, ATP binding protei 93.04
2il1_A192 RAB12; G-protein, GDP, GTPase, predicted, structur 93.02
1u0l_A301 Probable GTPase ENGC; permutation, OB-fold, zinc-f 93.01
2atx_A194 Small GTP binding protein TC10; GTPase, P-loop, al 93.0
2fv8_A207 H6, RHO-related GTP-binding protein RHOB; GDP/GTP 93.0
3k53_A271 Ferrous iron transport protein B; GTPase fold, hel 92.98
2j69_A 695 Bacterial dynamin-like protein; FZO, FZL, GTPase, 92.97
2j0v_A212 RAC-like GTP-binding protein ARAC7; nucleotide-bin 92.94
2hup_A201 RAS-related protein RAB-43; G-protein, GDP, struct 92.91
2obl_A347 ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O 92.89
3gqb_A 578 V-type ATP synthase alpha chain; A3B3, V-ATPase, A 92.89
3cr8_A552 Sulfate adenylyltranferase, adenylylsulfate kinase 92.88
3cph_A213 RAS-related protein SEC4; RAB GTPase, prenylation, 92.87
2gco_A201 H9, RHO-related GTP-binding protein RHOC; GTPase,s 92.85
2pt7_A330 CAG-ALFA; ATPase, protein-protein complex, type IV 92.82
2fu5_C183 RAS-related protein RAB-8A; MSS4:RAB8 protein comp 92.76
3q3j_B214 RHO-related GTP-binding protein RHO6; RAS-binding 92.76
1mky_A439 Probable GTP-binding protein ENGA; GTPase, DER, KH 92.73
2f7s_A217 C25KG, RAS-related protein RAB-27B; G-protein, str 92.73
1ypw_A806 Transitional endoplasmic reticulum ATPase; AAA, P9 92.72
2rcn_A358 Probable GTPase ENGC; YJEQ, circularly permuted, G 92.68
1m8p_A573 Sulfate adenylyltransferase; rossmann fold, phosph 92.67
4dzz_A206 Plasmid partitioning protein PARF; deviant walker 92.65
3b1v_A272 Ferrous iron uptake transporter protein B; G prote 92.64
3iev_A308 GTP-binding protein ERA; ERA, GTPase, KH domain, a 92.61
3ch4_B202 Pmkase, phosphomevalonate kinase; parallel beta-sh 92.58
4dhe_A223 Probable GTP-binding protein ENGB; melioidosis, RA 92.56
2npi_A460 Protein CLP1; CLP1-PCF11 complex, ATP binding, ter 92.54
2aka_B299 Dynamin-1; fusion protein, GTPase domain, myosin, 92.5
3def_A262 T7I23.11 protein; chloroplast, TOC33, GTPase, hydr 92.5
1x6v_B 630 Bifunctional 3'-phosphoadenosine 5'- phosphosulfat 92.46
2xtp_A260 GTPase IMAP family member 2; immune system, G prot 92.45
2qag_B 427 Septin-6, protein NEDD5; cell cycle, cell division 92.4
3k9g_A267 PF-32 protein; ssgcid, SBRI, decode biostructures, 92.32
2woj_A 354 ATPase GET3; tail-anchored, membrane protein, targ 92.28
3fkq_A373 NTRC-like two-domain protein; RER070207001320, str 92.25
2woo_A329 ATPase GET3; tail-anchored, membrane protein, targ 92.23
2x77_A189 ADP-ribosylation factor; GTP-binding protein, smal 92.2
1wf3_A301 GTP-binding protein; GTPase, riken structural geno 92.13
3iby_A256 Ferrous iron transport protein B; G protein, G dom 92.12
3cpj_B223 GTP-binding protein YPT31/YPT8; RAB GTPase, prenyl 92.11
>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Back     alignment and structure
Probab=100.00  E-value=7.2e-40  Score=323.59  Aligned_cols=231  Identities=18%  Similarity=0.209  Sum_probs=189.2

Q ss_pred             cccchHHHHHHHHHHhcCC---CccEEEEEcCCCCcHHHHHHHHHc--CcccccCCCccEEEEEeCCCc--CHHHHHHHH
Q 038454          110 VGENTKKIVKKVWEDLMGD---KVTKIGVWGMGGFGKTAIMRHINN--RPQEETNEFSDVIWVTVSQPL--DLVKLQAEI  182 (359)
Q Consensus       110 vGr~~~~~~~~l~~~l~~~---~~~vi~I~G~gGiGKTtLa~~v~~--~~~~~~~~F~~~~wv~~~~~~--~~~~~~~~i  182 (359)
                      |||+.  ++++|.++|..+   ..++|+|+||||+||||||+++|+  + ..+..+|++++||++++.+  +...++..|
T Consensus       131 ~GR~~--~~~~l~~~L~~~~~~~~~vv~I~G~gGvGKTtLA~~v~~~~~-~~~~~~F~~~~wv~vs~~~~~~~~~~~~~i  207 (549)
T 2a5y_B          131 YIREY--HVDRVIKKLDEMCDLDSFFLFLHGRAGSGKSVIASQALSKSD-QLIGINYDSIVWLKDSGTAPKSTFDLFTDI  207 (549)
T ss_dssp             CCCHH--HHHHHHHHHHHHTTSSSEEEEEECSTTSSHHHHHHHHHHHCS-STBTTTBSEEEEEECCCCSTTHHHHHHHHH
T ss_pred             CCchH--HHHHHHHHHhcccCCCceEEEEEcCCCCCHHHHHHHHHHhhh-HHHhccCCcEEEEEECCCCCCCHHHHHHHH
Confidence            69976  899999998643   689999999999999999999998  4 4578999999999999885  899999999


Q ss_pred             HHHhcCCCC-------CCccHHHHHHHHHHHHhcCC-cEEEEEecC----------CCC-eEEEeec------ccc-e-e
Q 038454          183 AMALKLSLT-------EDEDKVSRARRLLGKLKAKK-KFVLILDDI----------DNH-TFCWGLR------SMG-C-E  235 (359)
Q Consensus       183 ~~~l~~~~~-------~~~~~~~~~~~l~~~l~~~k-~~LlVlDdv----------~~g-~ilvTtr------~~~-~-~  235 (359)
                      +.+++....       ...+.......+.+.|.+ + |+|||||||          .+| +||||||      .++ . .
T Consensus       208 l~~l~~~~~~~~~~~~~~~~~~~l~~~l~~~L~~-~kr~LlVLDdv~~~~~~~~~~~~gs~ilvTTR~~~v~~~~~~~~~  286 (549)
T 2a5y_B          208 LLMLKSEDDLLNFPSVEHVTSVVLKRMICNALID-RPNTLFVFDDVVQEETIRWAQELRLRCLVTTRDVEISNAASQTCE  286 (549)
T ss_dssp             HHHHTTTSCCTTCCCCTTCCHHHHHHHHHHHHTT-STTEEEEEEEECCHHHHHHHHHTTCEEEEEESBGGGGGGCCSCEE
T ss_pred             HHHHhcCcccccccccccccHHHHHHHHHHHHcC-CCcEEEEEECCCCchhhcccccCCCEEEEEcCCHHHHHHcCCCCe
Confidence            999986421       123456678889999988 6 999999999          368 9999999      222 2 4


Q ss_pred             eeecCCCChHHHHHHHHHhhcCCCCCCCCchHHHHHHHHHHcCCchhHHHHHHHhhcCCCChhHHHHHHHHHhhcccccC
Q 038454          236 EVRVPPLSKEEALNLFLDKVGRNILHVPTLNEEIINSVVEECAGLQLAIFTVVGCMRGVDEIHEWRNALNELRGLVRSFS  315 (359)
Q Consensus       236 ~~~l~~L~~~ea~~lf~~~~~~~~~~~~~~~~~~~~~i~~~c~g~Plai~~~~~~L~~~~~~~~w~~~l~~~~~~~~~~~  315 (359)
                      .|+|++|+.++||+||.+.++...  .++.+.+++.+|+++|+|+||||+++|+.|+.+ +   |..+ +.+....+.. 
T Consensus       287 ~~~l~~L~~~ea~~Lf~~~a~~~~--~~~~~~~~~~~I~~~c~GlPLAl~~~g~~l~~~-~---w~~~-~~l~~~l~~~-  358 (549)
T 2a5y_B          287 FIEVTSLEIDECYDFLEAYGMPMP--VGEKEEDVLNKTIELSSGNPATLMMFFKSCEPK-T---FEKM-AQLNNKLESR-  358 (549)
T ss_dssp             EEECCCCCHHHHHHHHHHTSCCCC----CHHHHHHHHHHHHHTTCHHHHHHHHTTCCSS-S---HHHH-HHHHHHHHHH-
T ss_pred             EEECCCCCHHHHHHHHHHHhcCCC--CchhHHHHHHHHHHHhCCChHHHHHHHHHhccc-h---HHHH-HHhHHHhhcc-
Confidence            699999999999999999987653  246788899999999999999999999999874 3   4433 3333222222 


Q ss_pred             CChhhHhhHHHHhhhcCCCcchhHHHh-----------hccccCCCCccC
Q 038454          316 GINADVLGRLEFSYLRLKDKKVQHCFL-----------YCALYPEDFAIS  354 (359)
Q Consensus       316 ~~~~~~~~~l~~sy~~L~~~~~k~cf~-----------~~s~fp~~~~i~  354 (359)
                       ....+..+|.+||+.| |+++|.||+           |||+||+++.|+
T Consensus       359 -~~~~i~~~l~~Sy~~L-~~~lk~~f~~Ls~~er~l~~~ls~fp~~~~i~  406 (549)
T 2a5y_B          359 -GLVGVECITPYSYKSL-AMALQRCVEVLSDEDRSALAFAVVMPPGVDIP  406 (549)
T ss_dssp             -CSSTTCCCSSSSSSSH-HHHHHHHHHTSCHHHHHHTTGGGSSCTTCCEE
T ss_pred             -cHHHHHHHHhcccccc-cHHHHHHHhccchhhhhHhhheeeeCCCCeee
Confidence             2356889999999999 999999999           999999999987



