Citrus Sinensis ID: 038591


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--
KKTAGAVINMRKLDEGTEPDTPRQIQRARLGKKMSQPDLANQINQRPQVVSEYENGKAVPNQTVLAKMEKAIGVKLRVKIRK
ccccccccccccccccccccHHHHHHHHHHHccccHHHHHHHHcccHHHHHHHHcccccccHHHHHHHHHHHcccccccccc
ccccccccccccccHcccHHHHHHHHHHHHHccccHHHHHHHHccccHHHHHHccccccccHHHHHHHHHHHcccEcccccc
KKTAGAVINmrkldegtepdtprQIQRARlgkkmsqpdlanqinqrpqvvseyengkavpnqTVLAKMEKAIGVKLRVKIRK
kktagavinmrkldegtepdtprQIQRArlgkkmsqpdlaNQINQRPQVVSEyengkavpnqtvlakmekaigvklrvkirk
KKTAGAVINMRKLDEGTEPDTPRQIQRARLGKKMSQPDLANQINQRPQVVSEYENGKAVPNQTVLAKMEKAIGVKLRVKIRK
**********************************************************************AIGV********
****************TEPDTPRQIQRARLGKKMSQPDLANQINQRPQVVSEYENGKAVPNQTVLAKMEKAIGVKLRV****
KKTAGAVINMRKLDEGTEPDTPRQIQRARLGKKMSQPDLANQINQRPQVVSEYENGKAVPNQTVLAKMEKAIGVKLRVKIRK
***********KLDEGTEPDTPRQIQRARLGKKMSQPDLANQINQRPQVVSEYENGKAVPNQTVLAKMEKAIGVKLR*****
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
KKTAGAVINMRKLDEGTEPDTPRQIQRARLGKKMSQPDLANQINQRPQVVSEYENGKAVPNQTVLAKMEKAIGVKLRVKIRK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query82 2.2.26 [Sep-21-2011]
Q9LV58148 Multiprotein-bridging fac yes no 1.0 0.554 0.644 3e-21
O14467151 Multiprotein-bridging fac yes no 0.817 0.443 0.535 3e-14
Q9LXT3142 Multiprotein-bridging fac no no 0.939 0.542 0.447 5e-14
Q9SJI8142 Multiprotein-bridging fac no no 0.939 0.542 0.435 2e-13
Q6FJN0151 Multiprotein-bridging fac yes no 0.841 0.456 0.506 3e-13
P14327104 Vegetative-specific prote yes no 0.743 0.586 0.573 3e-13
Q752P7152 Multiprotein-bridging fac yes no 0.841 0.453 0.493 3e-13
P69736148 Endothelial differentiati yes no 0.865 0.479 0.468 9e-13
Q9JMG1148 Endothelial differentiati yes no 0.865 0.479 0.468 9e-13
O94700148 Multiprotein-bridging fac yes no 0.646 0.358 0.566 3e-12
>sp|Q9LV58|MBF1C_ARATH Multiprotein-bridging factor 1c OS=Arabidopsis thaliana GN=MBF1C PE=1 SV=1 Back     alignment and function desciption
 Score =  100 bits (249), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 58/90 (64%), Positives = 64/90 (71%), Gaps = 8/90 (8%)

Query: 1   KKTAGAVINMRKLDEGTEP--------DTPRQIQRARLGKKMSQPDLANQINQRPQVVSE 52
           K TA  VIN +KL+E TEP        +    IQ+ARL KKMSQ DLA QIN+R QVV E
Sbjct: 59  KSTAVPVINTKKLEEETEPAAMDRVKAEVRLMIQKARLEKKMSQADLAKQINERTQVVQE 118

Query: 53  YENGKAVPNQTVLAKMEKAIGVKLRVKIRK 82
           YENGKAVPNQ VLAKMEK +GVKLR KI K
Sbjct: 119 YENGKAVPNQAVLAKMEKVLGVKLRGKIGK 148




Transcriptional coactivator that stimulates transcriptional activity by bridging regulatory proteins and TBP, thereby recruiting TBP to promoters occupied by DNA-binding regulators. Involved in the tolerance to heat and osmotic stress by partially activating the ethylene-response signal transduction pathway.
Arabidopsis thaliana (taxid: 3702)
>sp|O14467|MBF1_YEAST Multiprotein-bridging factor 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MBF1 PE=1 SV=2 Back     alignment and function description
>sp|Q9LXT3|MBF1B_ARATH Multiprotein-bridging factor 1b OS=Arabidopsis thaliana GN=MBF1B PE=2 SV=1 Back     alignment and function description
>sp|Q9SJI8|MBF1A_ARATH Multiprotein-bridging factor 1a OS=Arabidopsis thaliana GN=MBF1A PE=2 SV=1 Back     alignment and function description
>sp|Q6FJN0|MBF1_CANGA Multiprotein-bridging factor 1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=MBF1 PE=3 SV=1 Back     alignment and function description
>sp|P14327|VSH7_DICDI Vegetative-specific protein H7 OS=Dictyostelium discoideum GN=cinD-1 PE=2 SV=2 Back     alignment and function description
>sp|Q752P7|MBF1_ASHGO Multiprotein-bridging factor 1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=MBF1 PE=3 SV=1 Back     alignment and function description
>sp|P69736|EDF1_RAT Endothelial differentiation-related factor 1 OS=Rattus norvegicus GN=Edf1 PE=1 SV=1 Back     alignment and function description
>sp|Q9JMG1|EDF1_MOUSE Endothelial differentiation-related factor 1 OS=Mus musculus GN=Edf1 PE=1 SV=1 Back     alignment and function description
>sp|O94700|MBF1_SCHPO Multiprotein-bridging factor 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mbf1 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query82
225445278144 PREDICTED: multiprotein-bridging factor 0.987 0.562 0.651 3e-21
147852829144 hypothetical protein VITISV_034625 [Viti 0.987 0.562 0.640 4e-21
19225065145 ethylene-responsive transciptional coact 1.0 0.565 0.622 1e-20
21553721148 ethylene-responsive transcriptional coac 1.0 0.554 0.644 1e-19
297831282148 ATMBF1C/MBF1C [Arabidopsis lyrata subsp. 1.0 0.554 0.644 1e-19
15230125148 multiprotein-bridging factor 1c [Arabido 1.0 0.554 0.644 1e-19
449443143145 PREDICTED: multiprotein-bridging factor 0.939 0.531 0.635 2e-19
255546543146 Multiprotein-bridging factor, putative [ 1.0 0.561 0.6 2e-19
350535769146 ethylene-responsive transcriptional coac 1.0 0.561 0.6 3e-19
357500453146 Ethylene-responsive transciptional coact 1.0 0.561 0.611 4e-18
>gi|225445278|ref|XP_002284605.1| PREDICTED: multiprotein-bridging factor 1c [Vitis vinifera] Back     alignment and taxonomy information
 Score =  105 bits (262), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 58/89 (65%), Positives = 65/89 (73%), Gaps = 8/89 (8%)

Query: 2   KTAGAVINMRKLDEGTEP--------DTPRQIQRARLGKKMSQPDLANQINQRPQVVSEY 53
           K A  ++N RKLDEGTEP        D  + IQ+ARL KKMSQ +LA  IN+RPQVV EY
Sbjct: 56  KKAAPIMNTRKLDEGTEPAALDRVSVDVRQLIQKARLEKKMSQAELAKLINERPQVVQEY 115

Query: 54  ENGKAVPNQTVLAKMEKAIGVKLRVKIRK 82
           ENGKAVPNQ VLAKMEK +GVKLR KI K
Sbjct: 116 ENGKAVPNQAVLAKMEKVLGVKLRGKISK 144




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|147852829|emb|CAN79519.1| hypothetical protein VITISV_034625 [Vitis vinifera] Back     alignment and taxonomy information
>gi|19225065|gb|AAL32037.2|AF439278_1 ethylene-responsive transciptional coactivator-like protein [Retama raetam] Back     alignment and taxonomy information
>gi|21553721|gb|AAM62814.1| ethylene-responsive transcriptional coactivator, putative [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297831282|ref|XP_002883523.1| ATMBF1C/MBF1C [Arabidopsis lyrata subsp. lyrata] gi|297329363|gb|EFH59782.1| ATMBF1C/MBF1C [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|15230125|ref|NP_189093.1| multiprotein-bridging factor 1c [Arabidopsis thaliana] gi|75274343|sp|Q9LV58.1|MBF1C_ARATH RecName: Full=Multiprotein-bridging factor 1c gi|9294040|dbj|BAB01997.1| ethylene-responsive transcriptional coactivator-like protein [Arabidopsis thaliana] gi|28466837|gb|AAO44027.1| At3g24500 [Arabidopsis thaliana] gi|110735899|dbj|BAE99925.1| putative ethylene-responsive transcriptional coactivator [Arabidopsis thaliana] gi|332643384|gb|AEE76905.1| multiprotein-bridging factor 1c [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|449443143|ref|XP_004139340.1| PREDICTED: multiprotein-bridging factor 1c-like [Cucumis sativus] gi|449521076|ref|XP_004167557.1| PREDICTED: multiprotein-bridging factor 1c-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|255546543|ref|XP_002514331.1| Multiprotein-bridging factor, putative [Ricinus communis] gi|223546787|gb|EEF48285.1| Multiprotein-bridging factor, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|350535769|ref|NP_001234468.1| ethylene-responsive transcriptional coactivator [Solanum lycopersicum] gi|5669634|gb|AAD46402.1|AF096246_1 ethylene-responsive transcriptional coactivator [Solanum lycopersicum] gi|161898092|gb|ABX80140.1| multiprotein bridging factor ER24 [Solanum lycopersicum] Back     alignment and taxonomy information
>gi|357500453|ref|XP_003620515.1| Ethylene-responsive transciptional coactivator-like protein [Medicago truncatula] gi|355495530|gb|AES76733.1| Ethylene-responsive transciptional coactivator-like protein [Medicago truncatula] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query82
TAIR|locus:2091747148 MBF1C "multiprotein bridging f 1.0 0.554 0.655 1.9e-21
SGD|S000007253151 MBF1 "Transcriptional coactiva 0.817 0.443 0.535 5.4e-15
TAIR|locus:2098994142 MBF1B "multiprotein bridging f 0.939 0.542 0.458 1.1e-14
TAIR|locus:2041509142 MBF1A "multiprotein bridging f 0.939 0.542 0.447 3e-14
WB|WBGene00003148156 mbf-1 [Caenorhabditis elegans 0.865 0.455 0.518 3e-14
DICTYBASE|DDB_G0273775104 cinD-2 "putative helix-turn-he 0.743 0.586 0.573 4.9e-14
DICTYBASE|DDB_G0273061104 cinD-1 "putative helix-turn-he 0.743 0.586 0.573 4.9e-14
MGI|MGI:1891227148 Edf1 "endothelial differentiat 0.865 0.479 0.468 3.4e-13
RGD|1308073148 Edf1 "endothelial differentiat 0.865 0.479 0.468 3.4e-13
CGD|CAL0003442151 MBF1 [Candida albicans (taxid: 0.841 0.456 0.452 4.4e-13
TAIR|locus:2091747 MBF1C "multiprotein bridging factor 1C" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 251 (93.4 bits), Expect = 1.9e-21, P = 1.9e-21
 Identities = 59/90 (65%), Positives = 65/90 (72%)

Query:     1 KKTAGAVINMRKLDEGTEP---DTPR-----QIQRARLGKKMSQPDLANQINQRPQVVSE 52
             K TA  VIN +KL+E TEP   D  +      IQ+ARL KKMSQ DLA QIN+R QVV E
Sbjct:    59 KSTAVPVINTKKLEEETEPAAMDRVKAEVRLMIQKARLEKKMSQADLAKQINERTQVVQE 118

Query:    53 YENGKAVPNQTVLAKMEKAIGVKLRVKIRK 82
             YENGKAVPNQ VLAKMEK +GVKLR KI K
Sbjct:   119 YENGKAVPNQAVLAKMEKVLGVKLRGKIGK 148




GO:0003677 "DNA binding" evidence=IEA;ISS
GO:0003713 "transcription coactivator activity" evidence=IGI;ISS
GO:0005634 "nucleus" evidence=ISM
GO:0006351 "transcription, DNA-dependent" evidence=ISS
GO:0009723 "response to ethylene stimulus" evidence=ISS
GO:0043565 "sequence-specific DNA binding" evidence=IEA
GO:0009737 "response to abscisic acid stimulus" evidence=IEP
GO:0045893 "positive regulation of transcription, DNA-dependent" evidence=TAS
GO:0009408 "response to heat" evidence=IEP;RCA
GO:0009414 "response to water deprivation" evidence=IEP
GO:0005730 "nucleolus" evidence=IDA
GO:0006457 "protein folding" evidence=RCA
GO:0009644 "response to high light intensity" evidence=RCA
GO:0034976 "response to endoplasmic reticulum stress" evidence=RCA
GO:0042542 "response to hydrogen peroxide" evidence=RCA
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=TAS
GO:0009873 "ethylene mediated signaling pathway" evidence=TAS
SGD|S000007253 MBF1 "Transcriptional coactivator" [Saccharomyces cerevisiae (taxid:4932)] Back     alignment and assigned GO terms
TAIR|locus:2098994 MBF1B "multiprotein bridging factor 1B" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2041509 MBF1A "multiprotein bridging factor 1A" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
WB|WBGene00003148 mbf-1 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0273775 cinD-2 "putative helix-turn-helix transcription factor" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0273061 cinD-1 "putative helix-turn-helix transcription factor" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
MGI|MGI:1891227 Edf1 "endothelial differentiation-related factor 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1308073 Edf1 "endothelial differentiation-related factor 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
CGD|CAL0003442 MBF1 [Candida albicans (taxid:5476)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
4th Layer2.7.1.22LOW CONFIDENCE prediction!
4th Layer2.7.7.1LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query82
COG1813165 COG1813, COG1813, Predicted transcription factor, 5e-10
smart0053056 smart00530, HTH_XRE, Helix-turn-helix XRE-family l 2e-09
cd0009358 cd00093, HTH_XRE, Helix-turn-helix XRE-family like 4e-09
pfam0138155 pfam01381, HTH_3, Helix-turn-helix 8e-09
PHA0197667 PHA01976, PHA01976, helix-turn-helix protein 2e-05
PRK06424144 PRK06424, PRK06424, transcription factor; Provisio 1e-04
pfam1284464 pfam12844, HTH_19, Helix-turn-helix domain 2e-04
TIGR00270154 TIGR00270, TIGR00270, TIGR00270 family protein 0.001
COG1396120 COG1396, HipB, Predicted transcriptional regulator 0.004
>gnl|CDD|224726 COG1813, COG1813, Predicted transcription factor, homolog of eukaryotic MBF1 [Transcription] Back     alignment and domain information
 Score = 52.1 bits (125), Expect = 5e-10
 Identities = 23/63 (36%), Positives = 37/63 (58%)

Query: 19  PDTPRQIQRARLGKKMSQPDLANQINQRPQVVSEYENGKAVPNQTVLAKMEKAIGVKLRV 78
            D   +I+ AR  + +SQ DLA ++ ++  V+   E G+A PN  V  K+EK +G+KL  
Sbjct: 78  EDYGERIREAREKRGLSQEDLAAKLKEKVSVIRRIERGEATPNIKVAKKLEKLLGIKLVE 137