>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Back     alignment and structure
>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Back     alignment and structure
>2fna_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE ADP; 2.00A {Sulfolobus solfataricus} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>2qen_A Walker-type ATPase; unknown function; HET: ADP; 2.25A {Pyrococcus abyssi} Back     alignment and structure
>1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* Back     alignment and structure
>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Back     alignment and structure
>3qfl_A MLA10; coiled-coil, (CC) domain, NLRS, nucleotide-binding domain, L rich repeat containing receptors, protein binding; 2.00A {Hordeum vulgare} Back     alignment and structure
>1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A Back     alignment and structure
>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* Back     alignment and structure
>1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* Back     alignment and structure
>1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A Back     alignment and structure
>3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* Back     alignment and structure
>1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* Back     alignment and structure
>3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} Back     alignment and structure
>1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* Back     alignment and structure
>3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} Back     alignment and structure
>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} Back     alignment and structure
>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Back     alignment and structure
>1a5t_A Delta prime, HOLB; zinc finger, DNA replication; 2.20A {Escherichia coli K12} SCOP: a.80.1.1 c.37.1.20 PDB: 1jr3_E* 1xxh_E* 1xxi_E* 3glf_E* 3glg_E* 3glh_E* 3gli_E* Back     alignment and structure
>2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} Back     alignment and structure
>1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* Back     alignment and structure
>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Back     alignment and structure
>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Back     alignment and structure
>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Back     alignment and structure
>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* Back     alignment and structure
>3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} Back     alignment and structure
>4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>3pxg_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 3.65A {Bacillus subtilis} Back     alignment and structure
>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* Back     alignment and structure
>2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} Back     alignment and structure
>4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_I 26S protease regulatory subunit 4 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 Back     alignment and structure
>4b4t_H 26S protease regulatory subunit 7 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Back     alignment and structure
>1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* Back     alignment and structure
>4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} Back     alignment and structure
>2gno_A DNA polymerase III, gamma subunit-related protein; structural genomics, joint center for structural genomics, J protein structure initiative; HET: DNA; 2.00A {Thermotoga maritima} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* Back     alignment and structure
>1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* Back     alignment and structure
>3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* Back     alignment and structure
>2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* Back     alignment and structure
>3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} Back     alignment and structure
>4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* Back     alignment and structure
>1ojl_A Transcriptional regulatory protein ZRAR; response regulator, two component system, AAA domain, NTRC family, DNA-binding; HET: ATP; 3.0A {Salmonella typhimurium} Back     alignment and structure
>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>2vhj_A Ntpase P4, P4; non- hydrolysable ATP analogue, hydrolase, virus dsRNA, molecular motor, packaging ATPase, hexameric helicase; HET: ADP; 1.80A {Pseudomonas phage PHI12} PDB: 2vhq_A* 1w44_A* 1w46_A* 1w47_A* 1w48_A* 1w49_A* 1w4a_A* 1w4b_A* 1w4c_A 2vht_A* 2vhu_A* 2vhc_A* Back     alignment and structure
>3hr8_A Protein RECA; alpha and beta proteins (A/B, A+B), ATP-binding, cytoplasm, damage, DNA recombination, DNA repair, DNA-binding; 1.95A {Thermotoga maritima} Back     alignment and structure
>2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} Back     alignment and structure
>1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>2z43_A DNA repair and recombination protein RADA; archaea, filament, DNA binding, molecular SWI RECA, DMC1; HET: DNA; 1.93A {Sulfolobus solfataricus} PDB: 2bke_A* 2dfl_A* 2zub_A* 2zuc_A* 2zud_A* Back     alignment and structure
>3io5_A Recombination and repair protein; storage dimer, inactive conformation, RECA like core domain, binding, DNA damage, DNA recombination; 2.40A {Enterobacteria phage T4} Back     alignment and structure
>3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} Back     alignment and structure
>1v5w_A DMC1, meiotic recombination protein DMC1/LIM15 homolog; DNA-binding protein, ring protein, octamer, AAA ATPase; 3.20A {Homo sapiens} SCOP: c.37.1.11 PDB: 2zjb_A Back     alignment and structure
>2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* Back     alignment and structure
>2i1q_A DNA repair and recombination protein RADA; ATPase, recombinase, ATP complex, calcium stimulation, RECA, DMC1; HET: DNA ANP; 1.90A {Methanococcus voltae} SCOP: a.60.4.1 c.37.1.11 PDB: 1xu4_A* 2b21_A* 2fpk_A* 2fpl_A* 2fpm_A* 1t4g_A* 3fyh_A* 2f1j_A* 2f1i_A* 2f1h_A* 3ntu_A* 3ewa_A* 3ew9_A* 3etl_A* 4dc9_A* 2gdj_A* Back     alignment and structure
>2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ... Back     alignment and structure
>2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} Back     alignment and structure
>1xp8_A RECA protein, recombinase A; recombination, radioresistance, DNA-repair, ATPase, DNA-BIND protein, DNA binding protein; HET: AGS; 2.50A {Deinococcus radiodurans} SCOP: c.37.1.11 d.48.1.1 Back     alignment and structure
>1u94_A RECA protein, recombinase A; homologous recombination, ATPase, DNA repair, DNA binding protein; 1.90A {Escherichia coli} SCOP: c.37.1.11 d.48.1.1 PDB: 1u98_A 1u99_A 1xms_A* 1xmv_A* 2rec_A 2reb_A 1n03_A* 1rea_A 1aa3_A Back     alignment and structure
>3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A Back     alignment and structure
>3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} Back     alignment and structure
>3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} Back     alignment and structure
>2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* Back     alignment and structure
>4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* Back     alignment and structure
>1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* Back     alignment and structure
>2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* Back     alignment and structure
>3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A Back     alignment and structure
>2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* Back     alignment and structure
>3bh0_A DNAB-like replicative helicase; ATPase, replication; 2.35A {Bacillus phage SPP1} Back     alignment and structure
>3lda_A DNA repair protein RAD51; DNA binding protein, ATP-binding, DNA damage, DNA recombinat repair, nucleotide-binding; HET: DNA; 2.50A {Saccharomyces cerevisiae} PDB: 1szp_A* Back     alignment and structure
>3ice_A Transcription termination factor RHO; transcription, ATPase, hexamer, helicase, RNA, RECA, OB fold ATP-binding, hydrolase; HET: MSE ADP SPD; 2.80A {Escherichia coli k-12} PDB: 1pv4_A 1pvo_A* 1xpo_A* 1xpr_A* 1xpu_A* 2ht1_A Back     alignment and structure
>3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A Back     alignment and structure
>1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* Back     alignment and structure
>1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* Back     alignment and structure
>2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} Back     alignment and structure
>3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A Back     alignment and structure
>2r6a_A DNAB helicase, replicative helicase; replication, DNAB; 2.90A {Geobacillus stearothermophilus} PDB: 2r6c_A 2r6d_A 2r6e_A 2vyf_A 2vye_A Back     alignment and structure
>3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* Back     alignment and structure
>2xxa_A Signal recognition particle protein; protein transport, RNA/RNA binding protein, hydrolase, gtpas; HET: GCP; 3.94A {Escherichia coli} PDB: 2j28_9 Back     alignment and structure
>1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6 Back     alignment and structure
>1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 Back     alignment and structure
>2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A* Back     alignment and structure
>1sky_E F1-ATPase, F1-ATP synthase; F1FO ATP synthase, alpha3BETA3 SUBC F1-ATPase, hydrolase; 3.20A {Bacillus SP} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 Back     alignment and structure
>1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 Back     alignment and structure
>2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} Back     alignment and structure
>1g8p_A Magnesium-chelatase 38 kDa subunit; parallel beta sheet, P-loop, rossman fold, AAA+, photosynthesis, metal transport; 2.10A {Rhodobacter capsulatus} SCOP: c.37.1.20 PDB: 2x31_G Back     alignment and structure
>2q6t_A DNAB replication FORK helicase; hydrolase; 2.90A {Thermus aquaticus} Back     alignment and structure
>1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* Back     alignment and structure
>4a1f_A DNAB helicase, replicative DNA helicase; hydrolase, DNA replication, ATPase; HET: FLC; 2.50A {Helicobacter pylori} Back     alignment and structure
>1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 Back     alignment and structure
>1fx0_B ATP synthase beta chain; latent ATPase, thermal stability, potential tentoxin binding hydrolase; 3.20A {Spinacia oleracea} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1kmh_B* Back     alignment and structure
>3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A* Back     alignment and structure
>1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 Back     alignment and structure
>3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2b8t_A Thymidine kinase; deoxyribonucleoside kinase, zinc-binding domain, TK1, UU-TK, transferase; HET: THM; 2.00A {Ureaplasma parvum} SCOP: c.37.1.24 g.39.1.14 PDB: 2uz3_A* Back     alignment and structure
>4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} Back     alignment and structure
>3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} Back     alignment and structure
>1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>2ck3_D ATP synthase subunit beta\, mitochondrial; hydrolase; HET: ANP ADP; 1.9A {Bos taurus} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1cow_D* 1bmf_D* 1e1q_D* 1e1r_D* 1efr_D* 1e79_D* 1h8h_D* 1ohh_D* 1qo1_D 1w0j_D* 1w0k_D* 1h8e_D* 2jdi_D* 2jiz_D* 2jj1_D* 2jj2_D* 2v7q_D* 2wss_D* 2w6j_D 2w6e_D ... Back     alignment and structure
>1pzn_A RAD51, DNA repair and recombination protein RAD51, RADA; heptameric ring, heptamer, ring, oligomer, RAD51 polymerizat motif; HET: DNA; 2.85A {Pyrococcus furiosus} SCOP: a.60.4.1 c.37.1.11 Back     alignment and structure
>2r44_A Uncharacterized protein; putative ATPase, structural genomics, joint center for struc genomics, JCSG; HET: MSE PG4; 2.00A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>2hf9_A Probable hydrogenase nickel incorporation protein HYPB; alpha and beta protein; HET: GSP; 1.90A {Methanocaldococcus jannaschii} PDB: 2hf8_A* Back     alignment and structure
>3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} Back     alignment and structure
>1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 Back     alignment and structure
>3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} Back     alignment and structure
>1ex7_A Guanylate kinase; substrate-induced FIT, domain movement, GMP, ATP, substrate specificity, X-RAY diffraction, transferase; HET: 5GP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1ex6_A* 1gky_A* 3sqk_A 4f4j_A Back     alignment and structure
>3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1 Back     alignment and structure
>2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} Back     alignment and structure
>3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* Back     alignment and structure
>2ffh_A Protein (FFH); SRP54, signal recognition particle, GTPase, M domain, RNA-binding, signal sequence-binding, helix-turn-helix, protein targeting; 3.20A {Thermus aquaticus} SCOP: a.24.13.1 a.36.1.1 c.37.1.10 PDB: 2iy3_A Back     alignment and structure
>2wsm_A Hydrogenase expression/formation protein (HYPB); metal binding protein; 2.30A {Archaeoglobus fulgidus} Back     alignment and structure
>1odf_A YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser2 intergenic region; yeast protein, ATP binding protein; 2.25A {Saccharomyces cerevisiae} SCOP: c.37.1.6 Back     alignment and structure
>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 Back     alignment and structure
>1uf9_A TT1252 protein; P-loop, nucleotide binding domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: ATP; 2.80A {Thermus thermophilus} SCOP: c.37.1.1 Back     alignment and structure
>3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A Back     alignment and structure
>1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A Back     alignment and structure
>3nbx_X ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structure, rossman fold, hydro; HET: ADP; 2.91A {Escherichia coli} Back     alignment and structure
>2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national P protein structural and functional analyses; 2.10A {Aeropyrum pernix} Back     alignment and structure
>3hws_A ATP-dependent CLP protease ATP-binding subunit CL; CLPXP, AAA+ molecular machine, hexamer, asymmetric,, ATP-BIN chaperone, metal-binding; HET: ADP; 3.25A {Escherichia coli} PDB: 3hte_A Back     alignment and structure
>1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1 Back     alignment and structure
>1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* Back     alignment and structure
>3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} Back     alignment and structure
>2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} Back     alignment and structure
>1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>1via_A Shikimate kinase; structural genomics, transferase; HET: MSE; 1.57A {Campylobacter jejuni} SCOP: c.37.1.2 Back     alignment and structure
>3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A* Back     alignment and structure
>1j8m_F SRP54, signal recognition 54 kDa protein; signaling protein; 2.00A {Acidianus ambivalens} SCOP: a.24.13.1 c.37.1.10 PDB: 1j8y_F Back     alignment and structure
>3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* Back     alignment and structure
>2iyv_A Shikimate kinase, SK; transferase, aromatic amino acid biosynthesis, P-loop kinase, metal- binding, shikimate pathway; HET: ADP; 1.35A {Mycobacterium tuberculosis} SCOP: c.37.1.2 PDB: 2iyr_A* 2iyq_A* 2iyt_A 2iyu_A* 2iys_A* 2iyw_A* 2iyx_A* 2iyy_A* 2iyz_A* 2g1k_A* 1l4y_A* 1u8a_A* 1we2_A* 1zyu_A* 2dfn_A* 2dft_A* 2g1j_A 1l4u_A* 3baf_A* Back     alignment and structure
>1zuh_A Shikimate kinase; alpha-beta protein, transferase; 1.80A {Helicobacter pylori} PDB: 1zui_A* 3hr7_A 3muf_A* 3mrs_A 3n2e_A* Back     alignment and structure
>2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A Back     alignment and structure
>2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 Back     alignment and structure
>2jaq_A Deoxyguanosine kinase; transferase, deoxyribonucleoside kinase; HET: DCP; 2.3A {Mycoplasma mycoides subsp} PDB: 2jat_A* 2jas_A* Back     alignment and structure
>2ga8_A Hypothetical 39.9 kDa protein; YFR007W, YFH7, unknown function; HET: CME; 1.77A {Saccharomyces cerevisiae} PDB: 2gaa_A* Back     alignment and structure
>1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* Back     alignment and structure
>2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} Back     alignment and structure
>1um8_A ATP-dependent CLP protease ATP-binding subunit CL; CLPP binding loop, chaperone; HET: ADP; 2.60A {Helicobacter pylori} SCOP: c.37.1.20 Back     alignment and structure
>1ukz_A Uridylate kinase; transferase; HET: ADP AMP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1uky_A* Back     alignment and structure
>2j37_W Signal recognition particle 54 kDa protein (SRP54); ribosome, SRP, translation/RNA; 8.00A {Canis SP} PDB: 1wgw_A Back     alignment and structure
>2ze6_A Isopentenyl transferase; crown GALL tumor, cytokinin biosynthesis; HET: DST AMP; 2.10A {Agrobacterium tumefaciens} PDB: 2ze5_A* 2ze7_A* 2ze8_A Back     alignment and structure
>2if2_A Dephospho-COA kinase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 3.00A {Aquifex aeolicus} Back     alignment and structure
>2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} Back     alignment and structure
>4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A* Back     alignment and structure
>1cke_A CK, MSSA, protein (cytidine monophosphate kinase); nucleotide monophosphate kinase,, transferase; 1.75A {Escherichia coli} SCOP: c.37.1.1 PDB: 1kdo_A* 1kdp_A* 1kdr_A* 1kdt_A* 2cmk_A* 2fem_A 2feo_A* Back     alignment and structure
>2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens} Back     alignment and structure
>2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A* Back     alignment and structure
>1e6c_A Shikimate kinase; phosphoryl transfer, ADP, shikimate pathway, P-loop protein, transferase; 1.8A {Erwinia chrysanthemi} SCOP: c.37.1.2 PDB: 1shk_A 2shk_A* Back     alignment and structure
>1jjv_A Dephospho-COA kinase; P-loop nucleotide-binding fold, structure 2 function project, S2F, structural genomics, transferase; HET: ATP; 2.00A {Haemophilus influenzae} SCOP: c.37.1.1 Back     alignment and structure
>1qf9_A UMP/CMP kinase, protein (uridylmonophosphate/cytidylmonophosphate kinase); nucleoside monophosphate kinase, NMP kinase; HET: ADP C5P; 1.70A {Dictyostelium discoideum} SCOP: c.37.1.1 PDB: 1uke_A* 2ukd_A* 3ukd_A* 4ukd_A* 5ukd_A* Back     alignment and structure
>1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11 Back     alignment and structure
>3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus} Back     alignment and structure
>2cdn_A Adenylate kinase; phosphoryl transfer, associative mechanism, ATP-binding, nucleotide biosynthesis, nucleotide-binding, transferase; HET: ADP; 1.9A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1p4s_A Back     alignment and structure
>2vli_A Antibiotic resistance protein; transferase, tunicamycin, phosphotransferase; 1.95A {Deinococcus radiodurans} Back     alignment and structure
>1q57_A DNA primase/helicase; dntpase, DNA replication, transferase; HET: DNA; 3.45A {Enterobacteria phage T7} SCOP: c.37.1.11 e.13.1.2 Back     alignment and structure
>1ls1_A Signal recognition particle protein; FFH, SRP54, SRP, GTPase, ultrahigh resolution, protein transport; 1.10A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 1jpn_B* 1jpj_A* 1ry1_U* 2j45_A* 1o87_A* 2c04_A* 2j46_A* 1rj9_B* 2c03_A* 2j7p_A* 1okk_A* 2cnw_A* 1ng1_A* 2xkv_A 3ng1_A 1ffh_A 2ng1_A* Back     alignment and structure
>2plr_A DTMP kinase, probable thymidylate kinase; TMP-binding, ATP-binding, structural GEN NPPSFA; HET: 1PE PGE EPE PG4; 1.60A {Sulfolobus tokodaii} Back     alignment and structure
>3a4m_A L-seryl-tRNA(SEC) kinase; P-loop motif, walker A motif, ATP binding motif, ATP- binding, nucleotide-binding, transferase; HET: ADP; 1.79A {Methanocaldococcus jannaschii} PDB: 3a4l_A* 3a4n_A 3am1_A* 3add_A* 3adc_A* 3adb_A* Back     alignment and structure
>1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 Back     alignment and structure
>2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A Back     alignment and structure
>3umf_A Adenylate kinase; rossmann fold, transferase; 2.05A {Schistosoma mansoni} Back     alignment and structure
>2pt5_A Shikimate kinase, SK; aromatic amino acid biosynthesis, P-loop kinase, SHI kinase, shikimate pathway; 2.10A {Aquifex aeolicus} Back     alignment and structure
>2pbr_A DTMP kinase, thymidylate kinase; transferase, nucleotide biosynthesis, TMP-binding, A binding, structural genomics, NPPSFA; 1.96A {Aquifex aeolicus} Back     alignment and structure
>1g5t_A COB(I)alamin adenosyltransferase; P-loop protein, cobalamin biosynthesis, RECA fold; HET: ATP; 1.80A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1g5r_A* 1g64_A* Back     alignment and structure
>2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae} Back     alignment and structure
>2wwf_A Thymidilate kinase, putative; transferase, malaria; HET: TMP ADP; 1.89A {Plasmodium falciparum} PDB: 2wwg_A* 2wwh_A* 2wwi_A* Back     alignment and structure
>3zvl_A Bifunctional polynucleotide phosphatase/kinase; hydrolase-transferase complex, base excision repair, BER, non-homologous END-joining, NHEJ; 1.65A {Mus musculus} PDB: 3zvm_A* 3zvn_A* 1yj5_A 3u7e_B* 3u7f_B* 3u7h_B* 3u7g_A* Back     alignment and structure
>1aky_A Adenylate kinase; ATP:AMP phosphotransferase, myokinase, transferase (phosphotransferase); HET: AP5; 1.63A {Saccharomyces cerevisiae} SCOP: c.37.1.1 g.41.2.1 PDB: 2aky_A* 3aky_A* 1dvr_A* Back     alignment and structure
>1nn5_A Similar to deoxythymidylate kinase (thymidylate K; P-loop, D4TMP, transferase; HET: 2DT ANP; 1.50A {Homo sapiens} SCOP: c.37.1.1 PDB: 1e2e_A* 1e2d_A* 1e2g_A* 1e2q_A* 1e99_A* 1e9a_A* 1e9b_A* 1nmx_A* 1nmz_A* 1nn0_A* 1nn1_A* 1e2f_A* 1nn3_A* 2xx3_A* 1e9c_A* 1e9d_A* 1e9e_A* 1e98_A* 1nmy_A* 1e9f_A* Back     alignment and structure
>1xjc_A MOBB protein homolog; structural genomics, midwest center for structural GEN PSI, protein structure initiative, MCSG; 2.10A {Geobacillus stearothermophilus} SCOP: c.37.1.10 Back     alignment and structure
>1uj2_A Uridine-cytidine kinase 2; alpha/beta mononucleotide-binding HOLD, transferase; HET: C5P ADP; 1.80A {Homo sapiens} SCOP: c.37.1.6 PDB: 1uei_A* 1uej_A* 1udw_A 1ufq_A* 1xrj_A* Back     alignment and structure
>3fwy_A Light-independent protochlorophyllide reductase I ATP-binding protein; BCHL, electron donor, DPOR, Fe protein, nitrogenase; HET: ADP; 1.63A {Rhodobacter sphaeroides 2} Back     alignment and structure
>3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A Back     alignment and structure
>2grj_A Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosphocoenzyme kinase, structural genomics, joint center for structural GE JCSG; HET: ADP COD; 2.60A {Thermotoga maritima} Back     alignment and structure
>2v54_A DTMP kinase, thymidylate kinase; nucleotide biosynthesis, ATP-binding, nucleotide-binding, poxvirus, transferase; HET: TYD POP; 2.4A {Vaccinia virus copenhagen} PDB: 2w0s_A* Back     alignment and structure
>1jr3_D DNA polymerase III, delta subunit; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1jqj_C* 1xxh_A* 1xxi_A* 3glf_A* 3glg_A* 3glh_A* 3gli_A* Back     alignment and structure
>3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} Back     alignment and structure
>1zd8_A GTP:AMP phosphotransferase mitochondrial; ATP:AMP phosphotransferase, myokinase, structural genomics, structural genomics consortium, SGC; 1.48A {Homo sapiens} PDB: 2ak3_A* Back     alignment and structure
>3upu_A ATP-dependent DNA helicase DDA; RECA-like domain, SH3 domain, PIN-tower interface, coupling hydrolysis to DNA unwinding, ssDNA; 3.30A {Enterobacteria phage T4} Back     alignment and structure
>3fb4_A Adenylate kinase; psychrophIle, phosphotransferase, ATP-binding, nucleotide-binding, transferase; HET: AP5; 2.00A {Marinibacillus marinus} Back     alignment and structure
>3l0o_A Transcription termination factor RHO; helicase, RHO factor, RNA capture mechanism, ATP-binding, hydrolase, nucleotide-binding, RN binding; 2.35A {Thermotoga maritima} Back     alignment and structure
>3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* Back     alignment and structure
>1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} Back     alignment and structure
>3aez_A Pantothenate kinase; transferase, homodimer, COA biosynthesis, nucleotide binding binding, cytoplasm, nucleotide-binding; HET: GDP PAZ; 2.20A {Mycobacterium tuberculosis} PDB: 2ges_A* 2geu_A* 2gev_A* 2zs7_A* 2zs8_A* 2zs9_A* 2zsa_A* 2zsb_A* 2zsd_A* 2zse_A* 2zsf_A* 2get_A* 3af0_A* 3af1_A* 3af2_A* 3af3_A* 3af4_A* 3avp_A* 3avo_A* 3avq_A* Back     alignment and structure
>3tqc_A Pantothenate kinase; biosynthesis of cofactors, prosthetic groups, carriers, TRAN; HET: ADP; 2.30A {Coxiella burnetii} Back     alignment and structure
>2jeo_A Uridine-cytidine kinase 1; UCK, transferase, ATP-binding, nucleoside kinase, nucleotide-binding; 2.50A {Homo sapiens} PDB: 2uvq_A* Back     alignment and structure
>1zak_A Adenylate kinase; ATP:AMP-phosphotransferase, transferase; HET: AP5; 3.50A {Zea mays} SCOP: c.37.1.1 g.41.2.1 Back     alignment and structure
>2zts_A Putative uncharacterized protein PH0186; KAIC like protein, ATP-binding, nucleotide-binding, ATP- binding protein; HET: ADP; 2.07A {Pyrococcus horikoshii} Back     alignment and structure
>3dl0_A Adenylate kinase; phosphotransferase, zinc coordination, ATP-binding, binding, nucleotide biosynthesis, nucleotide-binding, trans; HET: AP5; 1.58A {Bacillus subtilis} PDB: 1p3j_A* 2ori_A* 2eu8_A* 2oo7_A* 2p3s_A* 2qaj_A* 2osb_A* 3dkv_A* 1zin_A* 1zio_A* 1zip_A* 1s3g_A* Back     alignment and structure
>1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D* Back     alignment and structure
>4e22_A Cytidylate kinase; P-loop, CMP/ATP binding, transferase; 2.32A {Yersinia pseudotuberculosis} Back     alignment and structure
>1tue_A Replication protein E1; helicase, replication, E1E2 complex, AAA+ protein; 2.10A {Human papillomavirus type 18} SCOP: c.37.1.20 Back     alignment and structure
>1g41_A Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dependent proteolysis, chaperone; HET: ADP; 2.30A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1g3i_A* 1im2_A* 1kyi_A* 1g4a_E* 1g4b_E 1yyf_A* 1do0_A* 1do2_A* 1e94_E* 1hqy_E* 1ht1_E* 1ht2_E* Back     alignment and structure
>2qe7_A ATP synthase subunit alpha; blockage of ATP hydrolysis, F1-ATPase, single analysis, thermoalkaliphilic, hydrolase; 3.06A {Bacillus SP} PDB: 1sky_B Back     alignment and structure
>2r9v_A ATP synthase subunit alpha; TM1612, structural genomics, JOI for structural genomics, JCSG, protein structure initiative ATP synthesis; HET: ATP PG4; 2.10A {Thermotoga maritima MSB8} Back     alignment and structure
>2f6r_A COA synthase, bifunctional coenzyme A synthase; 18044849, bifunctional coenzyme A synthase (COA synthase), S genomics; HET: ACO UNL; 1.70A {Mus musculus} Back     alignment and structure
>1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A* Back     alignment and structure
>2pez_A Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthetase 1 (PAPS synthetase...; NMP-kinase fold, protein in complex with nucleic acid; HET: GGZ DAT; 1.40A {Homo sapiens} PDB: 2pey_A* 2ax4_A* Back     alignment and structure
>3tlx_A Adenylate kinase 2; structural genomics, structural genomics consortium, SGC, RO fold, transferase, ATP binding, phosphorylation; HET: ADP ATP AMP; 2.75A {Plasmodium falciparum} Back     alignment and structure
>1htw_A HI0065; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; HET: ADP; 1.70A {Haemophilus influenzae} SCOP: c.37.1.18 PDB: 1fl9_A Back     alignment and structure
>1gtv_A TMK, thymidylate kinase; transferase, transferase (ATP:TMP phosphotransferase); HET: TYD TMP; 1.55A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1g3u_A* 1gsi_A* 1mrn_A* 1mrs_A* 1n5i_A* 1n5j_A* 1n5k_A* 1n5l_A* 1w2g_A* 1w2h_A* Back     alignment and structure
>1vht_A Dephospho-COA kinase; structural genomics, transferase; HET: BA3; 1.59A {Escherichia coli} SCOP: c.37.1.1 PDB: 1vhl_A* 1viy_A 1t3h_A 1n3b_A Back     alignment and structure
>1m7g_A Adenylylsulfate kinase; APS kinase, transferase, sulfate Met nucleotide 2 kinase; HET: AV2 ADX ADP; 1.43A {Penicillium chrysogenum} SCOP: c.37.1.4 PDB: 1d6j_A* 1m7h_A* 3cr7_A* Back     alignment and structure
>1a7j_A Phosphoribulokinase; transferase, calvin cycle; 2.50A {Rhodobacter sphaeroides} SCOP: c.37.1.6 Back     alignment and structure
>3p32_A Probable GTPase RV1496/MT1543; structural genomics, seattle structural genomics center for infectious disease, ssgcid, MEAB, MMAA; HET: GDP PGE; 1.90A {Mycobacterium tuberculosis} PDB: 3md0_A* 4gt1_A* 3nxs_A* 3tk1_A* Back     alignment and structure
>3vr4_D V-type sodium ATPase subunit D; V-ATPase, rotary motor, P-loop, hydrolas ATPase, ATP binding; HET: MSE B3P; 2.17A {Enterococcus hirae} PDB: 3vr3_D* 3vr2_D* 3vr5_D 3vr6_D* Back     alignment and structure
>3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* Back     alignment and structure
>3nwj_A ATSK2; P loop, shikimate, nucleoside monophosphate kinase, shikimat ATP binding, chloroplast, transferase; 2.35A {Arabidopsis thaliana} Back     alignment and structure
>3lnc_A Guanylate kinase, GMP kinase; ALS collaborative crystallography, emerald biostructures, ATP-binding, cytoplasm, nucleotide-binding; HET: 5GP; 1.95A {Anaplasma phagocytophilum} Back     alignment and structure
>3ake_A Cytidylate kinase; CMP kinase, CMP complex, open conformation, nucleotide metab transferase; HET: C5P; 1.50A {Thermus thermophilus} PDB: 3akc_A* 3akd_A* Back     alignment and structure
>3a8t_A Adenylate isopentenyltransferase; rossmann fold protein; HET: ATP; 2.37A {Humulus lupulus} Back     alignment and structure
>1np6_A Molybdopterin-guanine dinucleotide biosynthesis protein B; mixed alpha-beta fold, elongated beta-sheet, walker A motif, P-loop structural motif; 1.90A {Escherichia coli} SCOP: c.37.1.10 PDB: 1p9n_A Back     alignment and structure
>2i3b_A HCR-ntpase, human cancer-related ntpase; AAA, rossmann, hydrolase; NMR {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>3k1j_A LON protease, ATP-dependent protease LON; ATP-binding, nucleotide-binding, Pro hydrolase; HET: ADP PE8; 2.00A {Thermococcus onnurineus} Back     alignment and structure
>2f1r_A Molybdopterin-guanine dinucleotide biosynthesis protein B (MOBB); structural genomics, PSI, protein structure initiative; 2.10A {Archaeoglobus fulgidus} Back     alignment and structure
>1e4v_A Adenylate kinase; transferase(phosphotransferase); HET: AP5; 1.85A {Escherichia coli} SCOP: c.37.1.1 g.41.2.1 PDB: 1e4y_A* 1ake_A* 1ank_A* 2eck_A* 3hpq_A* 4ake_A 3hpr_A* Back     alignment and structure
>3lv8_A DTMP kinase, thymidylate kinase; structural genomics, in diseases, center for structural genomics of infectious DISE ATP-binding; HET: ADP TMP TYD; 1.80A {Vibrio cholerae o1 biovar eltor} PDB: 3n2i_A* Back     alignment and structure
>3be4_A Adenylate kinase; malaria, cryptosporidium parvum nonprotein inhibitors, nucleotide-binding, transferase; HET: AP5; 1.60A {Cryptosporidium parvum iowa II} Back     alignment and structure
>1sq5_A Pantothenate kinase; P-loop, transferase; HET: PAU ADP; 2.20A {Escherichia coli} SCOP: c.37.1.6 PDB: 1esm_A* 1esn_A* Back     alignment and structure
>2onk_A Molybdate/tungstate ABC transporter, ATP-binding protein; membrane protein; 3.10A {Archaeoglobus fulgidus} SCOP: c.37.1.12 Back     alignment and structure
>3sr0_A Adenylate kinase; phosphoryl transfer analogue, ALF4, transferase (phosphotran phosphoryl transfer, nucleotide-binding; HET: ADP AMP; 1.56A {Aquifex aeolicus} PDB: 2rh5_A 2rgx_A* Back     alignment and structure
>3bgw_A DNAB-like replicative helicase; ATPase, replication; 3.91A {Bacillus phage SPP1} Back     alignment and structure
>2xb4_A Adenylate kinase; ATP-binding, nucleotide-binding, transferase; HET: SRT; 1.80A {Desulfovibrio gigas} PDB: 3l0s_A* 3l0p_A* Back     alignment and structure
>3exa_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.30A {Bacillus halodurans} PDB: 2qgn_A Back     alignment and structure
>3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* Back     alignment and structure
>3d3q_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2; 2.70A {Staphylococcus epidermidis atcc 12228} Back     alignment and structure
>3r20_A Cytidylate kinase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, ADP, DCMP, D transferase; 2.00A {Mycobacterium smegmatis} SCOP: c.37.1.0 PDB: 3r8c_A 4die_A* Back     alignment and structure
>2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A Back     alignment and structure
>4tmk_A Protein (thymidylate kinase); ATP:DTMP phosphotransferase, transferase; HET: T5A; 1.98A {Escherichia coli} SCOP: c.37.1.1 PDB: 5tmp_A* Back     alignment and structure
>1ak2_A Adenylate kinase isoenzyme-2; nucleoside monophosphate kinase, phosphotransferase; 1.92A {Bos taurus} SCOP: c.37.1.1 g.41.2.1 PDB: 2ak2_A 2c9y_A* Back     alignment and structure
>3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana} Back     alignment and structure
>1ltq_A Polynucleotide kinase; phosphatase, alpha/beta, P-loop, transferase; HET: ADP; 2.33A {Enterobacteria phage T4} SCOP: c.108.1.9 c.37.1.1 PDB: 1rc8_A* 1rpz_A* 1rrc_A* 2ia5_A Back     alignment and structure
>1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A* Back     alignment and structure
>3b85_A Phosphate starvation-inducible protein; PHOH2, ATPase, PFAM: PF02562, ST genomics, PSI-2, protein structure initiative; 2.35A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3crm_A TRNA delta(2)-isopentenylpyrophosphate transferase; ATP-binding, nucleotide-binding, nucleotidyltransferase, tRNA processing; 1.90A {Pseudomonas aeruginosa} PDB: 3crq_A 3crr_A Back     alignment and structure
>2ck3_A ATP synthase subunit alpha\, mitochondrial; hydrolase; HET: ANP ADP; 1.9A {Bos taurus} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1bmf_A* 1e1q_A* 1e1r_A* 1e79_A* 1h8h_A* 1nbm_A* 1ohh_A* 1qo1_A 1w0j_A* 1w0k_A* 1h8e_A* 2jdi_A* 2wss_A* 2w6j_A 2w6e_A 2w6g_A 2w6f_A 2w6h_A 2w6i_A 1cow_A* ... Back     alignment and structure
>1oix_A RAS-related protein RAB-11A; small G protein, intracellular trafficking, GTP-binding, lipoprotein, prenylation, protein transport; HET: GDP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1oiw_A* 1oiv_A* 3rwo_B* 3rwm_B* Back     alignment and structure
>2dyk_A GTP-binding protein; GTPase, ribosome-binding protein, structural genomics; HET: GDP; 1.96A {Thermus thermophilus} Back     alignment and structure
>2wji_A Ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GNP; 1.90A {Methanocaldococcus jannaschii} PDB: 2wjj_A* 2wjh_A* Back     alignment and structure
>2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} Back     alignment and structure
>3gqb_B V-type ATP synthase beta chain; A3B3, V-ATPase, ATP synthesis, ATP-binding, hydrogen ION TRA hydrolase, ION transport; 2.80A {Thermus thermophilus HB8} PDB: 3a5c_D* 3a5d_D 3j0j_D* Back     alignment and structure
>1fx0_A ATP synthase alpha chain; latent ATPase, thermal stability, potential tentoxin binding hydrolase; 3.20A {Spinacia oleracea} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1kmh_A* Back     alignment and structure
>1yrb_A ATP(GTP)binding protein; GTPase, P-loop, rossman fold, GDP, HYDR; HET: GDP; 1.75A {Pyrococcus abyssi} SCOP: c.37.1.10 PDB: 1yr6_A* 1yr8_A* 1yr9_A* 1yra_A* 1yr7_A* 2oxr_A* Back     alignment and structure
>1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12 Back     alignment and structure
>2qmh_A HPR kinase/phosphorylase; V267F mutation, ATP-binding, carbohydrate metabolism, magnesium, metal-binding, multifunctional enzyme; 2.60A {Lactobacillus casei} PDB: 1jb1_A 1kkl_A 1kkm_A* Back     alignment and structure
>3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} Back     alignment and structure
>4eaq_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, MTBI, transferase; HET: ATM; 1.85A {Staphylococcus aureus subsp} PDB: 4dwj_A* 4f4i_A Back     alignment and structure
>2zej_A Dardarin, leucine-rich repeat kinase 2; parkinson'S disease, LRRK2, ROC, GTPase, ROCO, ATP-B disease mutation, GTP-binding, GTPase activation; HET: GDP; 2.00A {Homo sapiens} PDB: 3d6t_B* Back     alignment and structure
>3ld9_A DTMP kinase, thymidylate kinase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ehrlich chaffeensis; 2.15A {Ehrlichia chaffeensis} Back     alignment and structure
>2c61_A A-type ATP synthase non-catalytic subunit B; hydrolase, H+ ATPase, A1AO, ATP synthesis, hydrogen ION transport, ION transport; 1.5A {Methanosarcina mazei GO1} PDB: 3dsr_A* 3b2q_A* 2rkw_A* 3eiu_A* Back     alignment and structure
>2d2e_A SUFC protein; ABC-ATPase, SUF protein, 310-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics, binding; 1.70A {Thermus thermophilus} PDB: 2d2f_A* Back     alignment and structure
>1fzq_A ADP-ribosylation factor-like protein 3; protein-GDP complex without magnesium, ARF family, RAS superfamily, G-domain, signaling protein; HET: MES GDP; 1.70A {Mus musculus} SCOP: c.37.1.8 PDB: 3bh7_A* 3bh6_A* Back     alignment and structure
>1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A* Back     alignment and structure
>4g1u_C Hemin import ATP-binding protein HMUV; membrane transporter, type II ABC importer, HMUT, plasma MEM transport protein-hydrolase complex; 3.01A {Yersinia pestis} Back     alignment and structure
>3foz_A TRNA delta(2)-isopentenylpyrophosphate transferas; nucleoside modification, isopentenyl-tRNA transferase, transferase-RNA complex; 2.50A {Escherichia coli k-12} PDB: 2zxu_A* 2zm5_A Back     alignment and structure
>1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A Back     alignment and structure
>4akg_A Glutathione S-transferase class-MU 26 kDa isozyme heavy chain cytoplasmic; motor protein, AAA+ protein, ASCE protein, P-loop ntpase; HET: ATP ADP; 3.30A {Schistosoma japonicum} PDB: 4ai6_A* 4akh_A* 4aki_A* 3qmz_A Back     alignment and structure
>2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 Back     alignment and structure
>3f9v_A Minichromosome maintenance protein MCM; replicative helicase, DNA replication, MCM complex, AAA+ Pro ATP-binding, DNA-binding, helicase; 4.35A {Sulfolobus solfataricus} Back     alignment and structure
>2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A Back     alignment and structure
>2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J* Back     alignment and structure
>3oaa_A ATP synthase subunit alpha; rossmann fold, hydrolase, hydrolase-transport PROT complex; HET: ANP ADP; 3.26A {Escherichia coli DH1} PDB: 2a7u_A Back     alignment and structure
>1u0j_A DNA replication protein; AAA+ protein, P-loop atpases, helicase; HET: DNA ADP; 2.10A {Adeno-associated virus - 2} SCOP: c.37.1.20 PDB: 1s9h_A Back     alignment and structure