Query: 79  KIR 81
           K+ 
Sbjct: 138 KVD 140


Length = 165

>gnl|CDD|197775 smart00530, HTH_XRE, Helix-turn-helix XRE-family like proteins Back     alignment and domain information
>gnl|CDD|238045 cd00093, HTH_XRE, Helix-turn-helix XRE-family like proteins Back     alignment and domain information
>gnl|CDD|201759 pfam01381, HTH_3, Helix-turn-helix Back     alignment and domain information
>gnl|CDD|177330 PHA01976, PHA01976, helix-turn-helix protein Back     alignment and domain information
>gnl|CDD|102369 PRK06424, PRK06424, transcription factor; Provisional Back     alignment and domain information
>gnl|CDD|205103 pfam12844, HTH_19, Helix-turn-helix domain Back     alignment and domain information
>gnl|CDD|129371 TIGR00270, TIGR00270, TIGR00270 family protein Back     alignment and domain information
>gnl|CDD|224314 COG1396, HipB, Predicted transcriptional regulators [Transcription] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 82
PHA0197667 helix-turn-helix protein 99.76
PF1284464 HTH_19: Helix-turn-helix domain; PDB: 3LIS_B 3LFP_ 99.75
PF0138155 HTH_3: Helix-turn-helix; InterPro: IPR001387 This 99.73
COG147668 Predicted transcriptional regulators [Transcriptio 99.72
TIGR0307058 couple_hipB transcriptional regulator, y4mF family 99.71
PRK06424144 transcription factor; Provisional 99.68
PRK08359176 transcription factor; Validated 99.67
PF1356064 HTH_31: Helix-turn-helix domain; PDB: 3F51_C 3F52_ 99.65
PRK0972688 antitoxin HipB; Provisional 99.65
TIGR00270154 conserved hypothetical protein TIGR00270. 99.64
PRK09706135 transcriptional repressor DicA; Reviewed 99.64
TIGR0260778 antidote_HigA addiction module antidote protein, H 99.59
PRK13890120 conjugal transfer protein TrbA; Provisional 99.57
PRK09943 185 DNA-binding transcriptional repressor PuuR; Provis 99.57
PRK08154 309 anaerobic benzoate catabolism transcriptional regu 99.56
TIGR0268489 dnstrm_HI1420 probable addiction module antidote p 99.56
PF1344363 HTH_26: Cro/C1-type HTH DNA-binding domain; PDB: 3 99.55
PRK1007296 putative transcriptional regulator; Provisional 99.54
TIGR02612150 mob_myst_A mobile mystery protein A. Members of th 99.49
PRK04140 317 hypothetical protein; Provisional 99.48
smart0053056 HTH_XRE Helix-turn-helix XRE-family like proteins. 99.43
KOG3398135 consensus Transcription factor MBF1 [Transcription 99.41
cd0009358 HTH_XRE Helix-turn-helix XRE-family like proteins. 99.4
TIGR03830127 CxxCG_CxxCG_HTH putative zinc finger/helix-turn-he 99.38
COG1813165 Predicted transcription factor, homolog of eukaryo 99.38
PHA0054282 putative Cro-like protein 99.28
COG2944104 Predicted transcriptional regulator [Transcription 99.26
PRK10856 331 cytoskeletal protein RodZ; Provisional 99.25
PF1374480 HTH_37: Helix-turn-helix domain; PDB: 2A6C_B 2O38_ 99.21
COG3620 187 Predicted transcriptional regulator with C-termina 99.2
COG3093104 VapI Plasmid maintenance system antidote protein [ 99.11
PRK13355 517 bifunctional HTH-domain containing protein/aminotr 99.08
PRK02866147 cyanate hydratase; Validated 99.02
smart0035275 POU Found in Pit-Oct-Unc transcription factors. 98.98
PF0702266 Phage_CI_repr: Bacteriophage CI repressor helix-tu 98.93
TIGR00673150 cynS cyanate hydratase. Alternate names include cy 98.92
COG365573 Predicted transcriptional regulator [Transcription 98.91
COG1709 241 Predicted transcriptional regulator [Transcription 98.89
PF1341362 HTH_25: Helix-turn-helix domain; PDB: 2WUS_R 3FYM_ 98.86
COG1395 313 Predicted transcriptional regulator [Transcription 98.83
COG1396120 HipB Predicted transcriptional regulators [Transcr 98.76
PF08667147 BetR: BetR domain; InterPro: IPR013975 CheY-like p 98.65
PHA01083149 hypothetical protein 98.58
cd0139252 HTH_LacI Helix-turn-helix (HTH) DNA binding domain 98.54
COG5499120 Predicted transcription regulator containing HTH d 98.49
PF0035646 LacI: Bacterial regulatory proteins, lacI family; 98.47
COG1426 284 Predicted transcriptional regulator contains Xre-l 98.45
PF08965118 DUF1870: Domain of unknown function (DUF1870); Int 98.29
COG3636100 Predicted transcriptional regulator [Transcription 98.28
smart0035470 HTH_LACI helix_turn _helix lactose operon represso 98.24
TIGR0132194 TrpR trp operon repressor, proteobacterial. This m 98.19
COG4800170 Predicted transcriptional regulator with an HTH do 98.18
COG2522119 Predicted transcriptional regulator [General funct 98.08
PF1369378 HTH_35: Winged helix-turn-helix DNA-binding; PDB: 98.0
COG342382 Nlp Predicted transcriptional regulator [Transcrip 97.98
PRK08099 399 bifunctional DNA-binding transcriptional repressor 97.97
TIGR02147 271 Fsuc_second hypothetical protein, TIGR02147. This 97.87
PF1338450 HTH_23: Homeodomain-like domain; PDB: 2X48_C. 97.74
PRK1034492 DNA-binding transcriptional regulator Nlp; Provisi 97.7
PRK09526 342 lacI lac repressor; Reviewed 97.66
TIGR01481 329 ccpA catabolite control protein A. Catabolite cont 97.65
PRK10014 342 DNA-binding transcriptional repressor MalI; Provis 97.65
PRK09492 315 treR trehalose repressor; Provisional 97.62
PHA0067578 hypothetical protein 97.62
PF0279645 HTH_7: Helix-turn-helix domain of resolvase; Inter 97.62
PRK10703 341 DNA-binding transcriptional repressor PurR; Provis 97.62
PRK11303 328 DNA-binding transcriptional regulator FruR; Provis 97.62
TIGR02405 311 trehalos_R_Ecol trehalose operon repressor, proteo 97.61
PRK10727 343 DNA-binding transcriptional regulator GalR; Provis 97.61
TIGR0284480 spore_III_D sporulation transcriptional regulator 97.61
PF1454960 P22_Cro: DNA-binding transcriptional regulator Cro 97.57
PRK14987 331 gluconate operon transcriptional regulator; Provis 97.57
TIGR0387973 near_KaiC_dom probable regulatory domain. This mod 97.56
TIGR02293133 TAS_TIGR02293 putative toxin-antitoxin system anti 97.56
PF04814180 HNF-1_N: Hepatocyte nuclear factor 1 (HNF-1), N te 97.53
PRK10401 346 DNA-binding transcriptional regulator GalS; Provis 97.51
PF0015775 Pou: Pou domain - N-terminal to homeobox domain; I 97.5
TIGR02417 327 fruct_sucro_rep D-fructose-responsive transcriptio 97.42
PHA0259183 hypothetical protein; Provisional 97.39
PF1393644 HTH_38: Helix-turn-helix domain; PDB: 2W48_A. 97.39
PF1341248 HTH_24: Winged helix-turn-helix DNA-binding; PDB: 97.38
COG1609 333 PurR Transcriptional regulators [Transcription] 97.36
PRK03975141 tfx putative transcriptional regulator; Provisiona 97.36
COG560691 Uncharacterized conserved small protein [Function 97.31
COG419796 Uncharacterized protein conserved in bacteria, pro 97.27
PRK10339 327 DNA-binding transcriptional repressor EbgR; Provis 97.23
PRK10423 327 transcriptional repressor RbsR; Provisional 97.2
cd0476249 HTH_MerR-trunc Helix-Turn-Helix DNA binding domain 97.15
PF0853593 KorB: KorB domain; InterPro: IPR013741 This entry 97.11
PF0605658 Terminase_5: Putative ATPase subunit of terminase 97.07
PF0526991 Phage_CII: Bacteriophage CII protein; InterPro: IP 97.04
PF0295442 HTH_8: Bacterial regulatory protein, Fis family; I 97.01
TIGR00721137 tfx DNA-binding protein, Tfx family. Tfx from Meth 97.0
PF1272851 HTH_17: Helix-turn-helix domain 96.99
TIGR0176449 excise DNA binding domain, excisionase family. An 96.87
PF07037122 DUF1323: Putative transcription regulator (DUF1323 96.85
PF1351852 HTH_28: Helix-turn-helix domain 96.82
PF0032532 Crp: Bacterial regulatory proteins, crp family; In 96.79
cd0476149 HTH_MerR-SF Helix-Turn-Helix DNA binding domain of 96.77
PF1066860 Phage_terminase: Phage terminase small subunit; In 96.76
cd0476467 HTH_MlrA-like_sg1 Helix-Turn-Helix DNA binding dom 96.75
PF0037638 MerR: MerR family regulatory protein; InterPro: IP 96.75
PF0454550 Sigma70_r4: Sigma-70, region 4; InterPro: IPR00763 96.73
TIGR0253188 yecD_yerC TrpR-related protein YerC/YecD. This mod 96.71
PF0827955 HTH_11: HTH domain; InterPro: IPR013196 Winged hel 96.7
PF02001106 DUF134: Protein of unknown function DUF134; InterP 96.63
COG1356143 tfx Transcriptional regulator [DNA replication, re 96.57
cd0110468 HTH_MlrA-CarA Helix-Turn-Helix DNA binding domain 96.52
PRK08558 238 adenine phosphoribosyltransferase; Provisional 96.5
PF0421853 CENP-B_N: CENP-B N-terminal DNA-binding domain; In 96.49
PF0237687 CUT: CUT domain; InterPro: IPR003350 A class, also 96.4
PF0496753 HTH_10: HTH DNA binding domain; InterPro: IPR00705 96.37
PRK0138199 Trp operon repressor; Provisional 96.37
cd0476368 HTH_MlrA-like Helix-Turn-Helix DNA binding domain 96.36
PF1341169 MerR_1: MerR HTH family regulatory protein; PDB: 2 96.31
PF0522545 HTH_psq: helix-turn-helix, Psq domain; InterPro: I 96.31
cd0056942 HTH_Hin_like Helix-turn-helix domain of Hin and re 96.2
PRK15418 318 transcriptional regulator LsrR; Provisional 96.2
PRK13698323 plasmid-partitioning protein; Provisional 96.18
PF1340442 HTH_AsnC-type: AsnC-type helix-turn-helix domain; 96.17
smart0042270 HTH_MERR helix_turn_helix, mercury resistance. 96.16
TIGR02044127 CueR Cu(I)-responsive transcriptional regulator. T 96.16
cd01109113 HTH_YyaN Helix-Turn-Helix DNA binding domain of th 96.15
COG134299 Predicted DNA-binding proteins [General function p 96.13
COG2390 321 DeoR Transcriptional regulator, contains sigma fac 96.09
PF0152776 HTH_Tnp_1: Transposase; InterPro: IPR002514 Transp 96.08
PF0104759 MarR: MarR family; InterPro: IPR000835 The MarR-ty 96.07
cd04781120 HTH_MerR-like_sg6 Helix-Turn-Helix DNA binding dom 96.01
PF04552160 Sigma54_DBD: Sigma-54, DNA binding domain; InterPr 96.0
PRK0974475 DNA-binding transcriptional regulator DicC; Provis 95.98
COG2842 297 Uncharacterized ATPase, putative transposase [Gene 95.95
smart0055068 Zalpha Z-DNA-binding domain in adenosine deaminase 95.9
cd0617155 Sigma70_r4 Sigma70, region (SR) 4 refers to the mo 95.9
PF13022142 HTH_Tnp_1_2: Helix-turn-helix of insertion element 95.89
TIGR00180187 parB_part ParB-like partition proteins. This model 95.88
COG1513151 CynS Cyanate lyase [Inorganic ion transport and me 95.88
smart0042158 HTH_LUXR helix_turn_helix, Lux Regulon. lux regulo 95.84
PF0141877 HTH_6: Helix-turn-helix domain, rpiR family; Inter 95.84
COG1318182 Predicted transcriptional regulators [Transcriptio 95.82
cd0110588 HTH_GlnR-like Helix-Turn-Helix DNA binding domain 95.81
TIGR02054120 MerD mercuric resistence transcriptional repressor 95.8
cd04773108 HTH_TioE_rpt2 Second Helix-Turn-Helix DNA binding 95.79
cd04784127 HTH_CadR-PbrR Helix-Turn-Helix DNA binding domain 95.77
PRK04217110 hypothetical protein; Provisional 95.71
PRK10227135 DNA-binding transcriptional regulator CueR; Provis 95.69
cd01108127 HTH_CueR Helix-Turn-Helix DNA binding domain of Cu 95.69
PF1354576 HTH_Crp_2: Crp-like helix-turn-helix domain; PDB: 95.68
smart0042053 HTH_DEOR helix_turn_helix, Deoxyribose operon repr 95.67
PF13551112 HTH_29: Winged helix-turn helix 95.66
PF0593051 Phage_AlpA: Prophage CP4-57 regulatory protein (Al 95.65
cd04777107 HTH_MerR-like_sg1 Helix-Turn-Helix DNA binding dom 95.64
KOG3802 398 consensus Transcription factor OCT-1, contains POU 95.63
PF0828154 Sigma70_r4_2: Sigma-70, region 4; InterPro: IPR013 95.62
TIGR03764258 ICE_PFGI_1_parB integrating conjugative element, P 95.62
PF0822057 HTH_DeoR: DeoR-like helix-turn-helix domain; Inter 95.61
PF0016542 HTH_AraC: Bacterial regulatory helix-turn-helix pr 95.6
TIGR02047127 CadR-PbrR Cd(II)/Pb(II)-responsive transcriptional 95.6
PRK13749121 transcriptional regulator MerD; Provisional 95.55
PRK09413121 IS2 repressor TnpA; Reviewed 95.54
PRK15002154 redox-sensitivie transcriptional activator SoxR; P 95.51
PF0137187 Trp_repressor: Trp repressor protein; InterPro: IP 95.51
PF1280262 MarR_2: MarR family; PDB: 3ECO_B 2QWW_B 3KP6_B 3KP 95.51
cd0009267 HTH_CRP helix_turn_helix, cAMP Regulatory protein 95.48
cd04789102 HTH_Cfa Helix-Turn-Helix DNA binding domain of the 95.47
PF1142750 HTH_Tnp_Tc3_1: Tc3 transposase; PDB: 1U78_A 1TC3_C 95.47
cd01107108 HTH_BmrR Helix-Turn-Helix DNA binding domain of th 95.47
PRK00118104 putative DNA-binding protein; Validated 95.45
PF1301185 LZ_Tnp_IS481: leucine-zipper of insertion element 95.43
PF1361353 HTH_Tnp_4: Helix-turn-helix of DDE superfamily end 95.43
cd01106103 HTH_TipAL-Mta Helix-Turn-Helix DNA binding domain 95.43
smart0041948 HTH_CRP helix_turn_helix, cAMP Regulatory protein. 95.41
PF0204252 RWP-RK: RWP-RK domain; InterPro: IPR003035 This do 95.41
PRK09514140 zntR zinc-responsive transcriptional regulator; Pr 95.39
TIGR02043131 ZntR Zn(II)-responsive transcriptional regulator. 95.38
cd0476599 HTH_MlrA-like_sg2 Helix-Turn-Helix DNA binding dom 95.37
cd0476896 HTH_BmrR-like Helix-Turn-Helix DNA binding domain 95.36
cd0477299 HTH_TioE_rpt1 First Helix-Turn-Helix DNA binding d 95.34
PRK15043 243 transcriptional regulator MirA; Provisional 95.33
TIGR0161095 phage_O_Nterm phage replication protein O, N-termi 95.33
cd0477496 HTH_YfmP Helix-Turn-Helix DNA binding domain of th 95.3
smart00351125 PAX Paired Box domain. 95.29
PF0933952 HTH_IclR: IclR helix-turn-helix domain; InterPro: 95.26
cd0478896 HTH_NolA-AlbR Helix-Turn-Helix DNA binding domain 95.26
PRK04132 846 replication factor C small subunit; Provisional 95.22
cd04775102 HTH_Cfa-like Helix-Turn-Helix DNA binding domain o 95.21
cd04786131 HTH_MerR-like_sg7 Helix-Turn-Helix DNA binding dom 95.17
PF14590166 DUF4447: Domain of unknown function (DUF4447); PDB 95.14
PRK10840216 transcriptional regulator RcsB; Provisional 95.13
PRK11891 429 aspartate carbamoyltransferase; Provisional 95.12
cd0478297 HTH_BltR Helix-Turn-Helix DNA binding domain of th 95.11
cd00592100 HTH_MerR-like Helix-Turn-Helix DNA binding domain 95.09
COG3415138 Transposase and inactivated derivatives [DNA repli 95.08
COG331170 AlpA Predicted transcriptional regulator [Transcri 95.07
COG1191247 FliA DNA-directed RNA polymerase specialized sigma 95.03
cd0476691 HTH_HspR Helix-Turn-Helix DNA binding domain of th 94.99
COG1522154 Lrp Transcriptional regulators [Transcription] 94.98
PF07638185 Sigma70_ECF: ECF sigma factor 94.97
cd00131128 PAX Paired Box domain 94.94
cd01111107 HTH_MerD Helix-Turn-Helix DNA binding domain of th 94.92
cd0127998 HTH_HspR-like Helix-Turn-Helix DNA binding domain 94.88
PRK10458 467 DNA cytosine methylase; Provisional 94.84
PF1284061 HTH_20: Helix-turn-helix domain; PDB: 1ULY_A 2CWE_ 94.83
COG0789124 SoxR Predicted transcriptional regulators [Transcr 94.8
cd0478095 HTH_MerR-like_sg5 Helix-Turn-Helix DNA binding dom 94.78
PF1330964 HTH_22: HTH domain 94.74
PRK13752144 putative transcriptional regulator MerR; Provision 94.71
cd01282112 HTH_MerR-like_sg3 Helix-Turn-Helix DNA binding dom 94.64
PF0197868 TrmB: Sugar-specific transcriptional regulator Trm 94.63
PF1354252 HTH_Tnp_ISL3: Helix-turn-helix domain of transposa 94.62
cd0617057 LuxR_C_like C-terminal DNA-binding domain of LuxR- 94.62
PF1373055 HTH_36: Helix-turn-helix domain 94.54
cd04769116 HTH_MerR2 Helix-Turn-Helix DNA binding domain of M 94.53
cd04783126 HTH_MerR1 Helix-Turn-Helix DNA binding domain of t 94.52
smart0049753 IENR1 Intron encoded nuclease repeat motif. Repeat 94.52
cd04770123 HTH_HMRTR Helix-Turn-Helix DNA binding domain of H 94.51
cd04767120 HTH_HspR-like_MBC Helix-Turn-Helix DNA binding dom 94.46
PRK13182 175 racA polar chromosome segregation protein; Reviewe 94.46
PRK11169164 leucine-responsive transcriptional regulator; Prov 94.44
TIGR03697193 NtcA_cyano global nitrogen regulator NtcA, cyanoba 94.43
PF0102247 HTH_5: Bacterial regulatory protein, arsR family; 94.37
TIGR01950142 SoxR redox-sensitive transcriptional activator Sox 94.37
smart0034691 HTH_ICLR helix_turn_helix isocitrate lyase regulat 94.32
PF0904859 Cro: Cro; InterPro: IPR000655 Bacteriophage lambda 94.28
cd04787133 HTH_HMRTR_unk Helix-Turn-Helix DNA binding domain 94.26
PRK0043095 fis global DNA-binding transcriptional dual regula 94.23
PF0019658 GerE: Bacterial regulatory proteins, luxR family; 94.22
cd01110139 HTH_SoxR Helix-Turn-Helix DNA binding domain of th 94.22
PF1355659 HTH_30: PucR C-terminal helix-turn-helix domain; P 94.2
PRK0190577 DNA-binding protein Fis; Provisional 94.12
cd04776118 HTH_GnyR Helix-Turn-Helix DNA binding domain of th 94.07
PF0044047 TetR_N: Bacterial regulatory proteins, tetR family 94.02
PRK12469481 RNA polymerase factor sigma-54; Provisional 94.01
TIGR02885231 spore_sigF RNA polymerase sigma-F factor. Members 94.01
TIGR01636134 phage_rinA phage transcriptional activator, RinA f 93.98
cd04779134 HTH_MerR-like_sg4 Helix-Turn-Helix DNA binding dom 93.91
PRK11512144 DNA-binding transcriptional repressor MarR; Provis 93.91
cd04785126 HTH_CadR-PbrR-like Helix-Turn-Helix DNA binding do 93.89
PF0012660 HTH_1: Bacterial regulatory helix-turn-helix prote 93.88
PRK11179153 DNA-binding transcriptional regulator AsnC; Provis 93.86
TIGR0012269 birA_repr_reg BirA biotin operon repressor domain. 93.83
PRK13918202 CRP/FNR family transcriptional regulator; Provisio 93.83
TIGR02395429 rpoN_sigma RNA polymerase sigma-54 factor. A sigma 93.79
smart00344108 HTH_ASNC helix_turn_helix ASNC type. AsnC: an auto 93.75