>2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* Back     alignment and structure
>1zj6_A ADP-ribosylation factor-like protein 5; ARL, GTP-binding, transport protein; HET: G3D; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2zu0_C Probable ATP-dependent transporter SUFC; iron-sulfur cluster, ABC-ATPase, ATP-binding, cytoplasm, nucleotide-binding; HET: MES; 2.20A {Escherichia coli} PDB: 2d3w_A Back     alignment and structure
>2ce2_X GTPase HRAS; signaling protein, guanine nucleotide binding protein, fluor membrane, lipoprotein, palmitate, prenylation; HET: GDP XY2; 1.0A {Homo sapiens} PDB: 2cl0_X* 2cl6_X* 2cl7_X* 2clc_X* 2evw_X* 2cld_X* 1aa9_A* 1ioz_A* 1q21_A* 6q21_A* 3k9l_A* 3k9n_A* 1ctq_A* 1bkd_R 1crp_A* 1crq_A* 1crr_A* 121p_A* 1gnp_A* 1gnq_A* ... Back     alignment and structure
>2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} Back     alignment and structure
>2ged_A SR-beta, signal recognition particle receptor beta subunit; protein transport, G protein, proline isomerization, circular permutation; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>1moz_A ARL1, ADP-ribosylation factor-like protein 1; GTP-binding, protein binding; HET: GDP; 3.17A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 Back     alignment and structure
>2f9l_A RAB11B, member RAS oncogene family; RAB11B GTPase, vesicle transport, hydrolase; HET: GDP; 1.55A {Homo sapiens} SCOP: c.37.1.8 PDB: 2f9m_A* 1yzk_A* 2hv8_A* 2gzd_A* 2gzh_A* 2d7c_A* 3bfk_A* Back     alignment and structure
>1zu4_A FTSY; GTPase, signal recognition particle, SRP, receptor, protein transport; 1.95A {Mycoplasma mycoides} PDB: 1zu5_A Back     alignment and structure
>3mfy_A V-type ATP synthase alpha chain; A-type ATP synthase, P loop, phenylalanine mutant, hydrolase; 2.35A {Pyrococcus horikoshii} PDB: 3i4l_A* 3i72_A 3i73_A* 3p20_A 3ikj_A 3qg1_A 3nd8_A 3nd9_A 1vdz_A 3qia_A 3qjy_A 3m4y_A 3se0_A 3sdz_A Back     alignment and structure
>3io3_A DEHA2D07832P; chaperone, membrane traffic, ATPase; HET: ADP; 1.80A {Debaryomyces hansenii} Back     alignment and structure
>1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} Back     alignment and structure
>2wjg_A FEOB, ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GDP; 2.20A {Methanocaldococcus jannaschii} Back     alignment and structure
>2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* Back     alignment and structure
>2lkc_A Translation initiation factor IF-2; NMR {Geobacillus stearothermophilus} PDB: 2lkd_A* Back     alignment and structure
>2v9p_A Replication protein E1; AAA+ molecular motor, DNA replication, DNA translocation, nucleotide-binding, DNA-binding; 3.00A {Bovine papillomavirus type 1} PDB: 2gxa_A* Back     alignment and structure
>1z2a_A RAS-related protein RAB-23; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 1.90A {Mus musculus} SCOP: c.37.1.8 PDB: 1z22_A* Back     alignment and structure
>1q3t_A Cytidylate kinase; nucleotide monophosphate kinase, CMP kinase, transferase; NMR {Streptococcus pneumoniae} SCOP: c.37.1.1 Back     alignment and structure
>2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C Back     alignment and structure
>2r8r_A Sensor protein; KDPD, PFAM02702, MCSG, structural genomics, protein structure initiative, midwest center for structural genomics, kinase; 2.30A {Pseudomonas syringae PV} Back     alignment and structure
>1svi_A GTP-binding protein YSXC; ENGB, GTPase, GDP, hydrolase; HET: GDP; 1.95A {Bacillus subtilis} SCOP: c.37.1.8 PDB: 1sul_A* 1svw_A* Back     alignment and structure
>2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima} Back     alignment and structure
>3iqw_A Tail-anchored protein targeting factor GET3; ATPase, Zn binding, protein transport; HET: ANP; 3.00A {Chaetomium thermophilum} PDB: 3iqx_A* 3ibg_A* Back     alignment and structure
>4edh_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology; HET: TMP ADP; 1.32A {Pseudomonas aeruginosa PAO1} PDB: 4e5u_A* 4esh_A* 4gmd_A* 3uwk_A* 3uwo_A* 3uxm_A* Back     alignment and structure
>2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} Back     alignment and structure
>2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} Back     alignment and structure
>1nrj_B SR-beta, signal recognition particle receptor beta subunit; transmembrane, endoplasmic reticulum, GTP-binding; HET: GTP; 1.70A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>3con_A GTPase NRAS; structural genomics consortium, SGC, GDP, oncogene, disease mutation, golgi apparatus, GTP-binding, lipoprotein membrane, methylation; HET: GDP; 1.65A {Homo sapiens} PDB: 2pmx_A* 3gft_A* 4q21_A* Back     alignment and structure
>2www_A Methylmalonic aciduria type A protein, mitochondrial; transport protein, nucleotide-binding; HET: GDP 2PE; 2.64A {Homo sapiens} Back     alignment and structure
>1u8z_A RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNHP, GDP, GTPase, signaling protein; HET: GDP; 1.50A {Saguinus oedipus} SCOP: c.37.1.8 PDB: 1u8y_A* 1u90_A* 1uad_A* 1zc3_A* 1zc4_A* 2kwi_A* 2ke5_A* Back     alignment and structure
>3geh_A MNME, tRNA modification GTPase MNME; G protein, U34, GTP-binding, HYDR magnesium, metal-binding, nucleotide-binding, potassium, TR processing; HET: GDP FON; 3.20A {Nostoc SP} Back     alignment and structure
>2nzj_A GTP-binding protein REM 1; GDP/GTP binding, GTP hydrolysis, RAD and GEM like GTP protein 1, structural genomics; HET: GDP; 2.50A {Homo sapiens} Back     alignment and structure
>3sop_A Neuronal-specific septin-3; hydrolase; HET: GDP; 2.88A {Homo sapiens} Back     alignment and structure
>2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A Back     alignment and structure
>1f6b_A SAR1; gtpases, N-terminal helix, Mg-containing complex, protein transport; HET: GDP; 1.70A {Cricetulus griseus} SCOP: c.37.1.8 PDB: 2fmx_A* 2fa9_A* 2gao_A* Back     alignment and structure
>2ocp_A DGK, deoxyguanosine kinase; protein-nucleotide complex, transferase; HET: DTP; 2.80A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>3hjn_A DTMP kinase, thymidylate kinase; ATP-binding, nucleotide biosynth nucleotide-binding, transferase, structural genomics; HET: ADP TYD; 2.10A {Thermotoga maritima} Back     alignment and structure
>2gj8_A MNME, tRNA modification GTPase TRME; G-domain dimer, alpha-beta-sandwich, hydrolase; HET: GDP; 1.70A {Escherichia coli BL21} SCOP: c.37.1.8 PDB: 2gj9_A* 2gja_A* 1rfl_A Back     alignment and structure
>1svm_A Large T antigen; AAA+ fold, viral protein; HET: ATP; 1.94A {Simian virus 40} SCOP: c.37.1.20 PDB: 1svl_A* 1svo_A 1n25_A 2h1l_A Back     alignment and structure
>2erx_A GTP-binding protein DI-RAS2; GTP hydrolysis, transport protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3vr4_A V-type sodium ATPase catalytic subunit A; V-ATPase, rotary motor, P-loop, hydrolas ATPase, ATP binding; HET: MSE B3P; 2.17A {Enterococcus hirae} PDB: 3vr3_A* 3vr2_A* 3vr5_A 3vr6_A* Back     alignment and structure
>1z08_A RAS-related protein RAB-21; RAB GTPase, vesicular trafficking, protein transport; HET: GNP; 1.80A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ot3_B 1yzu_A* 1z0i_A 1yzt_A* Back     alignment and structure
>1kao_A RAP2A; GTP-binding protein, small G protein, GDP, RAS; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2rap_A* 3rap_R* Back     alignment and structure
>3q72_A GTP-binding protein RAD; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.66A {Homo sapiens} SCOP: c.37.1.8 PDB: 3q7p_A* 3q7q_A* 2gjs_A* 2dpx_A* Back     alignment and structure
>1c1y_A RAS-related protein RAP-1A; GTP-binding proteins, protein-protein complex, effectors, signaling protein; HET: GTP; 1.90A {Homo sapiens} SCOP: c.37.1.8 PDB: 3kuc_A* 1gua_A* 3cf6_R* 3brw_D* Back     alignment and structure
>1ek0_A Protein (GTP-binding protein YPT51); vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase; HET: MHO GNP GDP; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>1z0j_A RAB-22, RAS-related protein RAB-22A; RAB GTPase, RAB22 GTPase, rabenosyn, endosomal trafficking; HET: GTP; 1.32A {Mus musculus} SCOP: c.37.1.8 PDB: 1yvd_A* Back     alignment and structure
>1m7b_A RND3/RHOE small GTP-binding protein; small GTPase, signaling protein; HET: GTP; 2.00A {Homo sapiens} SCOP: c.37.1.8 PDB: 2v55_B* Back     alignment and structure
>2vp4_A Deoxynucleoside kinase; ATP-binding, DNA synthesis, phosphoprotein, feedback inhibition, deoxyribonucleoside kinase, salvage pathway; HET: DCP; 2.20A {Drosophila melanogaster} SCOP: c.37.1.1 PDB: 1j90_A* 2jj8_A* 2vp2_A* 1oe0_A* 2vp5_A* 2vp6_A* 2vp9_A* 2vpp_A* 2vqs_A* 2vp0_A* 1ot3_A* 2jcs_A* 1zm7_A* 1zmx_A* Back     alignment and structure
>3pqc_A Probable GTP-binding protein ENGB; rossmann fold, GTPase, cell cycle, hydrolase; HET: GDP; 1.90A {Thermotoga maritima} PDB: 3pr1_A Back     alignment and structure
>1ky3_A GTP-binding protein YPT7P; vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase, endocytosis/exocytosis complex; HET: GDP; 1.35A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ky2_A* Back     alignment and structure
>1nij_A Hypothetical protein YJIA; structural genomics, P-loop protein, GTP binding, structure function project, S2F, unknown function; 2.00A {Escherichia coli} SCOP: c.37.1.10 d.237.1.1 Back     alignment and structure
>3q85_A GTP-binding protein REM 2; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.76A {Mus musculus} SCOP: c.37.1.8 PDB: 4aii_A* Back     alignment and structure
>2pjz_A Hypothetical protein ST1066; ATP binding protein, structural genomics, NPPSFA; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>2v3c_C SRP54, signal recognition 54 kDa protein; nucleotide-binding, signal recognition particle, GTP-binding, RNA-binding; 2.50A {Methanocaldococcus jannaschii} PDB: 3ndb_B Back     alignment and structure
>3ihw_A Centg3; RAS, centaurin, GTPase, structural genomics, structural genomics consortium, SGC, alternative splicing, ANK repeat, cytoplasm, GTP-binding; 1.92A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>2fn4_A P23, RAS-related protein R-RAS; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ery_A* Back     alignment and structure
>1wms_A RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, protein transport; HET: GDP; 1.25A {Homo sapiens} SCOP: c.37.1.8 PDB: 1s8f_A* 1yzl_A* 2ocb_A* Back     alignment and structure
>3fvq_A Fe(3+) IONS import ATP-binding protein FBPC; nucleotide binding domain, ABC motor domain, ferric iron TRA ATP-binding, cell inner membrane; HET: ATP; 1.90A {Neisseria gonorrhoeae} Back     alignment and structure
>1g16_A RAS-related protein SEC4; G protein RAB, signaling protein, endocytosis/exocytosis complex; HET: GDP; 1.80A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1g17_A* 2ocy_C 2eqb_A Back     alignment and structure
>2cxx_A Probable GTP-binding protein ENGB; structural genomics, NPPSFA, national P protein structural and functional analyses; HET: GDP; 1.70A {Pyrococcus horikoshii} SCOP: c.37.1.8 Back     alignment and structure
>2b6h_A ADP-ribosylation factor 5; membrane trafficking, GDP, structural genomics, structural G consortium, SGC, protein transport; HET: GDP; 1.76A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z6x_A* 3aq4_A* Back     alignment and structure
>2hxs_A RAB-26, RAS-related protein RAB-28; GTPase, signaling protein; HET: G3D; 1.10A {Homo sapiens} PDB: 2hy4_A* 3e5h_A* Back     alignment and structure
>2orw_A Thymidine kinase; TMTK, TP4A, transferase; HET: 4TA; 1.50A {Thermotoga maritima} PDB: 2qpo_A 2qq0_A* 2qqe_A* Back     alignment and structure
>3c5c_A RAS-like protein 12; GDP, GTPase, structural genomics consortium, SGC, limited proteolysis, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.85A {Homo sapiens} Back     alignment and structure
>3kta_A Chromosome segregation protein SMC; structural maintenance of chromosomes, ABC ATPase, CFTR adenylate kinase, AP5A, transferase; HET: AP5; 1.63A {Pyrococcus furiosus} PDB: 1xex_A* 1xew_X* Back     alignment and structure
>4gzl_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTP binding, membrane, hydrolase; HET: GNP; 2.00A {Homo sapiens} PDB: 3th5_A* 4gzm_A* Back     alignment and structure
>1r2q_A RAS-related protein RAB-5A; GTPase, GNP, atomic resolution, protein transport; HET: GNP; 1.05A {Homo sapiens} SCOP: c.37.1.8 PDB: 1n6h_A* 1tu4_A* 1tu3_A* 1n6k_A* 1n6i_A* 1n6l_A* 1n6o_A* 1n6p_A* 1n6n_A* 1n6r_A* 3mjh_A* 1z0d_A* 1huq_A* 2hei_A* 1z07_A* Back     alignment and structure
>3eph_A TRNA isopentenyltransferase; transferase, alternative initiation, ATP-binding, cytoplasm, mitochondrion, nucleotide-binding, nucleus; 2.95A {Saccharomyces cerevisiae} PDB: 3epj_A 3epk_A* 3epl_A* Back     alignment and structure
>1r8s_A ADP-ribosylation factor 1; protein transport/exchange factor, protein transport-exchang complex; HET: GDP; 1.46A {Bos taurus} SCOP: c.37.1.8 PDB: 1re0_A* 1s9d_A* 1u81_A* 1r8q_A* 1rrf_A* 1rrg_A* 1hur_A* 1o3y_A* 1j2j_A* 2j59_A* 1mr3_F* 2k5u_A* 3lrp_A* 3tjz_A* 3rd1_A* 2ksq_A* 2a5d_A* 2a5f_A* 2j5x_A* 1e0s_A* ... Back     alignment and structure
>1p5z_B DCK, deoxycytidine kinase; nucleoside kinase, P-loop, ARAC, cytarabine, transferase; HET: AR3 ADP; 1.60A {Homo sapiens} SCOP: c.37.1.1 PDB: 1p60_A* 1p61_B* 1p62_B* 2a7q_A* 2qrn_A* 2qro_A* 3exk_A* 3hp1_A* 2no7_A* 2no1_A* 2no6_A* 2no0_A* 2no9_A* 2noa_A* 2zi5_A* 2zi4_A* 2zi6_A* 2zi7_B* 2zia_A* 3kfx_A* ... Back     alignment and structure
>2h92_A Cytidylate kinase; rossmann fold, transferase; HET: C5P PG4; 2.30A {Staphylococcus aureus} Back     alignment and structure
>1m2o_B GTP-binding protein SAR1, GTP binding protein; zinc-finger, beta barrel, VWA domain, gelsolin domain,; HET: GNP; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 2qtv_B* Back     alignment and structure
>1z0f_A RAB14, member RAS oncogene family; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 2.15A {Homo sapiens} SCOP: c.37.1.8 PDB: 2aed_A* 4drz_A* Back     alignment and structure
>2bbs_A Cystic fibrosis transmembrane conductance regulator; ATP binding cassette, transport protein; HET: ATP; 2.05A {Homo sapiens} PDB: 2bbt_A* 1xmi_A* 1xmj_A* 2bbo_A* 3si7_A* 1r0w_A 1q3h_A 1r0x_A* 1r0y_A* 1r0z_A* 1r10_A* 1xf9_A* 1xfa_A* Back     alignment and structure
>3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A* Back     alignment and structure
>1upt_A ARL1, ADP-ribosylation factor-like protein 1; hydrolase/protein-binding, complex (GTPase/golgin), golgin-245, GRIP, golgin, GTPase, G-protein; HET: GTP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1r4a_A* Back     alignment and structure
>3tw8_B RAS-related protein RAB-35; longin domain, RAB GTPase, guanine exchange factor; 2.10A {Homo sapiens} Back     alignment and structure
>2axn_A 6-phosphofructo-2-kinase/fructose-2,6- biphosphatase 3 (6PF-2-K/FRU- 2,6-P2ASE brain/placenta-type...; bifunctional enzyme, EDTA complex; HET: F6P EDT ADP; 2.10A {Homo sapiens} PDB: 2dwo_A* 2dwp_A* 2i1v_B* 3qpu_A* 3qpv_A* 3qpw_A* Back     alignment and structure
>4dsu_A GTPase KRAS, isoform 2B; small G-protein, signaling, hydrolase; HET: GDP; 1.70A {Homo sapiens} PDB: 4dsn_A* 4dst_A* 4dso_A* Back     alignment and structure
>1ksh_A ARF-like protein 2; small GTPase, small GTP-binding protein, ARF family; HET: CME GDP; 1.80A {Mus musculus} SCOP: c.37.1.8 PDB: 1ksg_A* 1ksj_A* 3doe_A* 3dof_A* Back     alignment and structure
>3kkq_A RAS-related protein M-RAS; GTP-binding, GTPase, signaling protein; HET: GDP; 1.20A {Mus musculus} SCOP: c.37.1.8 PDB: 3kkp_A* 3kko_A* 3pit_A* 3pir_A* 1x1r_A* 1x1s_A* Back     alignment and structure
>2bme_A RAB4A, RAS-related protein RAB4A; GTP-binding protein, vesicular transport, endocytosis, prenylation, protein transport, transport; HET: GNP; 1.57A {Homo sapiens} SCOP: c.37.1.8 PDB: 2bmd_A* 1yu9_A* 1z0k_A* Back     alignment and structure
>3tui_C Methionine import ATP-binding protein METN; ABC-transporter, type I ABC type importer, methionine uptake transporter, membrane protein; HET: ADP; 2.90A {Escherichia coli} PDB: 3tuj_C 3tuz_C* 3dhw_C Back     alignment and structure
>1z47_A CYSA, putative ABC-transporter ATP-binding protein; alpha/beta motif, beta sandwich, ligand binding protein; 1.90A {Alicyclobacillus acidocaldarius} Back     alignment and structure
>2y8e_A RAB-protein 6, GH09086P, RAB6; hydrolase, nucleotide binding, GTP binding; HET: GNP; 1.39A {Drosophila melanogaster} PDB: 3cwz_A* 1yzq_A* 2gil_A* 2e9s_A* 2fe4_A* 2ffq_A* 1d5c_A* Back     alignment and structure
>3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* Back     alignment and structure
>1cp2_A CP2, nitrogenase iron protein; oxidoreductase; 1.93A {Clostridium pasteurianum} SCOP: c.37.1.10 Back     alignment and structure
>1mh1_A RAC1; GTP-binding, GTPase, small G-protein, RHO family, RAS super family; HET: GNP; 1.38A {Homo sapiens} SCOP: c.37.1.8 PDB: 1hh4_A* 2p2l_A* 2h7v_A* 1g4u_R* 1i4d_D* 1i4l_D* 2vrw_A 1e96_A* 1i4t_D* 2rmk_A* 2yin_C 1ryf_A* 1ryh_A* 3su8_A* 3sua_A* 2fju_A* 1he1_C* 2nz8_A 1foe_B 3bji_C ... Back     alignment and structure
>3bc1_A RAS-related protein RAB-27A; RAB27, GTPase, RAB, signaling protein, GDPNP, SLP2A, exophil GTP-binding, lipoprotein, membrane, methylation; HET: GNP; 1.80A {Mus musculus} PDB: 2iey_A* 2if0_A* 2zet_A* Back     alignment and structure
>2iwr_A Centaurin gamma 1; ANK repeat, zinc-finger, GTP-binding, polymorphism, nucleotide-binding, alternative splicing, protein transport; HET: CAF; 1.5A {Homo sapiens} PDB: 2bmj_A Back     alignment and structure
>1g8f_A Sulfate adenylyltransferase; alpha-beta protein, beta-barrel, rossmann-fold, kinase fold; 1.95A {Saccharomyces cerevisiae} SCOP: b.122.1.3 c.26.1.5 c.37.1.15 PDB: 1g8g_A* 1g8h_A* 1j70_A 1jec_A 1jed_A* 1jee_A* Back     alignment and structure
>2a9k_A RAS-related protein RAL-A; bacterial ADP-ribosyltransferase, RAL, RHO, GD binding; HET: GDP NAD; 1.73A {Homo sapiens} SCOP: c.37.1.8 PDB: 2a78_A* Back     alignment and structure
>1p9r_A General secretion pathway protein E; bacterial type II secretion system cytoplasmic protein - GSPE, putative ATPase/ ATP binding protein; 2.50A {Vibrio cholerae} SCOP: c.37.1.11 PDB: 1p9w_A* Back     alignment and structure
>2yv5_A YJEQ protein; hydrolase, GTPase, permutation, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GDP; 1.90A {Aquifex aeolicus} Back     alignment and structure
>2oil_A CATX-8, RAS-related protein RAB-25; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.30A {Homo sapiens} Back     alignment and structure
>3bwd_D RAC-like GTP-binding protein ARAC6; G domain, cytoplasm, lipoprotein, membrane, methylation, nucleotide-binding, prenylation, ----; HET: GDP; 1.53A {Arabidopsis thaliana} PDB: 2nty_C* 2wbl_C Back     alignment and structure
>2yyz_A Sugar ABC transporter, ATP-binding protein; sugar transport, alpha and beta proteins (A/B) TM0421, structural genomics, NPPSFA; 2.11A {Thermotoga maritima} Back     alignment and structure
>3rlf_A Maltose/maltodextrin import ATP-binding protein M; integral membrane protein, ATPase, ABC transporter, membrane transmembrane; HET: UMQ MAL PGV ANP; 2.20A {Escherichia coli} PDB: 1q1e_A 1q12_A* 2awo_A* 3fh6_A 3puv_A* 3puw_A* 3pux_A* 3puy_A* 3puz_A* 3pv0_A* 2awn_A* 2r6g_A* 1q1b_A Back     alignment and structure
>3t1o_A Gliding protein MGLA; G domain containing protein, bacterial GTPase, bacterial POL motility, POLE localisation, alpha/beta protein; HET: GDP; 1.90A {Thermus thermophilus} PDB: 3t12_A* 3t1q_A* 3t1t_A* 3t1v_A* Back     alignment and structure
>3t5g_A GTP-binding protein RHEB; immunoglobulin-like beta sandwitch, PDE delta, RHEB; HET: GDP FAR; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 1xtq_A* 1xtr_A* 1xts_A* 2l0x_A* 3sea_A* Back     alignment and structure
>2efe_B Small GTP-binding protein-like; GEF, GTPase, VPS9, nucleotide, transport protein; HET: GNH; 2.08A {Arabidopsis thaliana} PDB: 2efd_B 2efc_B* 2efh_B* Back     alignment and structure
>2atv_A RERG, RAS-like estrogen-regulated growth inhibitor; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>4b3f_X DNA-binding protein smubp-2; hydrolase, helicase; 2.50A {Homo sapiens} PDB: 4b3g_A Back     alignment and structure
>2it1_A 362AA long hypothetical maltose/maltodextrin transport ATP-binding protein; structural genomics, NPPSFA; 1.94A {Pyrococcus horikoshii} Back     alignment and structure
>2bov_A RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, RAla, GTPase, ribosylating toxin, GTP-binding, lipoprotein, prenylation; HET: GDP; 2.66A {Homo sapiens} Back     alignment and structure
>2g6b_A RAS-related protein RAB-26; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, unknown function; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1g29_1 MALK, maltose transport protein MALK; ATPase, active transport, maltose uptake and regulation, sugar binding protein; 1.90A {Thermococcus litoralis} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 2d62_A Back     alignment and structure
>2afh_E Nitrogenase iron protein 1; nitrogen fixation, iron-sulfur, metal-binding, molybdenum, oxidoreductase; HET: HCA CFN CLF PGE PG4 P6G 1PE; 2.10A {Azotobacter vinelandii} SCOP: c.37.1.10 PDB: 1g1m_A 1g5p_A 1m1y_E* 1m34_E* 1n2c_E* 1nip_A* 1fp6_A* 2afi_E* 2afk_E* 2nip_A 1de0_A 1xcp_A* 1xdb_A 1xd8_A 1xd9_A* 1g20_E* 1g21_E* 2c8v_A* 1rw4_A Back     alignment and structure
>1vg8_A RAS-related protein RAB-7; GTP-binding protein, protein transport; HET: GNP; 1.70A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 1vg0_B* 3law_A* 1t91_A* 1yhn_A* 1vg1_A* 1vg9_B* Back     alignment and structure
>1lw7_A Transcriptional regulator NADR; NMN, NMN adenylyl transferase, ribosylnicotinamide KINA transferase; HET: NAD; 2.90A {Haemophilus influenzae} SCOP: c.26.1.3 c.37.1.1 Back     alignment and structure
>2cjw_A GTP-binding protein GEM; nucleotide-binding, small GTPase, conformational change, cysteine-modified, G-protein hydrolase; HET: GDP; 2.10A {Homo sapiens} PDB: 2cjw_B* 2ht6_A* Back     alignment and structure
>1v43_A Sugar-binding transport ATP-binding protein; ATPase, active transport, sugar uptake and regulation, transport protein; 2.20A {Pyrococcus horikoshii} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 1vci_A* Back     alignment and structure
>3llu_A RAS-related GTP-binding protein C; structural genomics consortium, SGC, cytoplasm, nucleotide-binding, nucleus, phosphoprotein; HET: GNP; 1.40A {Homo sapiens} PDB: 2q3f_A* Back     alignment and structure
>1pui_A ENGB, probable GTP-binding protein ENGB; structural genomics, nysgxrc T16, GTPase, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.37.1.8 Back     alignment and structure
>1zbd_A Rabphilin-3A; G protein, effector, RABCDR, synaptic exocytosis, RAB protein, RAB3A; HET: GTP; 2.60A {Rattus norvegicus} SCOP: c.37.1.8 Back     alignment and structure
>1gwn_A RHO-related GTP-binding protein RHOE; GTPase, inactive GTPase, signal transduction; HET: GTP; 2.1A {Mus musculus} SCOP: c.37.1.8 Back     alignment and structure
>2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A* Back     alignment and structure
>2h57_A ADP-ribosylation factor-like protein 6; GTP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GTP; 2.00A {Homo sapiens} Back     alignment and structure
>2fh5_B SR-beta, signal recognition particle receptor beta subunit; endomembrane targeting, GTPase, GAP, longin domain, SEDL, transport protein; HET: GTP; 2.45A {Mus musculus} SCOP: c.37.1.8 PDB: 2go5_2 Back     alignment and structure
>3cbq_A GTP-binding protein REM 2; FLJ38964A, structural genomics consortium, SGC, GDP, membrane, nucleotide-binding, nucleotide binding protein; HET: GDP; 1.82A {Homo sapiens} Back     alignment and structure
>2fg5_A RAB-22B, RAS-related protein RAB-31; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.80A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2qm8_A GTPase/ATPase; G protein, G3E, metallochaperone, chaperone; HET: MSE; 1.70A {Methylobacterium extorquens} SCOP: c.37.1.10 PDB: 2qm7_A* Back     alignment and structure
>2qu8_A Putative nucleolar GTP-binding protein 1; GTPase, malaria, structural genomics, structural genomics consortium, SGC, unknown function; HET: GDP; 2.01A {Plasmodium falciparum} Back     alignment and structure
>2ew1_A RAS-related protein RAB-30; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3clv_A RAB5 protein, putative; malaria, GTPase, structural genomics, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.89A {Plasmodium falciparum} Back     alignment and structure
>3oes_A GTPase rhebl1; small GTPase, structural genomics, structural genomics conso SGC, hydrolase; HET: GNP; 2.30A {Homo sapiens} Back     alignment and structure
>1zd9_A ADP-ribosylation factor-like 10B; transport protein, GDP-binding, membrane trafficking, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2al7_A* 2h18_A* Back     alignment and structure
>2gf9_A RAS-related protein RAB-3D; G-protein, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.53A {Homo sapiens} PDB: 3rab_A* Back     alignment and structure
>4hlc_A DTMP kinase, thymidylate kinase; TMK, MRSA, pipiridine, transfera transferase inhibitor complex; HET: T05; 1.55A {Staphylococcus aureus subsp} PDB: 2cck_A 4gfd_A* 4gsy_A* 4hdc_A* 4hej_A* 2ccj_A* 4hld_A* 2ccg_A* Back     alignment and structure
>3reg_A RHO-like small GTPase; cytoskeleton, nucleotide-binding, GTP-binding, signaling Pro lipoprotein, prenylation; HET: GSP; 1.80A {Entamoeba histolytica} PDB: 3ref_B* 4dvg_A* Back     alignment and structure
>3tkl_A RAS-related protein RAB-1A; vesicle trafficking, protein transport-protein binding compl; HET: GTP; 2.18A {Homo sapiens} Back     alignment and structure
>2a5j_A RAS-related protein RAB-2B; GTPase, signal transduction, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.50A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z0a_A* Back     alignment and structure
>4dkx_A RAS-related protein RAB-6A; GTP binding fold, membrane trafficking, GTP, cytosol, protei transport; HET: GDP; 1.90A {Homo sapiens} PDB: 3bbp_A* Back     alignment and structure
>3d31_A Sulfate/molybdate ABC transporter, ATP-binding protein; ATP-binding, nucleotide-binding, membrane, transmembrane, transport protein; 3.00A {Methanosarcina acetivorans} SCOP: b.40.6.3 c.37.1.12 Back     alignment and structure
>3v9p_A DTMP kinase, thymidylate kinase; ssgcid, STRU genomics, seattle structural genomics center for infectious transferase; 1.90A {Burkholderia thailandensis} Back     alignment and structure
>3kjh_A CO dehydrogenase/acetyl-COA synthase complex, accessory protein COOC; Zn-bound dimer, nickel binding protein, ATPase; 1.90A {Carboxydothermus hydrogenoformans} PDB: 3kjg_A* 3kje_A 3kji_A* Back     alignment and structure
>3gmt_A Adenylate kinase; ssgcid, ATP-BIN cytoplasm, nucleotide biosynthesis, nucleotide-BIND transferase, structural genomics; 2.10A {Burkholderia pseudomallei 1710B} Back     alignment and structure
>2q3h_A RAS homolog gene family, member U; GTPase, structural genomics, structural genomics consortium,; HET: GDP; 1.73A {Homo sapiens} Back     alignment and structure
>3tqf_A HPR(Ser) kinase; transferase, hydrolase; 2.80A {Coxiella burnetii} Back     alignment and structure
>3fdi_A Uncharacterized protein; cytidylate kinase like protein, PSI, MCSG, PRK04182 class ME structural genomics, protein structure initiative; 2.20A {Eubacterium ventriosum} Back     alignment and structure
>2o52_A RAS-related protein RAB-4B; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.20A {Homo sapiens} Back     alignment and structure
>1z06_A RAS-related protein RAB-33B; RAB GTPase, RAB33B GTPase, vesicular trafficking, protein transport; HET: GNP; 1.81A {Mus musculus} SCOP: c.37.1.8 PDB: 2g77_B* Back     alignment and structure
>4bas_A ADP-ribosylation factor, putative (small GTPase, putative); hydrolase; HET: GNP; 2.00A {Trypanosoma brucei TREU927} Back     alignment and structure
>2p5s_A RAS and EF-hand domain containing; G-protein, RAB, GDP, structural genomics, SGC, structural genomics consortium, signaling protein; HET: GDP; 2.15A {Homo sapiens} Back     alignment and structure
>2gza_A Type IV secretion system protein VIRB11; ATPase, hydrolase; 2.60A {Brucella suis} Back     alignment and structure
>3lxx_A GTPase IMAP family member 4; structural genomics consortium, SGC, coiled coil, GTP- binding, nucleotide-binding, immune system; HET: GDP; 2.15A {Homo sapiens} Back     alignment and structure
>1x3s_A RAS-related protein RAB-18; GTPase, GNP, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GNP; 1.32A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3dz8_A RAS-related protein RAB-3B; GDP, GTPase, structural genomics consortium, SGC, cell GTP-binding, lipoprotein, membrane, methylation; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3dzd_A Transcriptional regulator (NTRC family); sigma43 activator, AAA+ ATPase, response regulator, transcriptional activator, ATP-binding; HET: ADP; 2.40A {Aquifex aeolicus} PDB: 1zit_A 2jrl_A Back     alignment and structure
>2gf0_A GTP-binding protein DI-RAS1; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, transport protein; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2bcg_Y Protein YP2, GTP-binding protein YPT1; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ukv_Y* 3cue_F* 1yzn_A* 3sfv_A* 2wwx_A 2fol_A* 3nkv_A* 3jza_A* 2rhd_A* Back     alignment and structure
>3gd7_A Fusion complex of cystic fibrosis transmembrane conductance regulator, residues 1193-1427...; CFTR, ABC transporter, nucleotide binding domain, NBD; HET: B44; 2.70A {Homo sapiens} Back     alignment and structure
>1bif_A 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; transferase (phospho), phosphatase, hydrolase (phosp glycolysis, bifunctional enzyme; HET: AGS; 2.00A {Rattus norvegicus} SCOP: c.37.1.7 c.60.1.4 PDB: 3bif_A* 2bif_A* 1k6m_A* 1c80_A* 1c7z_A* 1c81_A* 1tip_A* 1fbt_A Back     alignment and structure
>2h17_A ADP-ribosylation factor-like protein 5A; GDP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GDP; 1.70A {Homo sapiens} PDB: 2h16_A* 1z6y_A* 1yzg_A* Back     alignment and structure
>2qnr_A Septin-2, protein NEDD5; structural genomics consortium, SGC, mitosis, GDP, C cycle, cell division, GTP-binding, nucleotide-binding; HET: GDP; 2.60A {Homo sapiens} PDB: 2qa5_A* 3ftq_A* Back     alignment and structure
>1tq4_A IIGP1, interferon-inducible GTPase; interferon gamma, dimer, immunology, signaling protein; HET: GDP; 1.95A {Mus musculus} SCOP: c.37.1.8 PDB: 1tqd_A* 1tq6_A* 1tpz_A* 1tq2_A* Back     alignment and structure
>2p67_A LAO/AO transport system kinase; ARGK, structural GEN PSI-2, protein structure initiative, NEW YORK SGX research for structural genomics; 1.80A {Escherichia coli} SCOP: c.37.1.10 Back     alignment and structure
>2g3y_A GTP-binding protein GEM; small GTPase, GDP, inactive state, RGK family, structur genomics, structural genomics consortium, SGC, signaling PR; HET: GDP; 2.40A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1c9k_A COBU, adenosylcobinamide kinase; alpha/beta structure rossmann fold P-loop, transferase; HET: 5GP; 2.20A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1cbu_A Back     alignment and structure
>1ega_A Protein (GTP-binding protein ERA); GTPase, RNA-binding, RAS-like, hydrolase; 2.40A {Escherichia coli} SCOP: c.37.1.8 d.52.3.1 PDB: 1x1l_X 3ieu_A* 1x18_X Back     alignment and structure
>2j1l_A RHO-related GTP-binding protein RHOD; GTPase, membrane, prenylation, hydrolase, nucleotide-binding, methylation, lipoprotein, endosome DYNA; HET: GDP; 2.5A {Homo sapiens} Back     alignment and structure
>1oxx_K GLCV, glucose, ABC transporter, ATP binding protein; ABC-ATPase, ATP-binding cassette, ATPase, transport protein; 1.45A {Sulfolobus solfataricus} SCOP: b.40.6.3 c.37.1.12 PDB: 1oxs_C 1oxt_A 1oxu_A* 1oxv_A* Back     alignment and structure
>2il1_A RAB12; G-protein, GDP, GTPase, predicted, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.10A {Homo sapiens} Back     alignment and structure
>1u0l_A Probable GTPase ENGC; permutation, OB-fold, zinc-finger, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; HET: GDP; 2.80A {Thermotoga maritima} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>2atx_A Small GTP binding protein TC10; GTPase, P-loop, alpha-beta, hydrolase; HET: GNP; 2.65A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2fv8_A H6, RHO-related GTP-binding protein RHOB; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3k53_A Ferrous iron transport protein B; GTPase fold, helical bundle, G-protein, prokaryote, GTP-BIND nucleotide-binding, metal transport; 2.70A {Pyrococcus furiosus} Back     alignment and structure
>2j69_A Bacterial dynamin-like protein; FZO, FZL, GTPase, hydrolase; 3.0A {Nostoc punctiforme} PDB: 2j68_A 2w6d_A* Back     alignment and structure
>2j0v_A RAC-like GTP-binding protein ARAC7; nucleotide-binding protein, ROP9, atrac7, membrane, palmitate, RHO GTPase; HET: GDP; 1.78A {Arabidopsis thaliana} Back     alignment and structure
>2hup_A RAS-related protein RAB-43; G-protein, GDP, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.05A {Homo sapiens} Back     alignment and structure
>2obl_A ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O127} PDB: 2obm_A* Back     alignment and structure
>3gqb_A V-type ATP synthase alpha chain; A3B3, V-ATPase, ATP synthesis, ATP-binding, hydrogen ION TRA hydrolase, ION transport; 2.80A {Thermus thermophilus HB8} PDB: 3a5c_A* 3a5d_A 3j0j_A* 1um2_C Back     alignment and structure
>3cr8_A Sulfate adenylyltranferase, adenylylsulfate kinase; APS kinase, transferase, sulfate metabolism, nucleotide 2 kinase; 2.95A {Thiobacillus denitrificans} Back     alignment and structure
>3cph_A RAS-related protein SEC4; RAB GTPase, prenylation, vesicular transport, cytoplasm, cytoplasmic vesicle, exocytosis, GTP-binding; HET: GDP; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>2gco_A H9, RHO-related GTP-binding protein RHOC; GTPase,signaling protein, signaling Pro; HET: GNP; 1.40A {Homo sapiens} PDB: 2gcn_A* 2gcp_A* 1z2c_A* 1x86_B 2rgn_C* 1lb1_B 1s1c_A* 3kz1_E* 3lxr_A* 3lwn_A* 3lw8_A* 1cxz_A* 1a2b_A* 1ow3_B* 1ftn_A* 1cc0_A* 3msx_A* 1xcg_B 3t06_B 1tx4_B* ... Back     alignment and structure
>2pt7_A CAG-ALFA; ATPase, protein-protein complex, type IV secretion, hydrolas binding complex; 2.40A {Helicobacter pylori} SCOP: c.37.1.11 PDB: 1nly_A* 1nlz_A 1opx_A* 1g6o_A Back     alignment and structure
>2fu5_C RAS-related protein RAB-8A; MSS4:RAB8 protein complex, GEF:GTPase nucleotide free complex; 2.00A {Mus musculus} SCOP: c.37.1.8 PDB: 3qbt_A* 3tnf_A* Back     alignment and structure
>3q3j_B RHO-related GTP-binding protein RHO6; RAS-binding domain, plexin, small GTPase, structural genomic consortium, SGC; HET: GNP; 1.97A {Homo sapiens} PDB: 2rex_B* 2cls_A* Back     alignment and structure
>1mky_A Probable GTP-binding protein ENGA; GTPase, DER, KH-domain, tandem G-domains, ligand binding protein; HET: GDP; 1.90A {Thermotoga maritima} SCOP: c.37.1.8 c.37.1.8 d.52.5.1 Back     alignment and structure
>2f7s_A C25KG, RAS-related protein RAB-27B; G-protein, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2iez_A* Back     alignment and structure
>2rcn_A Probable GTPase ENGC; YJEQ, circularly permuted, GTP-binding, hydrolase, nucleotide-binding; HET: GDP; 2.25A {Salmonella typhimurium} PDB: 2ykr_W 4a2i_V Back     alignment and structure
>1m8p_A Sulfate adenylyltransferase; rossmann fold, phosphosulfate binding, T-state; HET: PPS; 2.60A {Penicillium chrysogenum} SCOP: b.122.1.3 c.26.1.5 c.37.1.15 PDB: 1i2d_A* Back     alignment and structure
>4dzz_A Plasmid partitioning protein PARF; deviant walker BOX, DNA segregation, unknown function; HET: ADP; 1.80A {Escherichia coli} PDB: 4e03_A* 4e07_A* 4e09_A* Back     alignment and structure
>3b1v_A Ferrous iron uptake transporter protein B; G protein, iron transport, GTPase, transmembrane, potassium; HET: GGM; 1.85A {Streptococcus thermophilus} PDB: 3b1w_A* 3lx5_A* 3lx8_A* 3ss8_A* 3b1z_A 3b1y_A* 3b1x_A* 3tah_A* Back     alignment and structure
>3iev_A GTP-binding protein ERA; ERA, GTPase, KH domain, anti-SD, 16S rRNA, 30S ribosome ASSE GTP-binding, nucleotide-binding; HET: GNP; 1.90A {Aquifex aeolicus} PDB: 3r9w_A* 3r9x_A* Back     alignment and structure
>3ch4_B Pmkase, phosphomevalonate kinase; parallel beta-sheet with the strand order 23145, walker A motif, cholesterol biosynthesis, lipid synthesis; 1.76A {Homo sapiens} Back     alignment and structure
>4dhe_A Probable GTP-binding protein ENGB; melioidosis, RAS-like GTPase, cell division, cell cycle, SEP GTP-binding; 2.20A {Burkholderia thailandensis} Back     alignment and structure
>2npi_A Protein CLP1; CLP1-PCF11 complex, ATP binding, ternary complex, transcript; HET: ATP; 2.95A {Saccharomyces cerevisiae} Back     alignment and structure
>2aka_B Dynamin-1; fusion protein, GTPase domain, myosin, contractIle protein; 1.90A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 3l43_A* Back     alignment and structure
>3def_A T7I23.11 protein; chloroplast, TOC33, GTPase, hydrolase; HET: GDP; 1.96A {Arabidopsis thaliana} PDB: 3bb3_A* 3bb4_A* 2j3e_A* Back     alignment and structure
>1x6v_B Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthethase 1; transferase, ATP sulfurylase, APS kinase, PAPS; HET: ADP; 1.75A {Homo sapiens} SCOP: b.122.1.3 c.26.1.5 c.37.1.4 PDB: 1xjq_B* 1xnj_B* 2qjf_A* 2ofx_A* 2ofw_A* Back     alignment and structure
>2xtp_A GTPase IMAP family member 2; immune system, G protein; HET: MSE; 1.50A {Homo sapiens} PDB: 2xto_A* 2xtm_A* 2xtn_A* 3p1j_A Back     alignment and structure
>2qag_B Septin-6, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>3k9g_A PF-32 protein; ssgcid, SBRI, decode biostructures, UW, NIH, niaid, borellia burgdorferi, plasmid partition protein, iodide; 2.25A {Borrelia burgdorferi} PDB: 3k9h_A Back     alignment and structure
>2woj_A ATPase GET3; tail-anchored, membrane protein, targeting factor, endoplasmic reticulum, TRC40, ATP-binding, golgi apparatus; HET: ADP; 1.99A {Saccharomyces cerevisiae} PDB: 3h84_A 3zs8_A 3zs9_A* 3sja_A 3sjb_A 3sjc_A 3sjd_A* 3idq_A 3a36_A 3a37_A* Back     alignment and structure
>3fkq_A NTRC-like two-domain protein; RER070207001320, structural GE joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: ATP 2PE; 2.10A {Eubacterium rectale} Back     alignment and structure
>2woo_A ATPase GET3; tail-anchored, membrane protein, targeting factor, endoplasmic reticulum, TRC40, ATP-binding, golgi apparatus; 3.01A {Schizosaccharomyces pombe} Back     alignment and structure
>2x77_A ADP-ribosylation factor; GTP-binding protein, small GTPase, nucleotide-binding; HET: GDP; 2.10A {Leishmania major} Back     alignment and structure
>1wf3_A GTP-binding protein; GTPase, riken structural genomics/prote initiative, RSGI, structural genomics, hydrolase; HET: GNP; 1.88A {Thermus thermophilus} SCOP: c.37.1.8 d.52.3.1 Back     alignment and structure
>3iby_A Ferrous iron transport protein B; G protein, G domain, iron uptake, cell inner membrane, cell GTP-binding, ION transport, membrane; 2.50A {Legionella pneumophila} Back     alignment and structure
>3cpj_B GTP-binding protein YPT31/YPT8; RAB GTPase, prenylation, vesicular transport, acetylation, golgi apparatus, lipoprotein, membrane; HET: GDP; 2.35A {Saccharomyces cerevisiae} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 359
d2a5yb3277 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenor 3e-21
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: CED-4, NB-ARC domain
species: Caenorhabditis elegans [TaxId: 6239]
 Score = 89.9 bits (222), Expect = 3e-21
 Identities = 39/280 (13%), Positives = 75/280 (26%), Gaps = 44/280 (15%)