TIGR02051124 MerR Hg(II)-responsive transcriptional regulator. 93.73
PF1007889 DUF2316: Uncharacterized protein conserved in bact 93.66
PRK13413200 mpi multiple promoter invertase; Provisional 93.61
PRK11753211 DNA-binding transcriptional dual regulator Crp; Pr 93.58
PF0745337 NUMOD1: NUMOD1 domain; InterPro: IPR010896 This he 93.54
PRK05932455 RNA polymerase factor sigma-54; Reviewed 93.52
smart0034560 HTH_GNTR helix_turn_helix gluconate operon transcr 93.49
PRK09954 362 putative kinase; Provisional 93.48
PF0632264 Phage_NinH: Phage NinH protein; InterPro: IPR01045 93.47
COG2512258 Predicted membrane-associated trancriptional regul 93.45
PF04297101 UPF0122: Putative helix-turn-helix protein, YlxM / 93.4
COG3413215 Predicted DNA binding protein [General function pr 93.29
TIGR02392270 rpoH_proteo alternative sigma factor RpoH. A sigma 93.29
PRK05572252 sporulation sigma factor SigF; Validated 93.27
PF0132560 Fe_dep_repress: Iron dependent repressor, N-termin 93.22
PF0828059 HTH_Mga: M protein trans-acting positive regulator 93.19
smart0034284 HTH_ARAC helix_turn_helix, arabinose operon contro 93.17
TIGR03209142 P21_Cbot clostridium toxin-associated regulator Bo 93.14
cd04790 172 HTH_Cfa-like_unk Helix-Turn-Helix DNA binding doma 93.06
PF0470362 FaeA: FaeA-like protein; PDB: 2JT1_A 2HTJ_A. 93.06
COG1974 201 LexA SOS-response transcriptional repressors (RecA 93.06
PRK11608326 pspF phage shock protein operon transcriptional ac 93.05
TIGR02985161 Sig70_bacteroi1 RNA polymerase sigma-70 factor, Ba 93.05
PRK09480 194 slmA division inhibitor protein; Provisional 93.02
PRK11161235 fumarate/nitrate reduction transcriptional regulat 93.0
TIGR02394285 rpoS_proteo RNA polymerase sigma factor RpoS. A si 92.97
TIGR02937158 sigma70-ECF RNA polymerase sigma factor, sigma-70 92.97
PRK13509 251 transcriptional repressor UlaR; Provisional 92.92
TIGR02702 203 SufR_cyano iron-sulfur cluster biosynthesis transc 92.81
PRK06759154 RNA polymerase factor sigma-70; Validated 92.8
PRK08215258 sporulation sigma factor SigG; Reviewed 92.79
PF07471 164 Phage_Nu1: Phage DNA packaging protein Nu1; InterP 92.74
PRK09391230 fixK transcriptional regulator FixK; Provisional 92.71
PRK06596284 RNA polymerase factor sigma-32; Reviewed 92.68
PF01710119 HTH_Tnp_IS630: Transposase; InterPro: IPR002622 Tr 92.68
PRK11924179 RNA polymerase sigma factor; Provisional 92.68
PRK00215 205 LexA repressor; Validated 92.65
PRK10411 240 DNA-binding transcriptional activator FucR; Provis 92.64
PRK15320251 transcriptional activator SprB; Provisional 92.6
TIGR02974329 phageshock_pspF psp operon transcriptional activat 92.47
TIGR02337118 HpaR homoprotocatechuate degradation operon regula 92.46
PRK12427231 flagellar biosynthesis sigma factor; Provisional 92.44
TIGR02999183 Sig-70_X6 RNA polymerase sigma factor, TIGR02999 f 92.36
PRK12519194 RNA polymerase sigma factor; Provisional 92.34
COG2973103 TrpR Trp operon repressor [Transcription] 92.33
TIGR02980227 SigBFG RNA polymerase sigma-70 factor, sigma-B/F/G 92.31
PRK15411207 rcsA colanic acid capsular biosynthesis activation 92.3
PRK07037163 extracytoplasmic-function sigma-70 factor; Validat 92.27
PHA01082133 putative transcription regulator 92.24
PRK11361457 acetoacetate metabolism regulatory protein AtoC; P 92.17
smart0041866 HTH_ARSR helix_turn_helix, Arsenical Resistance Op 92.16
PRK09652182 RNA polymerase sigma factor RpoE; Provisional 92.15
PF06892162 Phage_CP76: Phage regulatory protein CII (CP76); I 92.07
PF0901269 FeoC: FeoC like transcriptional regulator; InterPr 91.97
TIGR01818463 ntrC nitrogen regulation protein NR(I). This model 91.97
TIGR02947193 SigH_actino RNA polymerase sigma-70 factor, TIGR02 91.96
TIGR02850254 spore_sigG RNA polymerase sigma-G factor. Members 91.94
PRK13869 405 plasmid-partitioning protein RepA; Provisional 91.9
PRK11511127 DNA-binding transcriptional activator MarA; Provis 91.87
TIGR02393238 RpoD_Cterm RNA polymerase sigma factor RpoD, C-ter 91.8
TIGR03453 387 partition_RepA plasmid partitioning protein RepA. 91.76
PRK09639166 RNA polymerase sigma factor SigX; Provisional 91.73
PRK09047161 RNA polymerase factor sigma-70; Validated 91.72
PRK15090 257 DNA-binding transcriptional regulator KdgR; Provis 91.71
COG1309 201 AcrR Transcriptional regulator [Transcription] 91.7
PRK15115444 response regulator GlrR; Provisional 91.69
PRK14165 217 winged helix-turn-helix domain-containing protein/ 91.69
COG5484 279 Uncharacterized conserved protein [Function unknow 91.62
smart00347101 HTH_MARR helix_turn_helix multiple antibiotic resi 91.59
PRK08583257 RNA polymerase sigma factor SigB; Validated 91.54
PRK10365441 transcriptional regulatory protein ZraR; Provision 91.54
PF01710119 HTH_Tnp_IS630: Transposase; InterPro: IPR002622 Tr 91.53
TIGR02989159 Sig-70_gvs1 RNA polymerase sigma-70 factor, Rhodop 91.53
PRK08301234 sporulation sigma factor SigE; Reviewed 91.44
PRK10219107 DNA-binding transcriptional regulator SoxS; Provis 91.4
PRK15201198 fimbriae regulatory protein FimW; Provisional 91.36
PRK10046225 dpiA two-component response regulator DpiA; Provis 91.33
TIGR02329526 propionate_PrpR propionate catabolism operon regul 91.33
PRK13919186 putative RNA polymerase sigma E protein; Provision 91.33
PRK09642160 RNA polymerase sigma factor SigW; Reviewed 91.32
PRK07408256 RNA polymerase sigma factor SigF; Reviewed 91.25
TIGR03613 202 RutR pyrimidine utilization regulatory protein R. 91.22
PRK12529178 RNA polymerase sigma factor; Provisional 91.22
PRK06986236 fliA flagellar biosynthesis sigma factor; Validate 91.21
PRK12537182 RNA polymerase sigma factor; Provisional 91.17
COG1508444 RpoN DNA-directed RNA polymerase specialized sigma 91.16
cd0737766 WHTH_GntR Winged helix-turn-helix (WHTH) DNA-bindi 91.12
PF11268170 DUF3071: Protein of unknown function (DUF3071); In 91.1
PF07750162 GcrA: GcrA cell cycle regulator; InterPro: IPR0116 91.05
COG2197211 CitB Response regulator containing a CheY-like rec 91.05
PRK12423 202 LexA repressor; Provisional 90.96
TIGR01884203 cas_HTH CRISPR locus-related DNA-binding protein. 90.96
cd0009078 HTH_ARSR Arsenical Resistance Operon Repressor and 90.95
PRK13832 520 plasmid partitioning protein; Provisional 90.94
PRK12534187 RNA polymerase sigma factor; Provisional 90.93
COG1595182 RpoE DNA-directed RNA polymerase specialized sigma 90.92
TIGR02366 176 DHAK_reg probable dihydroxyacetone kinase regulato 90.92
cd0831697 Death_FAS_TNFRSF6 Death domain of FAS or TNF recep 90.88
PRK12547164 RNA polymerase sigma factor; Provisional 90.85
PRK07122264 RNA polymerase sigma factor SigF; Reviewed 90.83
COG4565224 CitB Response regulator of citrate/malate metaboli 90.83
PRK09649185 RNA polymerase sigma factor SigC; Reviewed 90.82
PRK09645173 RNA polymerase sigma factor SigL; Provisional 90.81
PRK07500289 rpoH2 RNA polymerase factor sigma-32; Reviewed 90.8
TIGR02959170 SigZ RNA polymerase sigma factor, SigZ family. Thi 90.76
PF1346368 HTH_27: Winged helix DNA-binding domain; PDB: 3GFL 90.74
COG3355126 Predicted transcriptional regulator [Transcription 90.71
TIGR01889109 Staph_reg_Sar staphylococcal accessory regulator f 90.7
TIGR02915445 PEP_resp_reg putative PEP-CTERM system response re 90.67
PRK12523172 RNA polymerase sigma factor; Reviewed 90.67
PRK11302 284 DNA-binding transcriptional regulator HexR; Provis 90.65
PRK10923469 glnG nitrogen regulation protein NR(I); Provisiona 90.64
PRK15008 212 HTH-type transcriptional regulator RutR; Provision 90.61
PRK09975 213 DNA-binding transcriptional regulator EnvR; Provis 90.61
COG165479 BirA Biotin operon repressor [Transcription] 90.59
PRK03573144 transcriptional regulator SlyA; Provisional 90.53
PRK12511182 RNA polymerase sigma factor; Provisional 90.52
PRK10402226 DNA-binding transcriptional activator YeiL; Provis 90.5
smart0034284 HTH_ARAC helix_turn_helix, arabinose operon contro 90.47
cd04778 219 HTH_MerR-like_sg2 Helix-Turn-Helix DNA binding dom 90.43
PRK12530189 RNA polymerase sigma factor; Provisional 90.4
PRK13719217 conjugal transfer transcriptional regulator TraJ; 90.4
TIGR0063799 ModE_repress ModE molybdate transport repressor do 90.39
PRK12532195 RNA polymerase sigma factor; Provisional 90.36
PRK05803233 sporulation sigma factor SigK; Reviewed 90.36
COG277165 CsgD DNA-binding HTH domain-containing proteins [T 90.31
PRK10141117 DNA-binding transcriptional repressor ArsR; Provis 90.29
PRK13777185 transcriptional regulator Hpr; Provisional 90.28
TIGR02479224 FliA_WhiG RNA polymerase sigma factor, FliA/WhiG f 90.28
PRK12513194 RNA polymerase sigma factor; Provisional 90.27
PRK10668 215 DNA-binding transcriptional repressor AcrR; Provis 90.27
PRK11050152 manganese transport regulator MntR; Provisional 90.27
PRK12524196 RNA polymerase sigma factor; Provisional 90.24
PRK15424538 propionate catabolism operon regulatory protein Pr 90.23
TIGR02846227 spore_sigmaK RNA polymerase sigma-K factor. The sp 90.2
TIGR02954169 Sig70_famx3 RNA polymerase sigma-70 factor, TIGR02 90.18
PRK11475207 DNA-binding transcriptional activator BglJ; Provis 90.08
PRK12516187 RNA polymerase sigma factor; Provisional 90.08
PRK09647203 RNA polymerase sigma factor SigE; Reviewed 90.08
PF09862113 DUF2089: Protein of unknown function (DUF2089); In 90.07
PRK10430239 DNA-binding transcriptional activator DcuR; Provis 89.96
COG1349 253 GlpR Transcriptional regulators of sugar metabolis 89.95
TIGR03384 189 betaine_BetI transcriptional repressor BetI. BetI 89.93
TIGR02983162 SigE-fam_strep RNA polymerase sigma-70 factor, sig 89.92
KOG1168385 consensus Transcription factor ACJ6/BRN-3, contain 89.91
PF0476054 IF2_N: Translation initiation factor IF-2, N-termi 89.86
TIGR02950154 SigM_subfam RNA polymerase sigma factor, SigM fami 89.85
PRK05911257 RNA polymerase sigma factor sigma-28; Reviewed 89.85
TIGR02941255 Sigma_B RNA polymerase sigma-B factor. This sigma 89.85
PRK09641187 RNA polymerase sigma factor SigW; Provisional 89.82
PF08822165 DUF1804: Protein of unknown function (DUF1804); In 89.82
PRK09508 314 leuO leucine transcriptional activator; Reviewed 89.8
TIGR02952170 Sig70_famx2 RNA polymerase sigma-70 factor, TIGR02 89.72
TIGR02997298 Sig70-cyanoRpoD RNA polymerase sigma factor, cyano 89.7
PRK05602186 RNA polymerase sigma factor; Reviewed 89.69
PRK10434 256 srlR DNA-bindng transcriptional repressor SrlR; Pr 89.67
PRK12514179 RNA polymerase sigma factor; Provisional 89.66
PF0504387 Mga: Mga helix-turn-helix domain; InterPro: IPR007 89.64
PRK06930170 positive control sigma-like factor; Validated 89.61
TIGR02835234 spore_sigmaE RNA polymerase sigma-E factor. Member 89.5
PRK12528161 RNA polymerase sigma factor; Provisional 89.49
PRK09392236 ftrB transcriptional activator FtrB; Provisional 89.46
PRK12536181 RNA polymerase sigma factor; Provisional 89.42
PRK12682 309 transcriptional regulator CysB-like protein; Revie 89.4
PRK12525168 RNA polymerase sigma factor; Provisional 89.4
PRK10906 252 DNA-binding transcriptional repressor GlpR; Provis 89.38
PRK05022509 anaerobic nitric oxide reductase transcription reg 89.37
TIGR02984189 Sig-70_plancto1 RNA polymerase sigma-70 factor, Pl 89.34
PRK09483217 response regulator; Provisional 89.3
PRK12542185 RNA polymerase sigma factor; Provisional 89.3
PRK10681 252 DNA-binding transcriptional repressor DeoR; Provis 89.27
PRK11202 203 DNA-binding transcriptional repressor FabR; Provis 89.26
PRK09640188 RNA polymerase sigma factor SigX; Reviewed 89.18
PRK12527159 RNA polymerase sigma factor; Reviewed 89.12
TIGR02431 248 pcaR_pcaU beta-ketoadipate pathway transcriptional 89.11
COG2963116 Transposase and inactivated derivatives [DNA repli 89.07
PRK11923193 algU RNA polymerase sigma factor AlgU; Provisional 89.05
PF05732165 RepL: Firmicute plasmid replication protein (RepL) 88.99
PRK12526206 RNA polymerase sigma factor; Provisional 88.97
PRK12545201 RNA polymerase sigma factor; Provisional 88.96
PRK10100216 DNA-binding transcriptional regulator CsgD; Provis 88.93
PRK14996 192 TetR family transcriptional regulator; Provisional 88.91
COG2826 318 Tra8 Transposase and inactivated derivatives, IS30 88.9
PRK10188240 DNA-binding transcriptional activator SdiA; Provis 88.89
PRK12518175 RNA polymerase sigma factor; Provisional 88.88
PRK09834 263 DNA-binding transcriptional activator MhpR; Provis 88.86
PHA02535 581 P terminase ATPase subunit; Provisional 88.81
PRK00767 197 transcriptional regulator BetI; Validated 88.79
TIGR02948187 SigW_bacill RNA polymerase sigma-W factor. This si 88.78
PF0697150 Put_DNA-bind_N: Putative DNA-binding protein N-ter 88.75
PRK09648189 RNA polymerase sigma factor SigD; Reviewed 88.74
PRK09802 269 DNA-binding transcriptional regulator AgaR; Provis 88.71
PHA00738108 putative HTH transcription regulator 88.71
PRK12533216 RNA polymerase sigma factor; Provisional 88.7
TIGR03826137 YvyF flagellar operon protein TIGR03826. This gene 88.63
PRK11557 278 putative DNA-binding transcriptional regulator; Pr 88.58
PRK14845 1049 translation initiation factor IF-2; Provisional 88.52
PF0172665 LexA_DNA_bind: LexA DNA binding domain; InterPro: 88.48
PRK06288268 RNA polymerase sigma factor WhiG; Reviewed 88.43
PRK12515189 RNA polymerase sigma factor; Provisional 88.4
PRK09638176 RNA polymerase sigma factor SigY; Reviewed 88.39
cd0880484 Death_ank2 Death domain of Ankyrin-2. Death Domain 88.35
PRK12517188 RNA polymerase sigma factor; Provisional 88.34
PF1211682 SpoIIID: Stage III sporulation protein D; InterPro 88.33
PRK04424 185 fatty acid biosynthesis transcriptional regulator; 88.32
PRK09646194 RNA polymerase sigma factor SigK; Reviewed 88.3
PRK11388638 DNA-binding transcriptional regulator DhaR; Provis 88.3
PRK09637181 RNA polymerase sigma factor SigZ; Provisional 88.29
cd0657190 Bac_DnaA_C C-terminal domain of bacterial DnaA pro 88.29
PRK12546188 RNA polymerase sigma factor; Provisional 88.24
PRK12522173 RNA polymerase sigma factor; Provisional 88.2
PRK12520191 RNA polymerase sigma factor; Provisional 88.16
PRK15482 285 transcriptional regulator MurR; Provisional 88.11
PRK06811189 RNA polymerase factor sigma-70; Validated 88.07
PRK07921324 RNA polymerase sigma factor SigB; Reviewed 87.94
TIGR0156558 homeo_ZF_HD homeobox domain, ZF-HD class. This mod 87.93
PRK09210367 RNA polymerase sigma factor RpoD; Validated 87.93
PRK12540182 RNA polymerase sigma factor; Provisional 87.91
PF0004657 Homeobox: Homeobox domain not present here.; Inter 87.82
PRK12541161 RNA polymerase sigma factor; Provisional 87.81
PRK11337 292 DNA-binding transcriptional repressor RpiR; Provis 87.75
TIGR03454325 partition_RepB plasmid partitioning protein RepB. 87.75
PRK11569 274 transcriptional repressor IclR; Provisional 87.74
PRK08295208 RNA polymerase factor sigma-70; Validated 87.7
PRK05657325 RNA polymerase sigma factor RpoS; Validated 87.67
TIGR02939190 RpoE_Sigma70 RNA polymerase sigma factor RpoE. A s 87.66
COG1737 281 RpiR Transcriptional regulators [Transcription] 87.6
PRK10086 311 DNA-binding transcriptional regulator DsdC; Provis 87.59
PRK10163 271 DNA-binding transcriptional repressor AllR; Provis 87.57
PRK03601 275 transcriptional regulator HdfR; Provisional 87.47
PRK12543179 RNA polymerase sigma factor; Provisional 87.42
COG1321154 TroR Mn-dependent transcriptional regulator [Trans 87.41
PRK09415179 RNA polymerase factor sigma C; Reviewed 87.41
PRK10870176 transcriptional repressor MprA; Provisional 87.41
PRK07405317 RNA polymerase sigma factor SigD; Validated 87.37
PRK07670251 RNA polymerase sigma factor SigD; Validated 87.37
PF1417453 YycC: YycC-like protein 87.35
COG2207127 AraC AraC-type DNA-binding domain-containing prote 87.33
PRK09644165 RNA polymerase sigma factor SigM; Provisional 87.26
PRK12531194 RNA polymerase sigma factor; Provisional 87.21
PRK06704228 RNA polymerase factor sigma-70; Validated 87.2
PRK10820520 DNA-binding transcriptional regulator TyrR; Provis 87.09
PF1074387 Phage_Cox: Regulatory phage protein cox; InterPro: 87.03
PF0208283 Rrf2: Transcriptional regulator; InterPro: IPR0009 87.02
TIGR02943188 Sig70_famx1 RNA polymerase sigma-70 factor, TIGR02 87.01
PRK09651172 RNA polymerase sigma factor FecI; Provisional 87.0
PRK12539184 RNA polymerase sigma factor; Provisional 86.82
PRK12512184 RNA polymerase sigma factor; Provisional 86.79
PRK05901509 RNA polymerase sigma factor; Provisional 86.74
PRK09643192 RNA polymerase sigma factor SigM; Reviewed 86.68
PRK13756 205 tetracycline repressor protein TetR; Provisional 86.57
PRK11922231 RNA polymerase sigma factor; Provisional 86.5
PRK12538233 RNA polymerase sigma factor; Provisional 86.45
PRK11886 319 bifunctional biotin--[acetyl-CoA-carboxylase] synt 86.43
PRK10216 319 DNA-binding transcriptional regulator YidZ; Provis 86.42
PRK12535196 RNA polymerase sigma factor; Provisional 86.41
PRK15369211 two component system sensor kinase SsrB; Provision 86.4
>PHA01976 helix-turn-helix protein Back     alignment and domain information
Probab=99.76  E-value=4.7e-18  Score=90.89  Aligned_cols=58  Identities=28%  Similarity=0.476  Sum_probs=55.8

Q ss_pred             CHHHHHHHHHhCCCCHHHHHHHhCCCHHHHHHHHcCCCCCCHHHHHHHHHHhCCCCcc
Q 038591           21 TPRQIQRARLGKKMSQPDLANQINQRPQVVSEYENGKAVPNQTVLAKMEKAIGVKLRV   78 (82)
Q Consensus        21 ~~~~lk~~r~~~g~s~~elA~~~gis~~~i~~~e~g~~~p~~~~~~~la~~lgv~~~e   78 (82)
                      .+.+|+.+|+..|+||.+||+.+|+++++|++||+|...|+.+.+.+||++|||++++
T Consensus         3 ~~~rl~~~R~~~glt~~~lA~~~gvs~~~v~~~e~g~~~p~~~~l~~ia~~l~v~~~~   60 (67)
T PHA01976          3 FAIQLIKARNARAWSAPELSRRAGVRHSLIYDFEADKRLPNLKTLLRLADALGVTLDW   60 (67)
T ss_pred             HHHHHHHHHHHcCCCHHHHHHHhCCCHHHHHHHHcCCCCCCHHHHHHHHHHHCcCHHH
Confidence            4789999999999999999999999999999999999999999999999999999875



>PF12844 HTH_19: Helix-turn-helix domain; PDB: 3LIS_B 3LFP_A 2XIU_B 2GZU_B 2XJ3_A 1UTX_A 2XI8_B 3F6W_C 3EUS_B Back     alignment and domain information
>PF01381 HTH_3: Helix-turn-helix; InterPro: IPR001387 This is large family of DNA binding helix-turn helix proteins that include a bacterial plasmid copy control protein, bacterial methylases, various bacteriophage transcription control proteins and a vegetative specific protein from Dictyostelium discoideum (Slime mould) Back     alignment and domain information
>COG1476 Predicted transcriptional regulators [Transcription] Back     alignment and domain information
>TIGR03070 couple_hipB transcriptional regulator, y4mF family Back     alignment and domain information
>PRK06424 transcription factor; Provisional Back     alignment and domain information
>PRK08359 transcription factor; Validated Back     alignment and domain information
>PF13560 HTH_31: Helix-turn-helix domain; PDB: 3F51_C 3F52_A 3PXP_A 2OFY_A Back     alignment and domain information
>PRK09726 antitoxin HipB; Provisional Back     alignment and domain information
>TIGR00270 conserved hypothetical protein TIGR00270 Back     alignment and domain information
>PRK09706 transcriptional repressor DicA; Reviewed Back     alignment and domain information
>TIGR02607 antidote_HigA addiction module antidote protein, HigA family Back     alignment and domain information
>PRK13890 conjugal transfer protein TrbA; Provisional Back     alignment and domain information
>PRK09943 DNA-binding transcriptional repressor PuuR; Provisional Back     alignment and domain information
>PRK08154 anaerobic benzoate catabolism transcriptional regulator; Reviewed Back     alignment and domain information
>TIGR02684 dnstrm_HI1420 probable addiction module antidote protein Back     alignment and domain information
>PF13443 HTH_26: Cro/C1-type HTH DNA-binding domain; PDB: 3TYR_A 3TYS_A 3B7H_A Back     alignment and domain information
>PRK10072 putative transcriptional regulator; Provisional Back     alignment and domain information
>TIGR02612 mob_myst_A mobile mystery protein A Back     alignment and domain information
>PRK04140 hypothetical protein; Provisional Back     alignment and domain information
>smart00530 HTH_XRE Helix-turn-helix XRE-family like proteins Back     alignment and domain information
>KOG3398 consensus Transcription factor MBF1 [Transcription] Back     alignment and domain information
>cd00093 HTH_XRE Helix-turn-helix XRE-family like proteins Back     alignment and domain information
>TIGR03830 CxxCG_CxxCG_HTH putative zinc finger/helix-turn-helix protein, YgiT family Back     alignment and domain information
>COG1813 Predicted transcription factor, homolog of eukaryotic MBF1 [Transcription] Back     alignment and domain information
>PHA00542 putative Cro-like protein Back     alignment and domain information
>COG2944 Predicted transcriptional regulator [Transcription] Back     alignment and domain information
>PRK10856 cytoskeletal protein RodZ; Provisional Back     alignment and domain information
>PF13744 HTH_37: Helix-turn-helix domain; PDB: 2A6C_B 2O38_A Back     alignment and domain information
>COG3620 Predicted transcriptional regulator with C-terminal CBS domains [Transcription] Back     alignment and domain information
>COG3093 VapI Plasmid maintenance system antidote protein [General function prediction only] Back     alignment and domain information
>PRK13355 bifunctional HTH-domain containing protein/aminotransferase; Provisional Back     alignment and domain information
>PRK02866 cyanate hydratase; Validated Back     alignment and domain information
>smart00352 POU Found in Pit-Oct-Unc transcription factors Back     alignment and domain information
>PF07022 Phage_CI_repr: Bacteriophage CI repressor helix-turn-helix domain; InterPro: IPR010744 This family consists of several phage CI repressor proteins and related bacterial sequences Back     alignment and domain information
>TIGR00673 cynS cyanate hydratase Back     alignment and domain information
>COG3655 Predicted transcriptional regulator [Transcription] Back     alignment and domain information
>COG1709 Predicted transcriptional regulator [Transcription] Back     alignment and domain information
>PF13413 HTH_25: Helix-turn-helix domain; PDB: 2WUS_R 3FYM_A Back     alignment and domain information
>COG1395 Predicted transcriptional regulator [Transcription] Back     alignment and domain information
>COG1396 HipB Predicted transcriptional regulators [Transcription] Back     alignment and domain information
>PF08667 BetR: BetR domain; InterPro: IPR013975 CheY-like phosphoacceptor (or receiver [REC]) domain is a common module in a variety of response regulators of the bacterial signal transduction systems Back     alignment and domain information
>PHA01083 hypothetical protein Back     alignment and domain information
>cd01392 HTH_LacI Helix-turn-helix (HTH) DNA binding domain of the LacI family of transcriptional regulators Back     alignment and domain information
>COG5499 Predicted transcription regulator containing HTH domain [Transcription] Back     alignment and domain information
>PF00356 LacI: Bacterial regulatory proteins, lacI family; InterPro: IPR000843 Numerous bacterial transcription regulatory proteins bind DNA via a helix-turn-helix (HTH) motif Back     alignment and domain information
>COG1426 Predicted transcriptional regulator contains Xre-like HTH domain [Function unknown] Back     alignment and domain information
>PF08965 DUF1870: Domain of unknown function (DUF1870); InterPro: IPR015060 This family consist of hypothetical bacterial proteins Back     alignment and domain information
>COG3636 Predicted transcriptional regulator [Transcription] Back     alignment and domain information
>smart00354 HTH_LACI helix_turn _helix lactose operon repressor Back     alignment and domain information
>TIGR01321 TrpR trp operon repressor, proteobacterial Back     alignment and domain information
>COG4800 Predicted transcriptional regulator with an HTH domain [Transcription] Back     alignment and domain information
>COG2522 Predicted transcriptional regulator [General function prediction only] Back     alignment and domain information
>PF13693 HTH_35: Winged helix-turn-helix DNA-binding; PDB: 1NEQ_A 1NER_A Back     alignment and domain information
>COG3423 Nlp Predicted transcriptional regulator [Transcription] Back     alignment and domain information
>PRK08099 bifunctional DNA-binding transcriptional repressor/ NMN adenylyltransferase; Provisional Back     alignment and domain information
>TIGR02147 Fsuc_second hypothetical protein, TIGR02147 Back     alignment and domain information
>PF13384 HTH_23: Homeodomain-like domain; PDB: 2X48_C Back     alignment and domain information
>PRK10344 DNA-binding transcriptional regulator Nlp; Provisional Back     alignment and domain information
>PRK09526 lacI lac repressor; Reviewed Back     alignment and domain information
>TIGR01481 ccpA catabolite control protein A Back     alignment and domain information
>PRK10014 DNA-binding transcriptional repressor MalI; Provisional Back     alignment and domain information
>PRK09492 treR trehalose repressor; Provisional Back     alignment and domain information
>PHA00675 hypothetical protein Back     alignment and domain information
>PF02796 HTH_7: Helix-turn-helix domain of resolvase; InterPro: IPR006120 Site-specific recombination plays an important role in DNA rearrangement in prokaryotic organisms Back     alignment and domain information
>PRK10703 DNA-binding transcriptional repressor PurR; Provisional Back     alignment and domain information
>PRK11303 DNA-binding transcriptional regulator FruR; Provisional Back     alignment and domain information
>TIGR02405 trehalos_R_Ecol trehalose operon repressor, proteobacterial Back     alignment and domain information
>PRK10727 DNA-binding transcriptional regulator GalR; Provisional Back     alignment and domain information
>TIGR02844 spore_III_D sporulation transcriptional regulator SpoIIID Back     alignment and domain information
>PF14549 P22_Cro: DNA-binding transcriptional regulator Cro; PDB: 1RZS_A 3BD1_A 3QWS_A 2HIN_B Back     alignment and domain information
>PRK14987 gluconate operon transcriptional regulator; Provisional Back     alignment and domain information
>TIGR03879 near_KaiC_dom probable regulatory domain Back     alignment and domain information
>TIGR02293 TAS_TIGR02293 putative toxin-antitoxin system antitoxin component, TIGR02293 family Back     alignment and domain information
>PF04814 HNF-1_N: Hepatocyte nuclear factor 1 (HNF-1), N terminus; InterPro: IPR006899 This domain consists of the N terminus of homeobox-containing transcription factor HNF-1 Back     alignment and domain information
>PRK10401 DNA-binding transcriptional regulator GalS; Provisional Back     alignment and domain information
>PF00157 Pou: Pou domain - N-terminal to homeobox domain; InterPro: IPR000327 POU proteins are eukaryotic transcription factors containing a bipartite DNA binding domain referred to as the POU domain Back     alignment and domain information
>TIGR02417 fruct_sucro_rep D-fructose-responsive transcription factor Back     alignment and domain information
>PHA02591 hypothetical protein; Provisional Back     alignment and domain information
>PF13936 HTH_38: Helix-turn-helix domain; PDB: 2W48_A Back     alignment and domain information
>PF13412 HTH_24: Winged helix-turn-helix DNA-binding; PDB: 1I1G_B 2IA0_B 3I4P_A 2GQQ_A 2L4A_A 2CFX_B 2DBB_B 2EFO_A 2EFQ_A 2PN6_A Back     alignment and domain information
>COG1609 PurR Transcriptional regulators [Transcription] Back     alignment and domain information
>PRK03975 tfx putative transcriptional regulator; Provisional Back     alignment and domain information
>COG5606 Uncharacterized conserved small protein [Function unknown] Back     alignment and domain information
>COG4197 Uncharacterized protein conserved in bacteria, prophage-related [Function unknown] Back     alignment and domain information
>PRK10339 DNA-binding transcriptional repressor EbgR; Provisional Back     alignment and domain information
>PRK10423 transcriptional repressor RbsR; Provisional Back     alignment and domain information
>cd04762 HTH_MerR-trunc Helix-Turn-Helix DNA binding domain of truncated MerR-like proteins Back     alignment and domain information
>PF08535 KorB: KorB domain; InterPro: IPR013741 This entry contains several KorB transcriptional repressor proteins Back     alignment and domain information
>PF06056 Terminase_5: Putative ATPase subunit of terminase (gpP-like); InterPro: IPR010332 This family of proteins are annotated as ATPase subunits of phage terminase after [] Back     alignment and domain information
>PF05269 Phage_CII: Bacteriophage CII protein; InterPro: IPR007933 The CII protein is a transcription activator, conserved in bacteriophage lambda and related phages, that plays a key role in the decision between lytic or lysogenic phage development Back     alignment and domain information
>PF02954 HTH_8: Bacterial regulatory protein, Fis family; InterPro: IPR002197 The Factor for Inversion Stimulation (FIS) protein is a regulator of bacterial functions, and binds specifically to weakly related DNA sequences [,] Back     alignment and domain information
>TIGR00721 tfx DNA-binding protein, Tfx family Back     alignment and domain information
>PF12728 HTH_17: Helix-turn-helix domain Back     alignment and domain information
>TIGR01764 excise DNA binding domain, excisionase family Back     alignment and domain information
>PF07037 DUF1323: Putative transcription regulator (DUF1323); InterPro: IPR010749 This family consists of several hypothetical Enterobacterial proteins of around 120 residues in length Back     alignment and domain information
>PF13518 HTH_28: Helix-turn-helix domain Back     alignment and domain information
>PF00325 Crp: Bacterial regulatory proteins, crp family; InterPro: IPR001808 Numerous bacterial transcription regulatory proteins bind DNA via a helix-turn-helix (HTH) motif Back     alignment and domain information
>cd04761 HTH_MerR-SF Helix-Turn-Helix DNA binding domain of transcription regulators from the MerR superfamily Back     alignment and domain information
>PF10668 Phage_terminase: Phage terminase small subunit; InterPro: IPR018925 This entry describes the terminase small subunit from Enterococcus phage phiFL1A, related proteins in other bacteriophage, and prophage regions of bacterial genomes Back     alignment and domain information
>cd04764 HTH_MlrA-like_sg1 Helix-Turn-Helix DNA binding domain of putative MlrA-like transcription regulators Back     alignment and domain information
>PF00376 MerR: MerR family regulatory protein; InterPro: IPR000551 The many bacterial transcription regulation proteins which bind DNA through a 'helix-turn-helix' motif can be classified into subfamilies on the basis of sequence similarities Back     alignment and domain information
>PF04545 Sigma70_r4: Sigma-70, region 4; InterPro: IPR007630 The bacterial core RNA polymerase complex, which consists of five subunits, is sufficient for transcription elongation and termination but is unable to initiate transcription Back     alignment and domain information
>TIGR02531 yecD_yerC TrpR-related protein YerC/YecD Back     alignment and domain information
>PF08279 HTH_11: HTH domain; InterPro: IPR013196 Winged helix DNA-binding proteins share a related winged helix-turn-helix DNA-binding motif, where the "wings", or loops, are small beta-sheets Back     alignment and domain information
>PF02001 DUF134: Protein of unknown function DUF134; InterPro: IPR002852 The bacterial and archaeal proteins in this family have no known function Back     alignment and domain information
>COG1356 tfx Transcriptional regulator [DNA replication, recombination and repair] Back     alignment and domain information
>cd01104 HTH_MlrA-CarA Helix-Turn-Helix DNA binding domain of the transcription regulators MlrA and CarA Back     alignment and domain information
>PRK08558 adenine phosphoribosyltransferase; Provisional Back     alignment and domain information
>PF04218 CENP-B_N: CENP-B N-terminal DNA-binding domain; InterPro: IPR006695 Centromere Protein B (CENP-B) is a DNA-binding protein localized to the centromere Back     alignment and domain information
>PF02376 CUT: CUT domain; InterPro: IPR003350 A class, also called ONECUT, of homeodomain proteins Back     alignment and domain information
>PF04967 HTH_10: HTH DNA binding domain; InterPro: IPR007050 Numerous bacterial transcription regulatory proteins bind DNA via a helix-turn-helix (HTH) motif Back     alignment and domain information
>PRK01381 Trp operon repressor; Provisional Back     alignment and domain information
>cd04763 HTH_MlrA-like Helix-Turn-Helix DNA binding domain of MlrA-like transcription regulators Back     alignment and domain information
>PF13411 MerR_1: MerR HTH family regulatory protein; PDB: 2JML_A 3GP4_A 3GPV_B Back     alignment and domain information
>PF05225 HTH_psq: helix-turn-helix, Psq domain; InterPro: IPR007889 This DNA-binding motif is found in four copies in the pipsqueak protein of Drosophila melanogaster [] Back     alignment and domain information
>cd00569 HTH_Hin_like Helix-turn-helix domain of Hin and related proteins, a family of DNA-binding domains unique to bacteria and represented by the Hin protein of Salmonella Back     alignment and domain information
>PRK15418 transcriptional regulator LsrR; Provisional Back     alignment and domain information
>PRK13698 plasmid-partitioning protein; Provisional Back     alignment and domain information
>PF13404 HTH_AsnC-type: AsnC-type helix-turn-helix domain; PDB: 2ZNY_E 2ZNZ_G 1RI7_A 2CYY_A 2E1C_A 2VC1_B 2QZ8_A 2W29_C 2IVM_B 2VBX_B Back     alignment and domain information
>smart00422 HTH_MERR helix_turn_helix, mercury resistance Back     alignment and domain information
>TIGR02044 CueR Cu(I)-responsive transcriptional regulator Back     alignment and domain information
>cd01109 HTH_YyaN Helix-Turn-Helix DNA binding domain of the MerR-like transcription regulators YyaN and YraB Back     alignment and domain information
>COG1342 Predicted DNA-binding proteins [General function prediction only] Back     alignment and domain information
>COG2390 DeoR Transcriptional regulator, contains sigma factor-related N-terminal domain [Transcription] Back     alignment and domain information
>PF01527 HTH_Tnp_1: Transposase; InterPro: IPR002514 Transposase proteins are necessary for efficient DNA transposition Back     alignment and domain information
>PF01047 MarR: MarR family; InterPro: IPR000835 The MarR-type HTH domain is a DNA-binding, winged helix-turn-helix (wHTH) domain of about 135 amino acids present in transcription regulators of the MarR/SlyA family, involved in the development of antibiotic resistance Back     alignment and domain information
>cd04781 HTH_MerR-like_sg6 Helix-Turn-Helix DNA binding domain of putative transcription regulators from the MerR superfamily Back     alignment and domain information
>PF04552 Sigma54_DBD: Sigma-54, DNA binding domain; InterPro: IPR007634 This DNA-binding domain is based on peptide fragmentation data Back     alignment and domain information
>PRK09744 DNA-binding transcriptional regulator DicC; Provisional Back     alignment and domain information
>COG2842 Uncharacterized ATPase, putative transposase [General function prediction only] Back     alignment and domain information
>smart00550 Zalpha Z-DNA-binding domain in adenosine deaminases Back     alignment and domain information
>cd06171 Sigma70_r4 Sigma70, region (SR) 4 refers to the most C-terminal of four conserved domains found in Escherichia coli (Ec) sigma70, the main housekeeping sigma, and related sigma-factors (SFs) Back     alignment and domain information
>PF13022 HTH_Tnp_1_2: Helix-turn-helix of insertion element transposase; PDB: 2AO9_I Back     alignment and domain information
>TIGR00180 parB_part ParB-like partition proteins Back     alignment and domain information
>COG1513 CynS Cyanate lyase [Inorganic ion transport and metabolism] Back     alignment and domain information
>smart00421 HTH_LUXR helix_turn_helix, Lux Regulon Back     alignment and domain information
>PF01418 HTH_6: Helix-turn-helix domain, rpiR family; InterPro: IPR000281 This domain contains a helix-turn-helix motif [] Back     alignment and domain information
>COG1318 Predicted transcriptional regulators [Transcription] Back     alignment and domain information
>cd01105 HTH_GlnR-like Helix-Turn-Helix DNA binding domain of GlnR-like transcription regulators Back     alignment and domain information
>TIGR02054 MerD mercuric resistence transcriptional repressor protein MerD Back     alignment and domain information
>cd04773 HTH_TioE_rpt2 Second Helix-Turn-Helix DNA binding domain of the regulatory protein TioE Back     alignment and domain information
>cd04784 HTH_CadR-PbrR Helix-Turn-Helix DNA binding domain of the CadR and PbrR transcription regulators Back     alignment and domain information
>PRK04217 hypothetical protein; Provisional Back     alignment and domain information
>PRK10227 DNA-binding transcriptional regulator CueR; Provisional Back     alignment and domain information
>cd01108 HTH_CueR Helix-Turn-Helix DNA binding domain of CueR-like transcription regulators Back     alignment and domain information
>PF13545 HTH_Crp_2: Crp-like helix-turn-helix domain; PDB: 3LA2_A 3LA3_B 3LA7_A 3B02_A 3E97_A 2H6C_B 1OMI_A 2BGC_H 2BEO_A 2GAU_A Back     alignment and domain information
>smart00420 HTH_DEOR helix_turn_helix, Deoxyribose operon repressor Back     alignment and domain information
>PF13551 HTH_29: Winged helix-turn helix Back     alignment and domain information
>PF05930 Phage_AlpA: Prophage CP4-57 regulatory protein (AlpA); InterPro: IPR010260 This entry is represents phage P4, Orf88 Back     alignment and domain information