Query: 94  IDAPPSSGLILPTTTLVGENTKKIVKKVWEDLM---GDKVTKIGVWGMGGFGKTAIMRHI 150
           +D     G +    T      +  V +V + L          + + G  G GK+ I    
Sbjct: 7   LDRKLLLGNVPKQMTCYI--REYHVDRVIKKLDEMCDLDSFFLFLHGRAGSGKSVIASQA 64

Query: 151 NNRPQEETNEFSD-VIWVTVSQPLDLVKLQAEIAMALKLSLTEDEDKVSR---------A 200
            ++  +      D ++W+  S             + L L   +D                
Sbjct: 65  LSKSDQLIGINYDSIVWLKDSGTAPKSTFDLFTDILLMLKSEDDLLNFPSVEHVTSVVLK 124

Query: 201 RRLLGKLKAKKKFVLILDDIDNHTFCWGLRSMGC-------------------EEVRVPP 241
           R +   L  +   + + DD+         + +                     E + V  
Sbjct: 125 RMICNALIDRPNTLFVFDDVVQEETIRWAQELRLRCLVTTRDVEISNAASQTCEFIEVTS 184

Query: 242 LSKEEALNLFLDKVGRNILHVPTLNEEIINSVVEECAGLQLAIFTVVGCMRGVDEIHEWR 301
           L  +E  +            V    E+++N  +E  +G    +              +  
Sbjct: 185 LEIDECYDFLEAYGMPM--PVGEKEEDVLNKTIELSSGNPATLMMFFKSCEP-KTFEKMA 241