>cd04777 HTH_MerR-like_sg1 Helix-Turn-Helix DNA binding domain of putative transcription regulators from the MerR superfamily Back     alignment and domain information
>KOG3802 consensus Transcription factor OCT-1, contains POU and HOX domains [Transcription] Back     alignment and domain information
>PF08281 Sigma70_r4_2: Sigma-70, region 4; InterPro: IPR013249 The bacterial core RNA polymerase complex, which consists of five subunits, is sufficient for transcription elongation and termination but is unable to initiate transcription Back     alignment and domain information
>TIGR03764 ICE_PFGI_1_parB integrating conjugative element, PFGI_1 class, ParB family protein Back     alignment and domain information
>PF08220 HTH_DeoR: DeoR-like helix-turn-helix domain; InterPro: IPR001034 The deoR-type HTH domain is a DNA-binding, helix-turn-helix (HTH) domain of about 50-60 amino acids present in transcription regulators of the deoR family, involved in sugar catabolism Back     alignment and domain information
>PF00165 HTH_AraC: Bacterial regulatory helix-turn-helix proteins, AraC family; PDB: 1WPK_A 1ZGW_A 1U8B_A Back     alignment and domain information
>TIGR02047 CadR-PbrR Cd(II)/Pb(II)-responsive transcriptional regulator Back     alignment and domain information
>PRK13749 transcriptional regulator MerD; Provisional Back     alignment and domain information
>PRK09413 IS2 repressor TnpA; Reviewed Back     alignment and domain information
>PRK15002 redox-sensitivie transcriptional activator SoxR; Provisional Back     alignment and domain information
>PF01371 Trp_repressor: Trp repressor protein; InterPro: IPR000831 The Trp repressor (TrpR) binds to at least five operators in the Escherichia coli genome, repressing gene expression Back     alignment and domain information
>PF12802 MarR_2: MarR family; PDB: 3ECO_B 2QWW_B 3KP6_B 3KP4_B 3KP2_A 3KP5_A 3KP3_B 3KP7_A 3NQO_B 3K0L_B Back     alignment and domain information
>cd00092 HTH_CRP helix_turn_helix, cAMP Regulatory protein C-terminus; DNA binding domain of prokaryotic regulatory proteins belonging to the catabolite activator protein family Back     alignment and domain information
>cd04789 HTH_Cfa Helix-Turn-Helix DNA binding domain of the Cfa transcription regulator Back     alignment and domain information
>PF11427 HTH_Tnp_Tc3_1: Tc3 transposase; PDB: 1U78_A 1TC3_C Back     alignment and domain information
>cd01107 HTH_BmrR Helix-Turn-Helix DNA binding domain of the BmrR transcription regulator Back     alignment and domain information
>PRK00118 putative DNA-binding protein; Validated Back     alignment and domain information
>PF13011 LZ_Tnp_IS481: leucine-zipper of insertion element IS481 Back     alignment and domain information
>PF13613 HTH_Tnp_4: Helix-turn-helix of DDE superfamily endonuclease Back     alignment and domain information
>cd01106 HTH_TipAL-Mta Helix-Turn-Helix DNA binding domain of the transcription regulators TipAL, Mta, and SkgA Back     alignment and domain information
>smart00419 HTH_CRP helix_turn_helix, cAMP Regulatory protein Back     alignment and domain information
>PF02042 RWP-RK: RWP-RK domain; InterPro: IPR003035 This domain is named RWP-RK after a conserved motif at the C terminus of the domain Back     alignment and domain information
>PRK09514 zntR zinc-responsive transcriptional regulator; Provisional Back     alignment and domain information
>TIGR02043 ZntR Zn(II)-responsive transcriptional regulator Back     alignment and domain information
>cd04765 HTH_MlrA-like_sg2 Helix-Turn-Helix DNA binding domain of putative MlrA-like transcription regulators Back     alignment and domain information
>cd04768 HTH_BmrR-like Helix-Turn-Helix DNA binding domain of BmrR-like transcription regulators Back     alignment and domain information
>cd04772 HTH_TioE_rpt1 First Helix-Turn-Helix DNA binding domain of the regulatory protein TioE Back     alignment and domain information
>PRK15043 transcriptional regulator MirA; Provisional Back     alignment and domain information
>TIGR01610 phage_O_Nterm phage replication protein O, N-terminal domain Back     alignment and domain information
>cd04774 HTH_YfmP Helix-Turn-Helix DNA binding domain of the YfmP transcription regulator Back     alignment and domain information
>smart00351 PAX Paired Box domain Back     alignment and domain information
>PF09339 HTH_IclR: IclR helix-turn-helix domain; InterPro: IPR005471 The many bacterial transcription regulation proteins which bind DNA through a 'helix-turn-helix' motif can be classified into subfamilies on the basis of sequence similarities Back     alignment and domain information
>cd04788 HTH_NolA-AlbR Helix-Turn-Helix DNA binding domain of the transcription regulators NolA and AlbR Back     alignment and domain information
>PRK04132 replication factor C small subunit; Provisional Back     alignment and domain information
>cd04775 HTH_Cfa-like Helix-Turn-Helix DNA binding domain of Cfa-like transcription regulators Back     alignment and domain information
>cd04786 HTH_MerR-like_sg7 Helix-Turn-Helix DNA binding domain of putative transcription regulators from the MerR superfamily Back     alignment and domain information
>PF14590 DUF4447: Domain of unknown function (DUF4447); PDB: 2OX6_B Back     alignment and domain information
>PRK10840 transcriptional regulator RcsB; Provisional Back     alignment and domain information
>PRK11891 aspartate carbamoyltransferase; Provisional Back     alignment and domain information
>cd04782 HTH_BltR Helix-Turn-Helix DNA binding domain of the BltR transcription regulator Back     alignment and domain information
>cd00592 HTH_MerR-like Helix-Turn-Helix DNA binding domain of MerR-like transcription regulators Back     alignment and domain information
>COG3415 Transposase and inactivated derivatives [DNA replication, recombination, and repair] Back     alignment and domain information
>COG3311 AlpA Predicted transcriptional regulator [Transcription] Back     alignment and domain information
>COG1191 FliA DNA-directed RNA polymerase specialized sigma subunit [Transcription] Back     alignment and domain information
>cd04766 HTH_HspR Helix-Turn-Helix DNA binding domain of the HspR transcription regulator Back     alignment and domain information
>COG1522 Lrp Transcriptional regulators [Transcription] Back     alignment and domain information
>PF07638 Sigma70_ECF: ECF sigma factor Back     alignment and domain information
>cd00131 PAX Paired Box domain Back     alignment and domain information
>cd01111 HTH_MerD Helix-Turn-Helix DNA binding domain of the MerD transcription regulator Back     alignment and domain information
>cd01279 HTH_HspR-like Helix-Turn-Helix DNA binding domain of HspR-like transcription regulators Back     alignment and domain information
>PRK10458 DNA cytosine methylase; Provisional Back     alignment and domain information
>PF12840 HTH_20: Helix-turn-helix domain; PDB: 1ULY_A 2CWE_A 1Y0U_B 2QUF_B 2QLZ_C 2OQG_B 2ZKZ_C 3PQK_A 3PQJ_D 3F6O_B Back     alignment and domain information
>COG0789 SoxR Predicted transcriptional regulators [Transcription] Back     alignment and domain information
>cd04780 HTH_MerR-like_sg5 Helix-Turn-Helix DNA binding domain of putative transcription regulators from the MerR superfamily Back     alignment and domain information
>PF13309 HTH_22: HTH domain Back     alignment and domain information
>PRK13752 putative transcriptional regulator MerR; Provisional Back     alignment and domain information
>cd01282 HTH_MerR-like_sg3 Helix-Turn-Helix DNA binding domain of putative transcription regulators from the MerR superfamily Back     alignment and domain information
>PF01978 TrmB: Sugar-specific transcriptional regulator TrmB; InterPro: IPR002831 TrmB, is a protein of 38,800 apparent molecular weight, that is involved in the maltose-specific regulation of the trehalose/maltose ABC transport operon in Thermococcus litoralis Back     alignment and domain information
>PF13542 HTH_Tnp_ISL3: Helix-turn-helix domain of transposase family ISL3 Back     alignment and domain information
>cd06170 LuxR_C_like C-terminal DNA-binding domain of LuxR-like proteins Back     alignment and domain information
>PF13730 HTH_36: Helix-turn-helix domain Back     alignment and domain information
>cd04769 HTH_MerR2 Helix-Turn-Helix DNA binding domain of MerR2-like transcription regulators Back     alignment and domain information
>cd04783 HTH_MerR1 Helix-Turn-Helix DNA binding domain of the MerR1 transcription regulator Back     alignment and domain information
>smart00497 IENR1 Intron encoded nuclease repeat motif Back     alignment and domain information
>cd04770 HTH_HMRTR Helix-Turn-Helix DNA binding domain of Heavy Metal Resistance transcription regulators Back     alignment and domain information
>cd04767 HTH_HspR-like_MBC Helix-Turn-Helix DNA binding domain of putative HspR-like transcription regulators Back     alignment and domain information
>PRK13182 racA polar chromosome segregation protein; Reviewed Back     alignment and domain information
>PRK11169 leucine-responsive transcriptional regulator; Provisional Back     alignment and domain information
>TIGR03697 NtcA_cyano global nitrogen regulator NtcA, cyanobacterial Back     alignment and domain information
>PF01022 HTH_5: Bacterial regulatory protein, arsR family; InterPro: IPR001845 Bacterial transcription regulatory proteins that bind DNA via a helix-turn-helix (HTH) motif can be grouped into families on the basis of sequence similarities Back     alignment and domain information
>TIGR01950 SoxR redox-sensitive transcriptional activator SoxR Back     alignment and domain information
>smart00346 HTH_ICLR helix_turn_helix isocitrate lyase regulation Back     alignment and domain information
>PF09048 Cro: Cro; InterPro: IPR000655 Bacteriophage lambda encodes two repressors: the Cro repressor that acts to turn off early gene transcription during the lytic cycle, and the lambda or cI repressor that is required to maintain lysogenic growth Back     alignment and domain information
>cd04787 HTH_HMRTR_unk Helix-Turn-Helix DNA binding domain of putative Heavy Metal Resistance transcription regulators Back     alignment and domain information
>PRK00430 fis global DNA-binding transcriptional dual regulator Fis; Provisional Back     alignment and domain information
>PF00196 GerE: Bacterial regulatory proteins, luxR family; InterPro: IPR000792 This domain is a DNA-binding, helix-turn-helix (HTH) domain of about 65 amino acids, present in transcription regulators of the LuxR/FixJ family of response regulators Back     alignment and domain information
>cd01110 HTH_SoxR Helix-Turn-Helix DNA binding domain of the SoxR transcription regulator Back     alignment and domain information
>PF13556 HTH_30: PucR C-terminal helix-turn-helix domain; PDB: 3ONQ_B Back     alignment and domain information
>PRK01905 DNA-binding protein Fis; Provisional Back     alignment and domain information
>cd04776 HTH_GnyR Helix-Turn-Helix DNA binding domain of the regulatory protein GnyR Back     alignment and domain information
>PF00440 TetR_N: Bacterial regulatory proteins, tetR family; InterPro: IPR001647 This entry represents a DNA-binding domain with a helix-turn-helix (HTH) structure that is found in several bacterial and archaeal transcriptional regulators, such as TetR, the tetracycline resistance repressor Back     alignment and domain information
>PRK12469 RNA polymerase factor sigma-54; Provisional Back     alignment and domain information
>TIGR02885 spore_sigF RNA polymerase sigma-F factor Back     alignment and domain information
>TIGR01636 phage_rinA phage transcriptional activator, RinA family Back     alignment and domain information
>cd04779 HTH_MerR-like_sg4 Helix-Turn-Helix DNA binding domain of putative transcription regulators from the MerR superfamily Back     alignment and domain information
>PRK11512 DNA-binding transcriptional repressor MarR; Provisional Back     alignment and domain information
>cd04785 HTH_CadR-PbrR-like Helix-Turn-Helix DNA binding domain of the CadR- and PbrR-like transcription regulators Back     alignment and domain information
>PF00126 HTH_1: Bacterial regulatory helix-turn-helix protein, lysR family; InterPro: IPR000847 Numerous bacterial transcription regulatory proteins bind DNA via a helix-turn-helix (HTH) motif Back     alignment and domain information
>PRK11179 DNA-binding transcriptional regulator AsnC; Provisional Back     alignment and domain information
>TIGR00122 birA_repr_reg BirA biotin operon repressor domain Back     alignment and domain information
>PRK13918 CRP/FNR family transcriptional regulator; Provisional Back     alignment and domain information
>TIGR02395 rpoN_sigma RNA polymerase sigma-54 factor Back     alignment and domain information
>smart00344 HTH_ASNC helix_turn_helix ASNC type Back     alignment and domain information
>TIGR02051 MerR Hg(II)-responsive transcriptional regulator Back     alignment and domain information
>PF10078 DUF2316: Uncharacterized protein conserved in bacteria (DUF2316); InterPro: IPR018757 Members of this family of hypothetical bacterial proteins have no known function Back     alignment and domain information
>PRK13413 mpi multiple promoter invertase; Provisional Back     alignment and domain information
>PRK11753 DNA-binding transcriptional dual regulator Crp; Provisional Back     alignment and domain information
>PF07453 NUMOD1: NUMOD1 domain; InterPro: IPR010896 This helix-turn-helix-containing DNA-binding domain is found associated in homing nucleases [] Back     alignment and domain information
>PRK05932 RNA polymerase factor sigma-54; Reviewed Back     alignment and domain information
>smart00345 HTH_GNTR helix_turn_helix gluconate operon transcriptional repressor Back     alignment and domain information
>PRK09954 putative kinase; Provisional Back     alignment and domain information
>PF06322 Phage_NinH: Phage NinH protein; InterPro: IPR010454 This entry is represented by Bacteriophage 933W, NinH Back     alignment and domain information
>COG2512 Predicted membrane-associated trancriptional regulator [Transcription] Back     alignment and domain information
>PF04297 UPF0122: Putative helix-turn-helix protein, YlxM / p13 like; InterPro: IPR007394 Members of this family are predicted to contain a helix-turn-helix motif, for example residues 37-55 in Mycoplasma mycoides p13 (O05290 from SWISSPROT) Back     alignment and domain information
>COG3413 Predicted DNA binding protein [General function prediction only] Back     alignment and domain information
>TIGR02392 rpoH_proteo alternative sigma factor RpoH Back     alignment and domain information
>PRK05572 sporulation sigma factor SigF; Validated Back     alignment and domain information
>PF01325 Fe_dep_repress: Iron dependent repressor, N-terminal DNA binding domain; InterPro: IPR022687 The DtxR-type HTH domain is a DNA-binding, winged helix-turn-helix (wHTH) domain of about 65 residues present in metalloregulators of the DtxR/MntR family Back     alignment and domain information
>PF08280 HTH_Mga: M protein trans-acting positive regulator (MGA) HTH domain; InterPro: IPR013199 Mga is a DNA-binding protein that activates the expression of several important virulence genes in group A streptococcus in response to changing environmental conditions [] Back     alignment and domain information
>smart00342 HTH_ARAC helix_turn_helix, arabinose operon control protein Back     alignment and domain information
>TIGR03209 P21_Cbot clostridium toxin-associated regulator BotR Back     alignment and domain information
>cd04790 HTH_Cfa-like_unk Helix-Turn-Helix DNA binding domain of putative Cfa-like transcription regulators Back     alignment and domain information
>PF04703 FaeA: FaeA-like protein; PDB: 2JT1_A 2HTJ_A Back     alignment and domain information
>COG1974 LexA SOS-response transcriptional repressors (RecA-mediated autopeptidases) [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>PRK11608 pspF phage shock protein operon transcriptional activator; Provisional Back     alignment and domain information
>TIGR02985 Sig70_bacteroi1 RNA polymerase sigma-70 factor, Bacteroides expansion family 1 Back     alignment and domain information
>PRK09480 slmA division inhibitor protein; Provisional Back     alignment and domain information
>PRK11161 fumarate/nitrate reduction transcriptional regulator; Provisional Back     alignment and domain information
>TIGR02394 rpoS_proteo RNA polymerase sigma factor RpoS Back     alignment and domain information
>TIGR02937 sigma70-ECF RNA polymerase sigma factor, sigma-70 family Back     alignment and domain information
>PRK13509 transcriptional repressor UlaR; Provisional Back     alignment and domain information
>TIGR02702 SufR_cyano iron-sulfur cluster biosynthesis transcriptional regulator SufR Back     alignment and domain information
>PRK06759 RNA polymerase factor sigma-70; Validated Back     alignment and domain information
>PRK08215 sporulation sigma factor SigG; Reviewed Back     alignment and domain information
>PF07471 Phage_Nu1: Phage DNA packaging protein Nu1; InterPro: IPR010906 This entry is represented by the Bacteriophage lambda, Nu1, terminase small subunit Back     alignment and domain information
>PRK09391 fixK transcriptional regulator FixK; Provisional Back     alignment and domain information
>PRK06596 RNA polymerase factor sigma-32; Reviewed Back     alignment and domain information
>PF01710 HTH_Tnp_IS630: Transposase; InterPro: IPR002622 Transposase proteins are necessary for efficient DNA transposition Back     alignment and domain information
>PRK11924 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK00215 LexA repressor; Validated Back     alignment and domain information
>PRK10411 DNA-binding transcriptional activator FucR; Provisional Back     alignment and domain information
>PRK15320 transcriptional activator SprB; Provisional Back     alignment and domain information
>TIGR02974 phageshock_pspF psp operon transcriptional activator PspF Back     alignment and domain information
>TIGR02337 HpaR homoprotocatechuate degradation operon regulator, HpaR Back     alignment and domain information
>PRK12427 flagellar biosynthesis sigma factor; Provisional Back     alignment and domain information
>TIGR02999 Sig-70_X6 RNA polymerase sigma factor, TIGR02999 family Back     alignment and domain information
>PRK12519 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>COG2973 TrpR Trp operon repressor [Transcription] Back     alignment and domain information
>TIGR02980 SigBFG RNA polymerase sigma-70 factor, sigma-B/F/G subfamily Back     alignment and domain information
>PRK15411 rcsA colanic acid capsular biosynthesis activation protein A; Provisional Back     alignment and domain information
>PRK07037 extracytoplasmic-function sigma-70 factor; Validated Back     alignment and domain information
>PHA01082 putative transcription regulator Back     alignment and domain information
>PRK11361 acetoacetate metabolism regulatory protein AtoC; Provisional Back     alignment and domain information
>smart00418 HTH_ARSR helix_turn_helix, Arsenical Resistance Operon Repressor Back     alignment and domain information
>PRK09652 RNA polymerase sigma factor RpoE; Provisional Back     alignment and domain information
>PF06892 Phage_CP76: Phage regulatory protein CII (CP76); InterPro: IPR009679 This entry is represented by Bacteriophage 186, CII Back     alignment and domain information
>PF09012 FeoC: FeoC like transcriptional regulator; InterPro: IPR015102 This entry contains several transcriptional regulators, including FeoC, which contain a HTH motif Back     alignment and domain information
>TIGR01818 ntrC nitrogen regulation protein NR(I) Back     alignment and domain information
>TIGR02947 SigH_actino RNA polymerase sigma-70 factor, TIGR02947 family Back     alignment and domain information
>TIGR02850 spore_sigG RNA polymerase sigma-G factor Back     alignment and domain information
>PRK13869 plasmid-partitioning protein RepA; Provisional Back     alignment and domain information
>PRK11511 DNA-binding transcriptional activator MarA; Provisional Back     alignment and domain information
>TIGR02393 RpoD_Cterm RNA polymerase sigma factor RpoD, C-terminal domain Back     alignment and domain information
>TIGR03453 partition_RepA plasmid partitioning protein RepA Back     alignment and domain information
>PRK09639 RNA polymerase sigma factor SigX; Provisional Back     alignment and domain information
>PRK09047 RNA polymerase factor sigma-70; Validated Back     alignment and domain information
>PRK15090 DNA-binding transcriptional regulator KdgR; Provisional Back     alignment and domain information
>COG1309 AcrR Transcriptional regulator [Transcription] Back     alignment and domain information
>PRK15115 response regulator GlrR; Provisional Back     alignment and domain information
>PRK14165 winged helix-turn-helix domain-containing protein/riboflavin kinase; Provisional Back     alignment and domain information
>COG5484 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>smart00347 HTH_MARR helix_turn_helix multiple antibiotic resistance protein Back     alignment and domain information
>PRK08583 RNA polymerase sigma factor SigB; Validated Back     alignment and domain information
>PRK10365 transcriptional regulatory protein ZraR; Provisional Back     alignment and domain information
>PF01710 HTH_Tnp_IS630: Transposase; InterPro: IPR002622 Transposase proteins are necessary for efficient DNA transposition Back     alignment and domain information
>TIGR02989 Sig-70_gvs1 RNA polymerase sigma-70 factor, Rhodopirellula/Verrucomicrobium family Back     alignment and domain information
>PRK08301 sporulation sigma factor SigE; Reviewed Back     alignment and domain information
>PRK10219 DNA-binding transcriptional regulator SoxS; Provisional Back     alignment and domain information
>PRK15201 fimbriae regulatory protein FimW; Provisional Back     alignment and domain information
>PRK10046 dpiA two-component response regulator DpiA; Provisional Back     alignment and domain information
>TIGR02329 propionate_PrpR propionate catabolism operon regulatory protein PrpR Back     alignment and domain information
>PRK13919 putative RNA polymerase sigma E protein; Provisional Back     alignment and domain information
>PRK09642 RNA polymerase sigma factor SigW; Reviewed Back     alignment and domain information
>PRK07408 RNA polymerase sigma factor SigF; Reviewed Back     alignment and domain information
>TIGR03613 RutR pyrimidine utilization regulatory protein R Back     alignment and domain information
>PRK12529 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK06986 fliA flagellar biosynthesis sigma factor; Validated Back     alignment and domain information
>PRK12537 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>COG1508 RpoN DNA-directed RNA polymerase specialized sigma subunit, sigma54 homolog [Transcription] Back     alignment and domain information
>cd07377 WHTH_GntR Winged helix-turn-helix (WHTH) DNA-binding domain of the GntR family of transcriptional regulators Back     alignment and domain information
>PF11268 DUF3071: Protein of unknown function (DUF3071); InterPro: IPR021421 Some members in this family of proteins are annotated as DNA-binding proteins however this cannot be confirmed Back     alignment and domain information
>PF07750 GcrA: GcrA cell cycle regulator; InterPro: IPR011681 GcrA, together with CtrA (see IPR001789 from INTERPRO and IPR001867 from INTERPRO), form a master cell cycle regulator Back     alignment and domain information
>COG2197 CitB Response regulator containing a CheY-like receiver domain and an HTH DNA-binding domain [Signal transduction mechanisms / Transcription] Back     alignment and domain information
>PRK12423 LexA repressor; Provisional Back     alignment and domain information
>TIGR01884 cas_HTH CRISPR locus-related DNA-binding protein Back     alignment and domain information
>cd00090 HTH_ARSR Arsenical Resistance Operon Repressor and similar prokaryotic, metal regulated homodimeric repressors Back     alignment and domain information
>PRK13832 plasmid partitioning protein; Provisional Back     alignment and domain information
>PRK12534 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>COG1595 RpoE DNA-directed RNA polymerase specialized sigma subunit, sigma24 homolog [Transcription] Back     alignment and domain information
>TIGR02366 DHAK_reg probable dihydroxyacetone kinase regulator Back     alignment and domain information
>cd08316 Death_FAS_TNFRSF6 Death domain of FAS or TNF receptor superfamily member 6 Back     alignment and domain information
>PRK12547 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK07122 RNA polymerase sigma factor SigF; Reviewed Back     alignment and domain information
>COG4565 CitB Response regulator of citrate/malate metabolism [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>PRK09649 RNA polymerase sigma factor SigC; Reviewed Back     alignment and domain information
>PRK09645 RNA polymerase sigma factor SigL; Provisional Back     alignment and domain information
>PRK07500 rpoH2 RNA polymerase factor sigma-32; Reviewed Back     alignment and domain information
>TIGR02959 SigZ RNA polymerase sigma factor, SigZ family Back     alignment and domain information
>PF13463 HTH_27: Winged helix DNA-binding domain; PDB: 3GFL_A 2YR2_B 3GFM_A 3GFJ_A 3GF2_A 3GEZ_A 2GXG_A 3GFI_A 2EB7_A Back     alignment and domain information
>COG3355 Predicted transcriptional regulator [Transcription] Back     alignment and domain information
>TIGR01889 Staph_reg_Sar staphylococcal accessory regulator family Back     alignment and domain information
>TIGR02915 PEP_resp_reg putative PEP-CTERM system response regulator Back     alignment and domain information
>PRK12523 RNA polymerase sigma factor; Reviewed Back     alignment and domain information
>PRK11302 DNA-binding transcriptional regulator HexR; Provisional Back     alignment and domain information
>PRK10923 glnG nitrogen regulation protein NR(I); Provisional Back     alignment and domain information
>PRK15008 HTH-type transcriptional regulator RutR; Provisional Back     alignment and domain information
>PRK09975 DNA-binding transcriptional regulator EnvR; Provisional Back     alignment and domain information
>COG1654 BirA Biotin operon repressor [Transcription] Back     alignment and domain information
>PRK03573 transcriptional regulator SlyA; Provisional Back     alignment and domain information
>PRK12511 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK10402 DNA-binding transcriptional activator YeiL; Provisional Back     alignment and domain information
>smart00342 HTH_ARAC helix_turn_helix, arabinose operon control protein Back     alignment and domain information
>cd04778 HTH_MerR-like_sg2 Helix-Turn-Helix DNA binding domain of putative transcription regulators from the MerR superfamily Back     alignment and domain information
>PRK12530 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK13719 conjugal transfer transcriptional regulator TraJ; Provisional Back     alignment and domain information
>TIGR00637 ModE_repress ModE molybdate transport repressor domain Back     alignment and domain information
>PRK12532 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK05803 sporulation sigma factor SigK; Reviewed Back     alignment and domain information
>COG2771 CsgD DNA-binding HTH domain-containing proteins [Transcription] Back     alignment and domain information
>PRK10141 DNA-binding transcriptional repressor ArsR; Provisional Back     alignment and domain information
>PRK13777 transcriptional regulator Hpr; Provisional Back     alignment and domain information
>TIGR02479 FliA_WhiG RNA polymerase sigma factor, FliA/WhiG family Back     alignment and domain information
>PRK12513 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK10668 DNA-binding transcriptional repressor AcrR; Provisional Back     alignment and domain information
>PRK11050 manganese transport regulator MntR; Provisional Back     alignment and domain information
>PRK12524 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK15424 propionate catabolism operon regulatory protein PrpR; Provisional Back     alignment and domain information
>TIGR02846 spore_sigmaK RNA polymerase sigma-K factor Back     alignment and domain information
>TIGR02954 Sig70_famx3 RNA polymerase sigma-70 factor, TIGR02954 family Back     alignment and domain information
>PRK11475 DNA-binding transcriptional activator BglJ; Provisional Back     alignment and domain information
>PRK12516 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK09647 RNA polymerase sigma factor SigE; Reviewed Back     alignment and domain information
>PF09862 DUF2089: Protein of unknown function (DUF2089); InterPro: IPR018658 This family consists of various hypothetical prokaryotic proteins Back     alignment and domain information
>PRK10430 DNA-binding transcriptional activator DcuR; Provisional Back     alignment and domain information
>COG1349 GlpR Transcriptional regulators of sugar metabolism [Transcription / Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR03384 betaine_BetI transcriptional repressor BetI Back     alignment and domain information
>TIGR02983 SigE-fam_strep RNA polymerase sigma-70 factor, sigma-E family Back     alignment and domain information
>KOG1168 consensus Transcription factor ACJ6/BRN-3, contains POU and HOX domains [Transcription] Back     alignment and domain information
>PF04760 IF2_N: Translation initiation factor IF-2, N-terminal region; InterPro: IPR006847 This region is found in the N-terminal half of translation initiation factor IF-2 Back     alignment and domain information
>TIGR02950 SigM_subfam RNA polymerase sigma factor, SigM family Back     alignment and domain information
>PRK05911 RNA polymerase sigma factor sigma-28; Reviewed Back     alignment and domain information
>TIGR02941 Sigma_B RNA polymerase sigma-B factor Back     alignment and domain information
>PRK09641 RNA polymerase sigma factor SigW; Provisional Back     alignment and domain information
>PF08822 DUF1804: Protein of unknown function (DUF1804); InterPro: IPR014926 This entry is represented by Bacteriophage D3112, Orf24 Back     alignment and domain information
>PRK09508 leuO leucine transcriptional activator; Reviewed Back     alignment and domain information
>TIGR02952 Sig70_famx2 RNA polymerase sigma-70 factor, TIGR02952 family Back     alignment and domain information
>TIGR02997 Sig70-cyanoRpoD RNA polymerase sigma factor, cyanobacterial RpoD-like family Back     alignment and domain information
>PRK05602 RNA polymerase sigma factor; Reviewed Back     alignment and domain information
>PRK10434 srlR DNA-bindng transcriptional repressor SrlR; Provisional Back     alignment and domain information
>PRK12514 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PF05043 Mga: Mga helix-turn-helix domain; InterPro: IPR007737 Mga is a DNA-binding protein that activates the expression of several important virulence genes in group A streptococcus in response to changing environmental conditions [] Back     alignment and domain information
>PRK06930 positive control sigma-like factor; Validated Back     alignment and domain information
>TIGR02835 spore_sigmaE RNA polymerase sigma-E factor Back     alignment and domain information
>PRK12528 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK09392 ftrB transcriptional activator FtrB; Provisional Back     alignment and domain information
>PRK12536 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK12682 transcriptional regulator CysB-like protein; Reviewed Back     alignment and domain information
>PRK12525 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK10906 DNA-binding transcriptional repressor GlpR; Provisional Back     alignment and domain information
>PRK05022 anaerobic nitric oxide reductase transcription regulator; Provisional Back     alignment and domain information
>TIGR02984 Sig-70_plancto1 RNA polymerase sigma-70 factor, Planctomycetaceae-specific subfamily 1 Back     alignment and domain information
>PRK09483 response regulator; Provisional Back     alignment and domain information
>PRK12542 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK10681 DNA-binding transcriptional repressor DeoR; Provisional Back     alignment and domain information
>PRK11202 DNA-binding transcriptional repressor FabR; Provisional Back     alignment and domain information
>PRK09640 RNA polymerase sigma factor SigX; Reviewed Back     alignment and domain information
>PRK12527 RNA polymerase sigma factor; Reviewed Back     alignment and domain information
>TIGR02431 pcaR_pcaU beta-ketoadipate pathway transcriptional regulators, PcaR/PcaU/PobR family Back     alignment and domain information
>COG2963 Transposase and inactivated derivatives [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK11923 algU RNA polymerase sigma factor AlgU; Provisional Back     alignment and domain information
>PF05732 RepL: Firmicute plasmid replication protein (RepL); InterPro: IPR008813 This entry consists of proteins thought to be involved in plasmid replication Back     alignment and domain information
>PRK12526 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK12545 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK10100 DNA-binding transcriptional regulator CsgD; Provisional Back     alignment and domain information
>PRK14996 TetR family transcriptional regulator; Provisional Back     alignment and domain information
>COG2826 Tra8 Transposase and inactivated derivatives, IS30 family [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK10188 DNA-binding transcriptional activator SdiA; Provisional Back     alignment and domain information
>PRK12518 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK09834 DNA-binding transcriptional activator MhpR; Provisional Back     alignment and domain information
>PHA02535 P terminase ATPase subunit; Provisional Back     alignment and domain information
>PRK00767 transcriptional regulator BetI; Validated Back     alignment and domain information
>TIGR02948 SigW_bacill RNA polymerase sigma-W factor Back     alignment and domain information
>PF06971 Put_DNA-bind_N: Putative DNA-binding protein N-terminus; InterPro: IPR009718 This entry represents the C terminus (approximately 30 residues) of a number of Rex proteins Back     alignment and domain information
>PRK09648 RNA polymerase sigma factor SigD; Reviewed Back     alignment and domain information
>PRK09802 DNA-binding transcriptional regulator AgaR; Provisional Back     alignment and domain information
>PHA00738 putative HTH transcription regulator Back     alignment and domain information
>PRK12533 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>TIGR03826 YvyF flagellar operon protein TIGR03826 Back     alignment and domain information
>PRK11557 putative DNA-binding transcriptional regulator; Provisional Back     alignment and domain information
>PRK14845 translation initiation factor IF-2; Provisional Back     alignment and domain information
>PF01726 LexA_DNA_bind: LexA DNA binding domain; InterPro: IPR006199 This is the DNA binding domain of the LexA SOS regulon repressor which prevents expression of DNA repair proteins in bacteria Back     alignment and domain information
>PRK06288 RNA polymerase sigma factor WhiG; Reviewed Back     alignment and domain information
>PRK12515 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK09638 RNA polymerase sigma factor SigY; Reviewed Back     alignment and domain information
>cd08804 Death_ank2 Death domain of Ankyrin-2 Back     alignment and domain information
>PRK12517 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PF12116 SpoIIID: Stage III sporulation protein D; InterPro: IPR014208 Members of this entry represent the transcriptional regulator SpoIIID, or stage III sporulation protein D Back     alignment and domain information
>PRK04424 fatty acid biosynthesis transcriptional regulator; Provisional Back     alignment and domain information
>PRK09646 RNA polymerase sigma factor SigK; Reviewed Back     alignment and domain information
>PRK11388 DNA-binding transcriptional regulator DhaR; Provisional Back     alignment and domain information
>PRK09637 RNA polymerase sigma factor SigZ; Provisional Back     alignment and domain information
>cd06571 Bac_DnaA_C C-terminal domain of bacterial DnaA proteins Back     alignment and domain information
>PRK12546 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK12522 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK12520 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK15482 transcriptional regulator MurR; Provisional Back     alignment and domain information
>PRK06811 RNA polymerase factor sigma-70; Validated Back     alignment and domain information
>PRK07921 RNA polymerase sigma factor SigB; Reviewed Back     alignment and domain information
>TIGR01565 homeo_ZF_HD homeobox domain, ZF-HD class Back     alignment and domain information
>PRK09210 RNA polymerase sigma factor RpoD; Validated Back     alignment and domain information
>PRK12540 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PF00046 Homeobox: Homeobox domain not present here Back     alignment and domain information
>PRK12541 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK11337 DNA-binding transcriptional repressor RpiR; Provisional Back     alignment and domain information
>TIGR03454 partition_RepB plasmid partitioning protein RepB Back     alignment and domain information
>PRK11569 transcriptional repressor IclR; Provisional Back     alignment and domain information
>PRK08295 RNA polymerase factor sigma-70; Validated Back     alignment and domain information
>PRK05657 RNA polymerase sigma factor RpoS; Validated Back     alignment and domain information
>TIGR02939 RpoE_Sigma70 RNA polymerase sigma factor RpoE Back     alignment and domain information
>COG1737 RpiR Transcriptional regulators [Transcription] Back     alignment and domain information
>PRK10086 DNA-binding transcriptional regulator DsdC; Provisional Back     alignment and domain information
>PRK10163 DNA-binding transcriptional repressor AllR; Provisional Back     alignment and domain information
>PRK03601 transcriptional regulator HdfR; Provisional Back     alignment and domain information
>PRK12543 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>COG1321 TroR Mn-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>PRK09415 RNA polymerase factor sigma C; Reviewed Back     alignment and domain information
>PRK10870 transcriptional repressor MprA; Provisional Back     alignment and domain information
>PRK07405 RNA polymerase sigma factor SigD; Validated Back     alignment and domain information
>PRK07670 RNA polymerase sigma factor SigD; Validated Back     alignment and domain information
>PF14174 YycC: YycC-like protein Back     alignment and domain information
>COG2207 AraC AraC-type DNA-binding domain-containing proteins [Transcription] Back     alignment and domain information
>PRK09644 RNA polymerase sigma factor SigM; Provisional Back     alignment and domain information
>PRK12531 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK06704 RNA polymerase factor sigma-70; Validated Back     alignment and domain information
>PRK10820 DNA-binding transcriptional regulator TyrR; Provisional Back     alignment and domain information
>PF10743 Phage_Cox: Regulatory phage protein cox; InterPro: IPR019679 Phage Cox proteins are expressed by Enterobacteria phages Back     alignment and domain information
>PF02082 Rrf2: Transcriptional regulator; InterPro: IPR000944 The following uncharacterised bacterial proteins have been shown to be evolutionary related, Desulfovibrio vulgaris protein Rrf2; Escherichia coli hypothetical proteins yfhP and yjeB; Bacillus subtilis hypothetical proteins yhdE, yrzC and ywgB; Mycobacterium tuberculosis hypothetical protein Rv1287; and Synechocystis sp Back     alignment and domain information
>TIGR02943 Sig70_famx1 RNA polymerase sigma-70 factor, TIGR02943 family Back     alignment and domain information
>PRK09651 RNA polymerase sigma factor FecI; Provisional Back     alignment and domain information
>PRK12539 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK12512 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK05901 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK09643 RNA polymerase sigma factor SigM; Reviewed Back     alignment and domain information
>PRK13756 tetracycline repressor protein TetR; Provisional Back     alignment and domain information
>PRK11922 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK12538 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK11886 bifunctional biotin--[acetyl-CoA-carboxylase] synthetase/biotin operon repressor; Provisional Back     alignment and domain information
>PRK10216 DNA-binding transcriptional regulator YidZ; Provisional Back     alignment and domain information
>PRK12535 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK15369 two component system sensor kinase SsrB; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query82
1x57_A91 Solution Structures Of The Hth Domain Of Human Edf- 7e-13
2jvl_A107 Nmr Structure Of The C-Terminal Domain Of Mbf1 Of T 6e-06
>pdb|1X57|A Chain A, Solution Structures Of The Hth Domain Of Human Edf-1 Protein Length = 91 Back     alignment and structure