Query: 302 NALNELRGLVRSFSGINADVLGRLEFSYLRLKDKKVQHCF 341
              N+L       S     V     +SY  L    +Q C 
Sbjct: 242 QLNNKLE------SRGLVGVECITPYSYKSL-AMALQRCV 274


Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query359
d2a5yb3277 CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI 100.0
d2fnaa2283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 99.34
d1fnna2276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 99.09
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 99.05
d1r6bx2268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 99.04
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 98.98
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 98.97
d1jbka_195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 98.88
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 98.86
d1w5sa2287 CDC6-like protein APE0152, N-terminal domain {Aero 98.83
d1njfa_239 delta prime subunit of DNA polymerase III, N-domai 98.79
d1ixsb2239 Holliday junction helicase RuvB {Thermus thermophi 98.73
d1qvra2387 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 98.73
d1sxje2252 Replication factor C5 {Baker's yeast (Saccharomyce 98.7
d1sxja2253 Replication factor C1 {Baker's yeast (Saccharomyce 98.64
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 98.58
d1in4a2238 Holliday junction helicase RuvB {Thermotoga mariti 98.52
d1a5ta2207 delta prime subunit of DNA polymerase III, N-domai 98.52
d1ixza_247 AAA domain of cell division protein FtsH {Thermus 98.44
d1e32a2258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 98.43
d1lv7a_256 AAA domain of cell division protein FtsH {Escheric 98.43
d1r7ra3265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 98.11
d1d2na_246 Hexamerization domain of N-ethylmalemide-sensitive 97.74
d2gnoa2198 gamma subunit of DNA polymerase III, N-domain {The 97.49
d1m8pa3183 ATP sulfurylase C-terminal domain {Fungus (Penicil 97.45
d1mo6a1269 RecA protein, ATPase-domain {Mycobacterium tubercu 97.43
d2qy9a2211 GTPase domain of the signal recognition particle r 97.34
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 97.34
d1xp8a1268 RecA protein, ATPase-domain {Deinococcus radiodura 97.34
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 97.33
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 97.33
d1yj5a2172 5' polynucleotide kinase-3' phosphatase, C-termina 97.31
d1gvnb_273 Plasmid maintenance system epsilon/zeta, toxin zet 97.31
d1okkd2207 GTPase domain of the signal recognition particle r 97.28
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 97.25
d1u94a1263 RecA protein, ATPase-domain {Escherichia coli [Tax 97.24
d1qf9a_194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 97.22
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 97.22
d1vmaa2213 GTPase domain of the signal recognition particle r 97.21
d1rz3a_198 Hypothetical protein rbstp0775 {Bacillus stearothe 97.2
d1tf7a2242 Circadian clock protein KaiC {Synechococcus sp. st 97.19
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 97.18
d1ls1a2207 GTPase domain of the signal sequence recognition p 97.16
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 97.11
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 97.1
d1j8yf2211 GTPase domain of the signal sequence recognition p 97.05
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 97.01
d1x6va3195 Adenosine-5'phosphosulfate kinase (APS kinase) {Hu 96.97
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 96.96
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 96.96
d1bifa1213 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata 96.95
d1ukza_196 Uridylate kinase {Baker's yeast (Saccharomyces cer 96.95
d1qvra3315 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 96.92
d1khta_190 Adenylate kinase {Archaeon Methanococcus voltae [T 96.89
d1ofha_309 HslU {Haemophilus influenzae [TaxId: 727]} 96.89
d2iyva1165 Shikimate kinase (AroK) {Mycobacterium tuberculosi 96.89
d2jdid3276 Central domain of beta subunit of F1 ATP synthase 96.86
d1m7ga_208 Adenosine-5'phosphosulfate kinase (APS kinase) {Fu 96.86
d1viaa_161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 96.85
d1e6ca_170 Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax 96.81
d1xjca_165 Molybdopterin-guanine dinucleotide biosynthesis pr 96.78
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 96.72
d1szpa2251 DNA repair protein Rad51, catalytic domain {Baker' 96.7
d1teva_194 UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] 96.7
d1nksa_194 Adenylate kinase {Archaeon Sulfolobus acidocaldari 96.69
d1w44a_321 NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} 96.68
d1ckea_225 CMP kinase {Escherichia coli [TaxId: 562]} 96.67
d1uj2a_213 Uridine-cytidine kinase 2 {Human (Homo sapiens) [T 96.58
d1zaka1189 Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} 96.49
d1vpla_238 Putative ABC transporter TM0544 {Thermotoga mariti 96.44
d1ihua2279 Arsenite-translocating ATPase ArsA {Escherichia co 96.43
d3adka_194 Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} 96.42
d1zina1182 Adenylate kinase {Bacillus stearothermophilus [Tax 96.33
d1ihua1296 Arsenite-translocating ATPase ArsA {Escherichia co 96.27
d1g8pa_333 ATPase subunit of magnesium chelatase, BchI {Rhodo 96.25
d1ak2a1190 Adenylate kinase {Cow (Bos taurus), mitochondrial 96.25
d2cdna1181 Adenylate kinase {Mycobacterium tuberculosis [TaxI 96.18
d1q3ta_223 CMP kinase {Streptococcus pneumoniae [TaxId: 1313] 96.18
d1s3ga1182 Adenylate kinase {Bacillus globisporus [TaxId: 145 96.17
d1sq5a_308 Pantothenate kinase PanK {Escherichia coli [TaxId: 96.17
d2qm8a1323 Metallochaperone MeaB {Methylobacterium extorquens 96.17
d1lvga_190 Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 96.17
d1fx0a3276 Central domain of alpha subunit of F1 ATP synthase 96.17
d1xpua3289 Transcription termination factor Rho, ATPase domai 96.17
d2ak3a1189 Adenylate kinase {Cow (Bos taurus), mitochondrial 96.15
d1cp2a_269 Nitrogenase iron protein {Clostridium pasteurianum 96.14
d1gkya_186 Guanylate kinase {Baker's yeast (Saccharomyces cer 96.13
d1uf9a_191 Dephospho-CoA kinase {Thermus thermophilus [TaxId: 96.13
d1znwa1182 Guanylate kinase {Mycobacterium tuberculosis [TaxI 96.12
d1r6bx3315 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 96.01
d2p67a1327 LAO/AO transport system kinase ArgK {Escherichia c 95.99
d1odfa_286 Hypothetical protein Ygr205W {Baker's yeast (Sacch 95.97
d1akya1180 Adenylate kinase {Baker's yeast (Saccharomyces cer 95.97
d1e4va1179 Adenylate kinase {Escherichia coli [TaxId: 562]} 95.93
d1kgda_178 Guanylate kinase-like domain of Cask {Human (Homo 95.87
d2vp4a1197 Deoxyribonucleoside kinase {Fruit fly (Drosophila 95.82
d1v5wa_258 Meiotic recombination protein DMC1/LIM15 homolog { 95.76
d1zj6a1177 ADP-ribosylation factor {Human (Homo sapiens), ARL 95.59
d1yrba1244 ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss 95.57
d1nn5a_209 Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 95.57
d1tf7a1242 Circadian clock protein KaiC {Synechococcus sp. st 95.55
d1pzna2254 DNA repair protein Rad51, catalytic domain {Archae 95.5
d2i1qa2258 DNA repair protein Rad51, catalytic domain {Archae 95.48
d2afhe1289 Nitrogenase iron protein {Azotobacter vinelandii [ 95.44
d1um8a_364 ClpX {Helicobacter pylori [TaxId: 210]} 95.42
d1a7ja_288 Phosphoribulokinase {Rhodobacter sphaeroides [TaxI 95.41
d1svia_195 Probable GTPase EngB {Bacillus subtilis [TaxId: 14 95.39
d1r8sa_160 ADP-ribosylation factor {Human (Homo sapiens), ARF 95.35
d4tmka_210 Thymidylate kinase {Escherichia coli [TaxId: 562]} 95.34
d1s96a_205 Guanylate kinase {Escherichia coli [TaxId: 562]} 95.29
d1g2912240 Maltose transport protein MalK, N-terminal domain 95.28
d1upta_169 ADP-ribosylation factor {Human (Homo sapiens), ARL 95.27
d1l2ta_230 MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 95.27
d1sgwa_200 Putative ABC transporter PF0895 {Pyrococcus furios 95.23
d2jdia3285 Central domain of alpha subunit of F1 ATP synthase 95.21
d3dhwc1240 Methionine import ATP-binding protein MetN {Escher 95.19
d2awna2232 Maltose transport protein MalK, N-terminal domain 95.18
d1ny5a2247 Transcriptional activator sigm54 (NtrC1), C-termin 95.13
d2ocpa1241 Deoxyguanosine kinase {Human (Homo sapiens) [TaxId 95.11
d2a5ja1173 Rab2b {Human (Homo sapiens) [TaxId: 9606]} 95.08
d1gsia_208 Thymidylate kinase {Mycobacterium tuberculosis [Ta 95.07
d2pmka1241 Haemolysin B ATP-binding protein {Escherichia coli 95.05
d1v43a3239 Hypothetical protein PH0022, N-terminal domain {Py 95.04
d3b60a1253 Multidrug resistance ABC transporter MsbA, C-termi 95.03
d1z06a1165 Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} 95.02
d1b0ua_258 ATP-binding subunit of the histidine permease {Sal 95.01
d1z0fa1166 Rab14 {Human (Homo sapiens) [TaxId: 9606]} 95.01
d1z2aa1164 Rab23 {Mouse (Mus musculus) [TaxId: 10090]} 94.99
d1cr2a_277 Gene 4 protein (g4p, DNA primase), helicase domain 94.96
d2onka1240 Molybdate/tungstate import ATP-binding protein Wtp 94.95
d1nija1222 Hypothetical protein YjiA, N-terminal domain {Esch 94.95
d1vhta_208 Dephospho-CoA kinase {Escherichia coli [TaxId: 562 94.93
d1n0wa_242 DNA repair protein Rad51, catalytic domain {Human 94.9
d2erxa1171 di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 94.89
d1jj7a_251 Peptide transporter Tap1, C-terminal ABC domain {H 94.86
d1jjva_205 Dephospho-CoA kinase {Haemophilus influenzae [TaxI 94.84
d1mv5a_242 Multidrug resistance ABC transporter LmrA, C-termi 94.84
d1r0wa_281 Cystic fibrosis transmembrane conductance regulato 94.81
d1kaoa_167 Rap2a {Human (Homo sapiens) [TaxId: 9606]} 94.8
d1yzqa1164 Rab6 {Human (Homo sapiens) [TaxId: 9606]} 94.78
d3raba_169 Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} 94.78
d2ew1a1171 Rab30 {Human (Homo sapiens) [TaxId: 9606]} 94.78
d1ksha_165 ADP-ribosylation factor {Mouse (Mus musculus), ARL 94.75
d2f7sa1186 Rab27b {Human (Homo sapiens) [TaxId: 9606]} 94.73
d1z0ja1167 Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} 94.72
d3d31a2229 Sulfate/molybdate ABC transporter, ATP-binding pro 94.71
d1z08a1167 Rab21 {Human (Homo sapiens) [TaxId: 9606]} 94.71
d2atva1168 Ras-like estrogen-regulated growth inhibitor, RERG 94.71
d1p5zb_241 Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 94.69
d1nrjb_209 Signal recognition particle receptor beta-subunit 94.69
d1r2qa_170 Rab5a {Human (Homo sapiens) [TaxId: 9606]} 94.67
d1wb9a2234 DNA repair protein MutS, the C-terminal domain {Es 94.66
d1mkya1171 Probable GTPase Der, N-terminal and middle domains 94.66
d2gjsa1168 Rad {Human (Homo sapiens) [TaxId: 9606]} 94.65
d1ky3a_175 Rab-related protein ypt7p {Baker's yeast (Saccharo 94.63
d1hyqa_232 Cell division regulator MinD {Archaeon Archaeoglob 94.62
d1g16a_166 Rab-related protein Sec4 {Baker's yeast (Saccharom 94.6
d2fn4a1173 r-Ras {Human (Homo sapiens) [TaxId: 9606]} 94.59
d1wf3a1178 GTPase Era, N-terminal domain {Thermus thermophilu 94.59
d1f6ba_186 SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 94.54
d1egaa1179 GTPase Era, N-terminal domain {Escherichia coli [T 94.54
d2bmea1174 Rab4a {Human (Homo sapiens) [TaxId: 9606]} 94.51
d2erya1171 r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 94.51
d1svma_362 Papillomavirus large T antigen helicase domain {Si 94.51
d1xtqa1167 GTP-binding protein RheB {Human (Homo sapiens) [Ta 94.47
d1c1ya_167 Rap1A {Human (Homo sapiens) [TaxId: 9606]} 94.47
d2qtvb1166 SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 94.44
d1ctqa_166 cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 94.41
d1kmqa_177 RhoA {Human (Homo sapiens) [TaxId: 9606]} 94.4
d1fzqa_176 ADP-ribosylation factor {Mouse (Mus musculus), ARL 94.39
d2f9la1175 Rab11b {Human (Homo sapiens) [TaxId: 9606]} 94.38
d2fh5b1207 Signal recognition particle receptor beta-subunit 94.31
d1ek0a_170 Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T 94.31
d1ji0a_240 Branched chain aminoacid ABC transporter {Thermoto 94.28
d1oxxk2242 Glucose transport protein GlcV, N-terminal domain 94.27
d1mh1a_183 Rac {Human (Homo sapiens) [TaxId: 9606]} 94.24
d2cxxa1184 GTP-binding protein engB {Pyrococcus horikoshii [T 94.17
d2bcgy1194 GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi 94.16
d1svsa1195 Transducin (alpha subunit) {Rat (Rattus norvegicus 94.15
d2atxa1185 RhoQ {Human (Homo sapiens) [TaxId: 9606]} 94.13
d1g6ha_254 MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 94.13
d2g6ba1170 Rab26 {Human (Homo sapiens) [TaxId: 9606]} 94.09
d1e0sa_173 ADP-ribosylation factor {Human (Homo sapiens), ARF 94.08
d1g3qa_237 Cell division regulator MinD {Archaeon Pyrococcus 94.08
d1htwa_158 Hypothetical protein HI0065 {Haemophilus influenza 94.07
d1vg8a_184 Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} 94.04
d1zd9a1164 ADP-ribosylation factor {Human (Homo sapiens), ARL 94.01
d1u8za_168 Ras-related protein RalA {Cotton-top tamarin (Sagu 93.96
d1wmsa_174 Rab9a {Human (Homo sapiens) [TaxId: 9606]} 93.96
d1zcba2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 93.94
d1deka_241 Deoxynucleoside monophosphate kinase {Bacteriophag 93.93
d2g3ya1172 GTP-binding protein GEM {Human (Homo sapiens) [Tax 93.89
d1m7ba_179 RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} 93.87
d1x1ra1169 Ras-related protein M-Ras (XRas) {Mouse (Mus muscu 93.86
d1x3sa1177 Rab18 {Human (Homo sapiens) [TaxId: 9606]} 93.82
d1w36d1359 Exodeoxyribonuclease V alpha chain (RecD) {Escheri 93.8
d2gj8a1161 Probable tRNA modification GTPase TrmE (MnmE), G d 93.74
d1udxa2180 Obg GTP-binding protein middle domain {Thermus the 93.72
d2ngra_191 CDC42 {Human (Homo sapiens) [TaxId: 9606]} 93.69
d2hyda1255 Putative multidrug export ATP-binding/permease pro 93.69
d1l7vc_231 ABC transporter involved in vitamin B12 uptake, Bt 93.69
d1moza_182 ADP-ribosylation factor {Baker's yeast (Saccharomy 93.61
d1i2ma_170 Ran {Human (Homo sapiens) [TaxId: 9606]} 93.6
d2bcjq2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 93.53
d1lnza2185 Obg GTP-binding protein middle domain {Bacillus su 93.53
d1tmka_214 Thymidylate kinase {Baker's yeast (Saccharomyces c 93.45
d2bmja1175 Centaurin gamma 1, G domain {Human (Homo sapiens) 93.42
d1u0la2225 Probable GTPase EngC (YjeQ), C-terminal domain {Th 93.39
d1mkya2186 Probable GTPase Der, N-terminal and middle domains 93.38
d1kkma_176 HPr kinase HprK C-terminal domain {Lactobacillus c 93.35
d1knxa2177 HPr kinase HprK C-terminal domain {Mycoplasma pneu 93.18
d1g41a_ 443 HslU {Haemophilus influenzae [TaxId: 727]} 93.17
d1puia_188 Probable GTPase EngB {Escherichia coli [TaxId: 562 93.15
d2fu5c1173 Rab8a {Mouse (Mus musculus) [TaxId: 10090]} 93.0
d1ewqa2224 DNA repair protein MutS, the C-terminal domain {Th 93.0
d1azta2221 Transducin (alpha subunit) {Cow (Bos taurus) [TaxI 92.92
d1byia_224 Dethiobiotin synthetase {Escherichia coli [TaxId: 92.9
d1h65a_257 Chloroplast protein translocon GTPase Toc34 {Garde 92.88
d1nlfa_274 Hexameric replicative helicase repA {Escherichia c 92.82
d1ko7a2169 HPr kinase HprK C-terminal domain {Staphylococcus 92.8
d1xzpa2160 TrmE GTPase domain {Thermotoga maritima [TaxId: 23 91.5
d2bv3a2276 Elongation factor G (EF-G), N-terminal (G) domain 91.37
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 91.02
g1f2t.1292 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 90.42
d2dy1a2267 Elongation factor G (EF-G), N-terminal (G) domain 90.4
d1p9ra_401 Extracellular secretion NTPase EpsE {Vibrio choler 90.11
d1g7sa4227 Initiation factor IF2/eIF5b, N-terminal (G) domain 90.06
d1tuea_205 Replication protein E1 helicase domain {Human papi 89.51
d1p6xa_333 Thymidine kinase {Equine herpesvirus type 4 [TaxId 89.48
d1wb1a4179 Elongation factor SelB, N-terminal domain {Methano 89.07
d1pjra1318 DEXX box DNA helicase {Bacillus stearothermophilus 88.61
d1f5na2277 Interferon-induced guanylate-binding protein 1 (GB 88.57
d1t9ha2231 Probable GTPase EngC (YjeQ), C-terminal domain {Ba 88.55
d1a1va1136 HCV helicase domain {Human hepatitis C virus (HCV) 87.98
d1uaaa1306 DEXX box DNA helicase {Escherichia coli, RepD [Tax 87.93
g1ii8.1 369 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 87.18
d1osna_331 Thymidine kinase {Varicella-zoster virus [TaxId: 1 87.09
d1jala1278 YchF GTP-binding protein N-terminal domain {Haemop 86.86
d1u0ja_267 Rep 40 protein helicase domain {Adeno-associated v 86.86
d1e2ka_329 Thymidine kinase {Herpes simplex virus type 1, dif 86.23
d1n0ua2341 Elongation factor 2 (eEF-2), N-terminal (G) domain 85.46
d2eyqa3233 Transcription-repair coupling factor, TRCF {Escher 85.4
g1xew.1329 Smc head domain {Pyrococcus furiosus [TaxId: 2261] 85.4
d1qhla_222 Cell division protein MukB {Escherichia coli [TaxI 84.75
d2c78a3204 Elongation factor Tu (EF-Tu), N-terminal (G) domai 84.64
d1puja_273 Probable GTPase YlqF {Bacillus subtilis [TaxId: 14 84.28
d1wxqa1319 GTP-binding protein PH0525 {Pyrococcus horikoshii 84.27
d1ni3a1296 YchF GTP-binding protein N-terminal domain {Fissio 83.65
d1tq4a_ 400 Interferon-inducible GTPase {Mouse (Mus musculus) 83.34
d1gm5a3264 RecG helicase domain {Thermotoga maritima [TaxId: 82.21
d1g8fa3122 ATP sulfurylase C-terminal domain {Baker's yeast ( 81.91
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: CED-4, NB-ARC domain
species: Caenorhabditis elegans [TaxId: 6239]
Probab=100.00  E-value=3.3e-40  Score=296.02  Aligned_cols=227  Identities=15%  Similarity=0.139  Sum_probs=178.1