Iteration: 1

Score = 68.9 bits (167), Expect = 7e-13, Method: Compositional matrix adjust. Identities = 30/55 (54%), Positives = 45/55 (81%) Query: 25 IQRARLGKKMSQPDLANQINQRPQVVSEYENGKAVPNQTVLAKMEKAIGVKLRVK 79 IQ+ R K ++Q DLA +IN++PQV+++YE+G+A+PN VL K+E+AIG+KLR K Sbjct: 18 IQQGRQSKGLTQKDLATKINEKPQVIADYESGRAIPNNQVLGKIERAIGLKLRGK 72
>pdb|2JVL|A Chain A, Nmr Structure Of The C-Terminal Domain Of Mbf1 Of Trichoderm Length = 107 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query82
1x57_A91 Endothelial differentiation-related factor 1; HMBF 4e-16
2jvl_A107 TRMBF1; coactivator, helix-turn-helix, Pro binding 2e-15
1adr_A76 P22 C2 repressor; transcription regulation; NMR {E 1e-08
2r1j_L68 Repressor protein C2; protein-DNA complex, helix-t 2e-08
2kpj_A94 SOS-response transcriptional repressor, LEXA; NESG 7e-08
3omt_A73 Uncharacterized protein; structural genomics, PSI- 2e-07
2p5t_A158 Putative transcriptional regulator PEZA; postsegre 3e-07
3bs3_A76 Putative DNA-binding protein; XRE-family, structur 4e-07
2wiu_B88 HTH-type transcriptional regulator HIPB; transfera 7e-07
3op9_A114 PLI0006 protein; structural genomics, PSI-2, prote 8e-07
1r69_A69 Repressor protein CI; gene regulating protein; 2.0 2e-06
3kxa_A141 NGO0477 protein, putative uncharacterized protein; 4e-06
3ivp_A126 Putative transposon-related DNA-binding protein; A 5e-06
2qfc_A 293 PLCR protein; TPR, HTH, transcription regulation; 5e-06
1zug_A71 Phage 434 CRO protein; gene regulating protein, tr 6e-06
3o9x_A133 Uncharacterized HTH-type transcriptional regulato; 3e-05
3mlf_A111 Transcriptional regulator; structural genomics, he 4e-05
3lfp_A98 CSP231I C protein; transcriptional regulator, DNA 4e-05
2bnm_A 198 Epoxidase; oxidoreductase, cupin, HTH, cation-depe 5e-05
3f6w_A83 XRE-family like protein; helix-turn-helix, DNA bin 5e-05
1y7y_A74 C.AHDI; helix-turn-helix, DNA-binding protein, tra 6e-05
3bdn_A 236 Lambda repressor; repressor, allostery; HET: DNA; 7e-05
2ef8_A84 C.ECOT38IS, putative transcription factor; helix-t 8e-05
3f52_A117 CLP gene regulator (CLGR); helix-turn-helix motif, 3e-04
2ppx_A99 AGR_C_3184P, uncharacterized protein ATU1735; HTH- 5e-04
2b5a_A77 C.BCLI; helix-turn-helix motif, gene regulation; 1 7e-04
2ewt_A71 BLDD, putative DNA-binding protein; the DNA-bindin 7e-04
3s8q_A82 R-M controller protein; protein-DNA complex, helix 7e-04
3g5g_A99 Regulatory protein; transcriptional regulator, hel 8e-04
>1x57_A Endothelial differentiation-related factor 1; HMBF1alpha, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.35.1.12 Length = 91 Back     alignment and structure
 Score = 65.6 bits (160), Expect = 4e-16
 Identities = 29/59 (49%), Positives = 46/59 (77%)

Query: 19 PDTPRQIQRARLGKKMSQPDLANQINQRPQVVSEYENGKAVPNQTVLAKMEKAIGVKLR 77
           +  + IQ+ R  K ++Q DLA +IN++PQV+++YE+G+A+PN  VL K+E+AIG+KLR
Sbjct: 12 LEVGKVIQQGRQSKGLTQKDLATKINEKPQVIADYESGRAIPNNQVLGKIERAIGLKLR 70


>2jvl_A TRMBF1; coactivator, helix-turn-helix, Pro binding, transcription; NMR {Trichoderma reesei} Length = 107 Back     alignment and structure
>1adr_A P22 C2 repressor; transcription regulation; NMR {Enterobacteria phage P22} SCOP: a.35.1.2 Length = 76 Back     alignment and structure
>2r1j_L Repressor protein C2; protein-DNA complex, helix-turn-helix, DNA-binding, transcription, transcription regulation; 1.53A {Enterobacteria phage P22} SCOP: a.35.1.2 PDB: 3jxb_C 3jxc_L 3jxd_L Length = 68 Back     alignment and structure
>2kpj_A SOS-response transcriptional repressor, LEXA; NESG, GFT, structural genomics, PSI-2, protein structure initiative; NMR {Eubacterium rectale atcc 33656} Length = 94 Back     alignment and structure
>3omt_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; 1.65A {Cytophaga hutchinsonii} Length = 73 Back     alignment and structure
>2p5t_A Putative transcriptional regulator PEZA; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae} Length = 158 Back     alignment and structure
>3bs3_A Putative DNA-binding protein; XRE-family, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.65A {Bacteroides fragilis} Length = 76 Back     alignment and structure
>2wiu_B HTH-type transcriptional regulator HIPB; transferase transcription complex, serine kinase, DNA-bindin mercury derivative, repressor; 2.35A {Escherichia coli} PDB: 3dnv_B* 3dnw_B* 3hzi_B* Length = 88 Back     alignment and structure
>3op9_A PLI0006 protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG, transcription regulat; HET: MSE; 1.90A {Listeria innocua} Length = 114 Back     alignment and structure
>1r69_A Repressor protein CI; gene regulating protein; 2.00A {Phage 434} SCOP: a.35.1.2 PDB: 1pra_A 1per_L 1rpe_L* 2or1_L* 1r63_A 2r63_A 1sq8_A Length = 69 Back     alignment and structure
>3kxa_A NGO0477 protein, putative uncharacterized protein; NEW protein fold, OPPF, STRU genomics, oxford protein production facility; 2.80A {Neisseria gonorrhoeae} Length = 141 Back     alignment and structure
>3ivp_A Putative transposon-related DNA-binding protein; APC62618, clostridium diffic structural genomics, PSI-2, protein structure initiative; HET: PG4; 2.02A {Clostridium difficile} Length = 126 Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Length = 293 Back     alignment and structure
>1zug_A Phage 434 CRO protein; gene regulating protein, transcription regulation; NMR {Phage 434} SCOP: a.35.1.2 PDB: 2cro_A 3cro_L* Length = 71 Back     alignment and structure
>3o9x_A Uncharacterized HTH-type transcriptional regulato; HTH-XRE DNA binding motif, transcriptional regulator, bacter antitoxin, Zn binding protein, transcription regulator-DNA; HET: DNA; 2.10A {Escherichia coli} PDB: 3gn5_A* 3gn5_B* 2kz8_A Length = 133 Back     alignment and structure
>3mlf_A Transcriptional regulator; structural genomics, helix-turn-helix XRE-family like protei transcription regulator, PSI-2; 2.60A {Staphylococcus aureus subsp} Length = 111 Back     alignment and structure
>3lfp_A CSP231I C protein; transcriptional regulator, DNA binding protein, helix-turn-H restriction-modification, transcription; 2.00A {Citrobacter SP} PDB: 3lis_A Length = 98 Back     alignment and structure
>2bnm_A Epoxidase; oxidoreductase, cupin, HTH, cation-dependant, zinc, fosfomycin; 1.7A {Streptomyces wedmorensis} SCOP: a.35.1.3 b.82.1.10 PDB: 1zz7_A 1zz8_A 1zz9_A 1zzb_A 1zz6_A 1zzc_A 2bnn_A 2bno_A 3scf_A 3scg_A 3sch_A Length = 198 Back     alignment and structure
>3f6w_A XRE-family like protein; helix-turn-helix, DNA binding protein, xenobiotic response E family of transcriptional regulators; HET: MSE BTB; 1.85A {Pseudomonas syringae PV} Length = 83 Back     alignment and structure
>1y7y_A C.AHDI; helix-turn-helix, DNA-binding protein, transcriptional regulator, transcription regulator; 1.69A {Aeromonas hydrophila} SCOP: a.35.1.3 Length = 74 Back     alignment and structure
>3bdn_A Lambda repressor; repressor, allostery; HET: DNA; 3.91A {Enterobacteria phage lambda} Length = 236 Back     alignment and structure
>2ef8_A C.ECOT38IS, putative transcription factor; helix-turn-helix, DNA binding protein, transcription regulator; HET: CME; 1.95A {Enterobacteria phage P2} Length = 84 Back     alignment and structure
>3f52_A CLP gene regulator (CLGR); helix-turn-helix motif, transcriptional ACTI human pathogen, transcription activator; 1.75A {Corynebacterium glutamicum} PDB: 3f51_A Length = 117 Back     alignment and structure
>2ppx_A AGR_C_3184P, uncharacterized protein ATU1735; HTH-motif, XRE-family, structural genomics, PSI-2, protein structure initiative; 2.00A {Agrobacterium tumefaciens str} SCOP: a.35.1.3 Length = 99 Back     alignment and structure
>2b5a_A C.BCLI; helix-turn-helix motif, gene regulation; 1.54A {Bacillus caldolyticus} SCOP: a.35.1.3 Length = 77 Back     alignment and structure
>2ewt_A BLDD, putative DNA-binding protein; the DNA-binding domain of BLDD; 1.81A {Streptomyces coelicolor} Length = 71 Back     alignment and structure
>3s8q_A R-M controller protein; protein-DNA complex, helix-turn-helix; HET: DNA; 2.10A {Enterobacter SP} PDB: 3clc_A* Length = 82 Back     alignment and structure
>3g5g_A Regulatory protein; transcriptional regulator, helix-turn-helix, restriction- modification, transcription regulator; 2.80A {Enterobacter SP} PDB: 3fya_A Length = 99 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query82
2jvl_A107 TRMBF1; coactivator, helix-turn-helix, Pro binding 99.75
2ewt_A71 BLDD, putative DNA-binding protein; the DNA-bindin 99.75
3qq6_A78 HTH-type transcriptional regulator SINR; helix-tur 99.73
3s8q_A82 R-M controller protein; protein-DNA complex, helix 99.73
3omt_A73 Uncharacterized protein; structural genomics, PSI- 99.73
3kz3_A80 Repressor protein CI; five helix bundle, DNA-bindi 99.73
3g5g_A99 Regulatory protein; transcriptional regulator, hel 99.73
1y7y_A74 C.AHDI; helix-turn-helix, DNA-binding protein, tra 99.73
3t76_A88 VANU, transcriptional regulator vanug; structural 99.73
3f6w_A83 XRE-family like protein; helix-turn-helix, DNA bin 99.72
3lfp_A98 CSP231I C protein; transcriptional regulator, DNA 99.71
2r1j_L68 Repressor protein C2; protein-DNA complex, helix-t 99.71
2k9q_A77 Uncharacterized protein; all helix, helix-turn-hel 99.71
3b7h_A78 Prophage LP1 protein 11; structural genomics, PSI2 99.71
2b5a_A77 C.BCLI; helix-turn-helix motif, gene regulation; 1 99.71
3op9_A114 PLI0006 protein; structural genomics, PSI-2, prote 99.7
3ivp_A126 Putative transposon-related DNA-binding protein; A 99.7
1x57_A91 Endothelial differentiation-related factor 1; HMBF 99.7
1adr_A76 P22 C2 repressor; transcription regulation; NMR {E 99.7
2kpj_A94 SOS-response transcriptional repressor, LEXA; NESG 99.7
3vk0_A114 NHTF, transcriptional regulator; HTH motif, XRE tr 99.69
3eus_A86 DNA-binding protein; structural genomics, PSI2,MCS 99.69
3trb_A104 Virulence-associated protein I; mobIle and extrach 99.69
2xi8_A66 Putative transcription regulator; HTH DNA-binding 99.69
3bs3_A76 Putative DNA-binding protein; XRE-family, structur 99.69
3mlf_A111 Transcriptional regulator; structural genomics, he 99.69
1lmb_392 Protein (lambda repressor); protein-DNA complex, d 99.68
2wiu_B88 HTH-type transcriptional regulator HIPB; transfera 99.68
3fmy_A73 HTH-type transcriptional regulator MQSA (YGIT/B302 99.68
3f52_A117 CLP gene regulator (CLGR); helix-turn-helix motif, 99.68
2a6c_A83 Helix-turn-helix motif; putative transcriptional r 99.68
1r69_A69 Repressor protein CI; gene regulating protein; 2.0 99.67
3cec_A104 Putative antidote protein of plasmid maintenance; 99.66
1b0n_A111 Protein (SINR protein); transcription regulator, a 99.65
4ghj_A101 Probable transcriptional regulator; structural gen 99.64
2ict_A94 Antitoxin HIGA; helix-turn-helix, structural genom 99.64
1zug_A71 Phage 434 CRO protein; gene regulating protein, tr 99.64
3fym_A130 Putative uncharacterized protein; HTH DNA binding, 99.63
2ef8_A84 C.ECOT38IS, putative transcription factor; helix-t 99.63
2wus_R112 RODZ, putative uncharacterized protein; structural 99.63
2l49_A99 C protein; P2 bacteriophage, P2 C, direct repeats, 99.63
2o38_A120 Hypothetical protein; alpha-beta, helix-turn-helix 99.62
2ppx_A99 AGR_C_3184P, uncharacterized protein ATU1735; HTH- 99.62
2eby_A113 Putative HTH-type transcriptional regulator YBAQ; 99.61
1y9q_A 192 Transcriptional regulator, HTH_3 family; transcrip 99.61
3kxa_A141 NGO0477 protein, putative uncharacterized protein; 99.61
2bnm_A 198 Epoxidase; oxidoreductase, cupin, HTH, cation-depe 99.59
2ofy_A86 Putative XRE-family transcriptional regulator; tra 99.59
3bd1_A79 CRO protein; transcription factor, helix-turn-heli 99.56
3r1f_A135 ESX-1 secretion-associated regulator ESPR; helix-t 99.56
3u3w_A 293 Transcriptional activator PLCR protein; ternary co 99.54
3qwg_A123 ESX-1 secretion-associated regulator ESPR; N-termi 99.54
3pxp_A 292 Helix-turn-helix domain protein; DNA-binding, basi 99.51
3o9x_A133 Uncharacterized HTH-type transcriptional regulato; 99.48
2awi_A 317 PRGX; repressor, pheromone, DNA binding, regulator 99.47
4ich_A 311 Transcriptional regulator; structural genomics, PS 99.45
1neq_A74 DNA-binding protein NER; NMR {Enterobacteria phage 99.45
2p5t_A158 Putative transcriptional regulator PEZA; postsegre 99.42
3bdn_A 236 Lambda repressor; repressor, allostery; HET: DNA; 99.4
2qfc_A 293 PLCR protein; TPR, HTH, transcription regulation; 99.4
2l1p_A83 DNA-binding protein SATB1; PSI-biology, NESG, stru 99.4
2fjr_A 189 Repressor protein CI; genetic switch, regulation, 99.28
2auw_A170 Hypothetical protein NE0471; alpha-beta structure, 99.19
1dw9_A156 Cyanate lyase; cyanate degradation, structural gen 99.02
1nr3_A122 MTH0916, DNA-binding protein TFX; northeast struct 99.01
1rzs_A61 Antirepressor, regulatory protein CRO; helix-turn- 98.92
1uxc_A65 FRUR (1-57), fructose repressor; DNA-binding prote 98.82
2l8n_A67 Transcriptional repressor CYTR; bacterial gene rep 98.74
1zx4_A192 P1 PARB, plasmid partition PAR B protein, PARB; tr 98.68
3g7d_A 443 PHPD; non heme Fe(II) dioxygenase, cupin, biosynth 98.66
1s4k_A120 Putative cytoplasmic protein YDIL; structural geno 98.64
2h8r_A 221 Hepatocyte nuclear factor 1-beta; trasncription fa 98.61
2pij_A67 Prophage PFL 6 CRO; transcription factor, helix-tu 98.54
1ic8_A 194 Hepatocyte nuclear factor 1-alpha; transcription r 98.5
2hin_A71 GP39, repressor protein; transcription factor, dim 98.3
2l0k_A93 Stage III sporulation protein D; SPOIIID, solution 98.21
2cw1_A65 SN4M; lambda CRO fold, de novo protein; NMR {Synth 98.08
1zs4_A83 Regulatory protein CII; helix-turn-helix, transcri 97.96
1jhf_A 202 LEXA repressor; LEXA SOS repressor, hydrolase; 1.8 97.96
1xwr_A97 Regulatory protein CII; all-alpha fold, DNA bindin 97.94
2ao9_A155 Phage protein; structural genomics, nine-fold NCS. 97.66
2x48_A55 CAG38821; archeal virus, viral protein; 2.60A {Sul 97.57
2hsg_A 332 Glucose-resistance amylase regulator; CCPA, transc 97.55
1qpz_A 340 PURA, protein (purine nucleotide synthesis repress 97.52
3kjx_A 344 Transcriptional regulator, LACI family; LACL famil 97.48
1tc3_C51 Protein (TC3 transposase); DNA binding, helix-turn 97.36
1jhg_A101 Trp operon repressor; complex (regulatory protein- 97.32
3h5t_A 366 Transcriptional regulator, LACI family; DNA-depend 97.26
1jko_C52 HIN recombinase, DNA-invertase HIN; water-mediated 97.25
2w7n_A101 TRFB transcriptional repressor protein; INCP, plas 97.03
2ovg_A66 Phage lambda CRO; transcription factor, helix-turn 97.02
2o20_A 332 Catabolite control protein A; CCPA, transcriptiona 96.97
1j9i_A68 GPNU1 DBD;, terminase small subunit; DNA binding d 96.87
3dbi_A 338 Sugar-binding transcriptional regulator, LACI FAM; 96.77
2csf_A101 DNA-binding protein SATB2; CUT domain, special AT- 96.76
3h5o_A 339 Transcriptional regulator GNTR; transcription regu 96.73
1x3u_A79 Transcriptional regulatory protein FIXJ; helix-tur 96.59
3e3m_A 355 Transcriptional regulator, LACI family; structural 96.57
3jvd_A 333 Transcriptional regulators; structural genomics, P 96.57
3me5_A 482 Cytosine-specific methyltransferase; structural ge 96.52
3ctp_A 330 Periplasmic binding protein/LACI transcriptional; 96.49
3e7l_A63 Transcriptional regulator (NTRC family); sigma43 a 96.48
2jn6_A97 Protein CGL2762, transposase; GFT PSI-2, protein s 96.48
1jye_A 349 Lactose operon repressor; gene regulation, protein 96.47
1qgp_A77 Protein (double stranded RNA adenosine deaminase); 96.44
2elh_A87 CG11849-PA, LD40883P; structural genomics, NPPSFA, 96.4
2htj_A81 P fimbrial regulatory protein KS71A; winged helix- 96.36
1qbj_A81 Protein (double-stranded RNA specific adenosine D 96.27
1umq_A81 Photosynthetic apparatus regulatory protein; DNA-b 96.22
2glo_A59 Brinker CG9653-PA; protein-DNA complex, helix-turn 96.21
3bil_A 348 Probable LACI-family transcriptional regulator; st 96.14
1z4h_A66 TORI, TOR inhibition protein; winged helix, revers 96.11
1g2h_A61 Transcriptional regulatory protein TYRR homolog; p 96.1
1hlv_A131 CENP-B, major centromere autoantigen B; helix-turn 96.09
2p7v_B68 Sigma-70, RNA polymerase sigma factor RPOD; RSD, r 96.08
1e3o_C160 Octamer-binding transcription factor 1; transcript 96.05
1pdn_C128 Protein (PRD paired); protein-DNA complex, double 96.04
2jml_A81 DNA binding domain/transcriptional regulator; anti 96.0
1u78_A141 TC3 transposase, transposable element TC3 transpos 95.99
2heo_A67 Z-DNA binding protein 1; protein DLM1-Z-DNA comple 95.97
2o8x_A70 Probable RNA polymerase sigma-C factor; promoter r 95.91
2jpc_A61 SSRB; DNA binding protein, structural genomics, PS 95.88
2xsd_C164 POU domain, class 3, transcription factor 1; trans 95.86
1au7_A146 Protein PIT-1, GHF-1; complex (DNA-binding protein 95.86
1r71_A178 Transcriptional repressor protein KORB; INCP, plas 95.86
1je8_A82 Nitrate/nitrite response regulator protein NARL; p 95.85
3hug_A92 RNA polymerase sigma factor; ECF sigma factor, zin 95.83
1ntc_A91 Protein (nitrogen regulation protein (NTRC)); heli 95.81
2vz4_A108 Tipal, HTH-type transcriptional activator TIPA; tr 95.81
1k78_A149 Paired box protein PAX5; paired domain, ETS domain 95.8
2dk5_A91 DNA-directed RNA polymerase III 39 kDa polypeptide 95.78
1ku3_A73 Sigma factor SIGA; helix-turn-helix, transcription 95.78
1xn7_A78 Hypothetical protein YHGG; alpha+beta, GFT structu 95.71
2w48_A 315 Sorbitol operon regulator; SORC, activator, repres 95.71
3ulq_B90 Transcriptional regulatory protein COMA; tetratric 95.67
2ox6_A166 Hypothetical protein SO3848; structural genomics, 95.66
1vz0_A230 PARB, chromosome partitioning protein PARB; nuclea 95.65
1x2l_A101 CUT-like 2, homeobox protein CUX-2; CUT domain, hu 95.64
1wh6_A101 CUT-like 2, homeobox protein CUX-2; CUT domain, st 95.59
1fse_A74 GERE; helix-turn-helix DNA-binding protein transcr 95.53
3kor_A119 Possible Trp repressor; putative DNA-binding Trp r 95.49
2o4a_A93 DNA-binding protein SATB1; protein-DNA complex, tr 95.46
1eto_A98 FIS, factor for inversion stimulation; transcripti 95.44
1tty_A87 Sigma-A, RNA polymerase sigma factor RPOD; helix-t 95.39
1sfx_A109 Conserved hypothetical protein AF2008; structural 95.37
1r8d_A109 Transcription activator MTAN; protein-DNA complex, 95.37
2d1h_A109 ST1889, 109AA long hypothetical transcriptional re 95.33
2k27_A159 Paired box protein PAX-8; paired domain, solution 95.3
2rn7_A108 IS629 ORFA; helix, all alpha, unknown function, st 95.3
3r0a_A123 Putative transcriptional regulator; structural gen 95.29
1oyi_A82 Double-stranded RNA-binding protein; (alpha+beta) 95.25
3c57_A95 Two component transcriptional regulatory protein; 95.17
1s7o_A113 Hypothetical UPF0122 protein SPY1201/SPYM3_0842/SP 95.16
2k02_A87 Ferrous iron transport protein C; FEOC, iron-sulfu 95.15
3cuo_A99 Uncharacterized HTH-type transcriptional regulato; 95.04
2o3f_A111 Putative HTH-type transcriptional regulator YBBH; 94.99
2cfx_A144 HTH-type transcriptional regulator LRPC; transcrip 94.98
3d1n_I151 POU domain, class 6, transcription factor 1; prote 94.97
2rnj_A91 Response regulator protein VRAR; HTH LUXR-type dom 94.93
1wiz_A101 DNA-binding protein SATB2; helix bundle, KIAA1034 94.92
3l1p_A155 POU domain, class 5, transcription factor 1; POU, 94.92
1p4w_A99 RCSB; solution structure, DNA binding domain, DNA 94.92
2jt1_A77 PEFI protein; solution structure, winged helix-tur 94.89
2w25_A150 Probable transcriptional regulatory protein; trans 94.84
3frw_A107 Putative Trp repressor protein; structural genomic 94.8
2p5k_A64 Arginine repressor; DNA-binding domain, winged hel 94.79
2cg4_A152 Regulatory protein ASNC; DNA binding, FFRP, LRP fa 94.78
2pg4_A95 Uncharacterized protein; structural genomics, join 94.71
2p5v_A162 Transcriptional regulator, LRP/ASNC family; NMB057 94.71
1ub9_A100 Hypothetical protein PH1061; helix-turn-helix moti 94.71
2dbb_A151 Putative HTH-type transcriptional regulator PH006; 94.7
1q06_A135 Transcriptional regulator CUER; MERR family transc 94.69
1xsv_A113 Hypothetical UPF0122 protein SAV1236; helix-turn-h 94.66
1y0u_A96 Arsenical resistance operon repressor, putative; s 94.6
3bpv_A138 Transcriptional regulator; MARR, DNA binding, tran 94.56
3hh0_A146 Transcriptional regulator, MERR family; protein st 94.52
3bdd_A142 Regulatory protein MARR; putative multiple antibio 94.52
3nrv_A148 Putative transcriptional regulator (MARR/EMRR FAM; 94.51
3iwf_A107 Transcription regulator RPIR family; transcription 94.5
3ech_A142 MEXR, multidrug resistance operon repressor; winge 94.47
3g3z_A145 NMB1585, transcriptional regulator, MARR family; t 94.47
2cyy_A151 Putative HTH-type transcriptional regulator PH151; 94.44
2pn6_A150 ST1022, 150AA long hypothetical transcriptional re 94.38
1r1u_A106 CZRA, repressor protein; zinc, DNA binding, transc 94.38
2e1c_A171 Putative HTH-type transcriptional regulator PH151; 94.38
3t72_q99 RNA polymerase sigma factor RPOD, DNA-directed RN 94.37
2ia0_A171 Putative HTH-type transcriptional regulator PF086; 94.36
2nnn_A140 Probable transcriptional regulator; structural gen 94.34
1u2w_A122 CADC repressor, cadmium efflux system accessory pr 94.33
3mzy_A164 RNA polymerase sigma-H factor; PSI, MCSG, structur 94.29
1i1g_A141 Transcriptional regulator LRPA; helix-turn-helix, 94.28
2hr3_A147 Probable transcriptional regulator; MCSG, structur 94.26
3oop_A143 LIN2960 protein; protein structure initiative, PSI 94.25
3gp4_A142 Transcriptional regulator, MERR family; structural 94.25
2wte_A244 CSA3; antiviral protein, viral resistance, winged 94.23
2oz6_A207 Virulence factor regulator; winged helix, helix-tu 94.22
2oqg_A114 Possible transcriptional regulator, ARSR family P; 94.22
2a61_A145 Transcriptional regulator TM0710; APC4350, MCSG, m 94.14
2rdp_A150 Putative transcriptional regulator MARR; PFAM PF01 94.13
2lkp_A119 Transcriptional regulator, ARSR family; symmetric 94.1
2fa5_A162 Transcriptional regulator MARR/EMRR family; multip 94.05
3ryp_A210 Catabolite gene activator; CAMP receptor protein ( 94.04
1on2_A142 Transcriptional regulator MNTR; helix-turn-helix, 94.03
2zkz_A99 Transcriptional repressor PAGR; protein-DNA, HTH m 94.03
3mky_B189 Protein SOPB; partition, F plasmid, centromere, DN 94.02
3bro_A141 Transcriptional regulator; helix_TURN_helix, multi 94.0
2zcw_A202 TTHA1359, transcriptional regulator, FNR/CRP famil 93.97
4hbl_A149 Transcriptional regulator, MARR family; HTH, trans 93.95
2fbi_A142 Probable transcriptional regulator; MARR, APC5816, 93.92
2fbh_A146 Transcriptional regulator PA3341; MARR, transcript 93.91
2eth_A154 Transcriptional regulator, putative, MAR family; M 93.88
2f07_A 197 YVDT; helix-turn-helix, transcription; HET: BTB; 2 93.83
1jgs_A138 Multiple antibiotic resistance protein MARR; trans 93.83
1j5y_A 187 Transcriptional regulator, biotin repressor famil; 93.82
3s2w_A159 Transcriptional regulator, MARR family; structural 93.82
3eco_A139 MEPR; mutlidrug efflux pump regulator winged helix 93.81
3dv8_A220 Transcriptional regulator, CRP/FNR family; cyclic 93.8
3iwz_A230 CAP-like, catabolite activation-like protein; XCC, 93.75
3b02_A195 Transcriptional regulator, CRP family; structural 93.71
3e97_A231 Transcriptional regulator, CRP/FNR family; YP_6044 93.71
3i4p_A162 Transcriptional regulator, ASNC family; PSI, struc 93.7
3kkc_A177 TETR family transcriptional regulator; APC20805, s 93.68
2qww_A154 Transcriptional regulator, MARR family; YP_013417. 93.68
3mn2_A108 Probable ARAC family transcriptional regulator; st 93.66
2fmy_A220 COOA, carbon monoxide oxidation system transcripti 93.65
4ev0_A216 Transcription regulator, CRP family; CAMP binding, 93.6
1lj9_A144 Transcriptional regulator SLYA; HTH DNA binding pr 93.6
3d0s_A227 Transcriptional regulatory protein; CAMP receptor 93.58
1ft9_A222 Carbon monoxide oxidation system transcription reg 93.58
1wh8_A111 CUT-like 2, homeobox protein CUX-2; CUT domain, st 93.55
3kp7_A151 Transcriptional regulator TCAR; multiple drug resi 93.51
2qvo_A95 Uncharacterized protein AF_1382; PSI, structural g 93.5
1z05_A 429 Transcriptional regulator, ROK family; structural 93.49
3k0l_A162 Repressor protein; helix-turn-helix, structural ge 93.46
3qkx_A 188 Uncharacterized HTH-type transcriptional regulato; 93.45
2zhg_A154 Redox-sensitive transcriptional activator SOXR; ox 93.45
1z6r_A 406 MLC protein; transcriptional repressor, ROK family 93.42
1q1h_A110 TFE, transcription factor E, TFE; TFIIE, transcrip 93.42
2r0q_C209 Putative transposon TN552 DNA-invertase BIN3; site 93.4
3bqz_B 194 HTH-type transcriptional regulator QACR; multidrug 93.39
3gpv_A148 Transcriptional regulator, MERR family; protein st 93.37
2pex_A153 Transcriptional regulator OHRR; transcription regu 93.36
1zyb_A232 Transcription regulator, CRP family; NP_813211.1, 93.35
3bj6_A