Q ss_pred             CcccccccchHHHHHHHHHHhc---CCCccEEEEEcCCCCcHHHHHHHHHcCcc-cccCCCccEEEEEeCCCcCHHHHHH
Q 038454          105 PTTTLVGENTKKIVKKVWEDLM---GDKVTKIGVWGMGGFGKTAIMRHINNRPQ-EETNEFSDVIWVTVSQPLDLVKLQA  180 (359)
Q Consensus       105 ~~~~~vGr~~~~~~~~l~~~l~---~~~~~vi~I~G~gGiGKTtLa~~v~~~~~-~~~~~F~~~~wv~~~~~~~~~~~~~  180 (359)
                      +.+.++||+.  ++++|+++|.   +.+.++|+|+||||+||||||+++|++.. ....+|++++||++++.++...+..
T Consensus        18 ~~~~~~gR~~--~~~~i~~~L~~~~~~~~~~v~I~GmgGiGKTtLA~~v~~~~~~~~~~~f~~~~Wv~vs~~~~~~~l~~   95 (277)
T d2a5yb3          18 KQMTCYIREY--HVDRVIKKLDEMCDLDSFFLFLHGRAGSGKSVIASQALSKSDQLIGINYDSIVWLKDSGTAPKSTFDL   95 (277)
T ss_dssp             CCCCSCCCHH--HHHHHHHHHHHHTTSSSEEEEEECSTTSSHHHHHHHHHHHCSSTBTTTBSEEEEEECCCCSTTHHHHH
T ss_pred             CCCceeCcHH--HHHHHHHHHHhccCCCceEEEEECCCCCCHHHHHHHHHHhhhhhhhhcCceEEEEEecCCCCHHHHHH
Confidence            4567899976  8999999884   45678999999999999999999998622 2566799999999999888776666


Q ss_pred             HHHHHh---cCCCC-------CCccHHHHHHHHHHHHhcCCcEEEEEecC----------CCC-eEEEeec------cc-
Q 038454          181 EIAMAL---KLSLT-------EDEDKVSRARRLLGKLKAKKKFVLILDDI----------DNH-TFCWGLR------SM-  232 (359)
Q Consensus       181 ~i~~~l---~~~~~-------~~~~~~~~~~~l~~~l~~~k~~LlVlDdv----------~~g-~ilvTtr------~~-  232 (359)
                      .+...+   +....       ...........+.+.+.+ +++|+||||+          ..| +||+|||      .. 
T Consensus        96 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~L~~-kr~LlVLDDv~~~~~~~~~~~~~srilvTTR~~~v~~~~~  174 (277)
T d2a5yb3          96 FTDILLMLKSEDDLLNFPSVEHVTSVVLKRMICNALIDR-PNTLFVFDDVVQEETIRWAQELRLRCLVTTRDVEISNAAS  174 (277)
T ss_dssp             HHHHHHHHTTTSCCTTCCCCTTCCHHHHHHHHHHHHTTS-TTEEEEEEEECCHHHHHHHHHTTCEEEEEESBGGGGGGCC
T ss_pred             HHHHHHHHhcchhhcCCccchhhhhHHHHHHHHHHHhcc-CCeeEecchhhHHhhhhhhcccCceEEEEeehHHHHHhcC
Confidence            554433   22111       112223333456667777 9999999999          467 9999999      11 


Q ss_pred             -ceeeeecCCCChHHHHHHHHHhhcCCCCCCCCchHHHHHHHHHHcCCchhHHHHHHHhhcCCCChhHHHHHHHHHhhcc
Q 038454          233 -GCEEVRVPPLSKEEALNLFLDKVGRNILHVPTLNEEIINSVVEECAGLQLAIFTVVGCMRGVDEIHEWRNALNELRGLV  311 (359)
Q Consensus       233 -~~~~~~l~~L~~~ea~~lf~~~~~~~~~~~~~~~~~~~~~i~~~c~g~Plai~~~~~~L~~~~~~~~w~~~l~~~~~~~  311 (359)
                       ....|++++|+.+||++||...+|...  ..+..++++++|+++|+|+||||+++|+.|+. ++.+.|.+..+.+... 
T Consensus       175 ~~~~~~~l~~L~~~ea~~Lf~~~~~~~~--~~~~~~~~~~~iv~~c~GlPLAl~~ig~~l~~-k~~~~~~~~~~~L~~~-  250 (277)
T d2a5yb3         175 QTCEFIEVTSLEIDECYDFLEAYGMPMP--VGEKEEDVLNKTIELSSGNPATLMMFFKSCEP-KTFEKMAQLNNKLESR-  250 (277)
T ss_dssp             SCEEEEECCCCCHHHHHHHHHHTSCCCC----CHHHHHHHHHHHHHTTCHHHHHHHHTTCCS-SSHHHHHHHHHHHHHH-
T ss_pred             CCCceEECCCCCHHHHHHHHHHHhCCcc--CchhhHHHHHHHHHHhCCCHHHHHHHHHHhcc-CCHHHHHHHHHHHhcC-
Confidence             124699999999999999999887653  34556888999999999999999999999987 7889999988888642 


Q ss_pred             cccCCChhhHhhHHHHhhhcCCCcchhHHHhhc
Q 038454          312 RSFSGINADVLGRLEFSYLRLKDKKVQHCFLYC  344 (359)
Q Consensus       312 ~~~~~~~~~~~~~l~~sy~~L~~~~~k~cf~~~  344 (359)
                           ...++..++.+||+.| |+++|.||.++
T Consensus       251 -----~~~~v~~il~~sY~~L-~~~lk~c~~~l  277 (277)
T d2a5yb3         251 -----GLVGVECITPYSYKSL-AMALQRCVEVL  277 (277)
T ss_dssp             -----CSSTTCCCSSSSSSSH-HHHHHHHHHTS
T ss_pred             -----cHHHHHHHHHHHHhcc-cHHHHHHHHhC
Confidence                 2366889999999999 99999999874



>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2jdid3 c.37.1.11 (D:82-357) Central domain of beta subunit of F1 ATP synthase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Back     information, alignment and structure
>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ihua2 c.37.1.10 (A:308-586) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1ihua1 c.37.1.10 (A:1-296) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fx0a3 c.37.1.11 (A:97-372) Central domain of alpha subunit of F1 ATP synthase {Spinach (Spinacia oleracea), chloroplast [TaxId: 3562]} Back     information, alignment and structure
>d1xpua3 c.37.1.11 (A:129-417) Transcription termination factor Rho, ATPase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d1cp2a_ c.37.1.10 (A:) Nitrogenase iron protein {Clostridium pasteurianum [TaxId: 1501]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d2afhe1 c.37.1.10 (E:1-289) Nitrogenase iron protein {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Back     information, alignment and structure
>d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2jdia3 c.37.1.11 (A:95-379) Central domain of alpha subunit of F1 ATP synthase {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d2ocpa1 c.37.1.1 (A:37-277) Deoxyguanosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1nija1 c.37.1.10 (A:2-223) Hypothetical protein YjiA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Back     information, alignment and structure
>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Back     information, alignment and structure
>d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wb9a2 c.37.1.12 (A:567-800) DNA repair protein MutS, the C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hyqa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Back     information, alignment and structure
>d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Back     information, alignment and structure
>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1svsa1 c.37.1.8 (A:32-60,A:182-347) Transducin (alpha subunit) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} Back     information, alignment and structure
>d1g3qa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} Back     information, alignment and structure
>d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} Back     information, alignment and structure
>d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1deka_ c.37.1.1 (A:) Deoxynucleoside monophosphate kinase {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} Back     information, alignment and structure
>d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bcjq2 c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1tmka_ c.37.1.1 (A:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1knxa2 c.91.1.2 (A:133-309) HPr kinase HprK C-terminal domain {Mycoplasma pneumoniae [TaxId: 2104]} Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ewqa2 c.37.1.12 (A:542-765) DNA repair protein MutS, the C-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1azta2 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1byia_ c.37.1.10 (A:) Dethiobiotin synthetase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ko7a2 c.91.1.2 (A:130-298) HPr kinase HprK C-terminal domain {Staphylococcus xylosus [TaxId: 1288]} Back     information, alignment and structure
>d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2bv3a2 c.37.1.8 (A:7-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2dy1a2 c.37.1.8 (A:8-274) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus, EF-G-2 [TaxId: 274]} Back     information, alignment and structure
>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1g7sa4 c.37.1.8 (A:1-227) Initiation factor IF2/eIF5b, N-terminal (G) domain {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1tuea_ c.37.1.20 (A:) Replication protein E1 helicase domain {Human papillomavirus type 18 [TaxId: 333761]} Back     information, alignment and structure
>d1p6xa_ c.37.1.1 (A:) Thymidine kinase {Equine herpesvirus type 4 [TaxId: 10331]} Back     information, alignment and structure
>d1wb1a4 c.37.1.8 (A:1-179) Elongation factor SelB, N-terminal domain {Methanococcus maripaludis [TaxId: 39152]} Back     information, alignment and structure
>d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} Back     information, alignment and structure
>d1f5na2 c.37.1.8 (A:7-283) Interferon-induced guanylate-binding protein 1 (GBP1), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} Back     information, alignment and structure
>d1osna_ c.37.1.1 (A:) Thymidine kinase {Varicella-zoster virus [TaxId: 10335]} Back     information, alignment and structure
>d1jala1 c.37.1.8 (A:1-278) YchF GTP-binding protein N-terminal domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1u0ja_ c.37.1.20 (A:) Rep 40 protein helicase domain {Adeno-associated virus 2, AAV2 [TaxId: 10804]} Back     information, alignment and structure
>d1e2ka_ c.37.1.1 (A:) Thymidine kinase {Herpes simplex virus type 1, different strains [TaxId: 10298]} Back     information, alignment and structure
>d1n0ua2 c.37.1.8 (A:3-343) Elongation factor 2 (eEF-2), N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qhla_ c.37.1.12 (A:) Cell division protein MukB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2c78a3 c.37.1.8 (A:9-212) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1puja_ c.37.1.8 (A:) Probable GTPase YlqF {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1wxqa1 c.37.1.8 (A:1-319) GTP-binding protein PH0525 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1ni3a1 c.37.1.8 (A:11-306) YchF GTP-binding protein N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1tq4a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1g8fa3 c.37.1.15 (A:390-511) ATP sulfurylase C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure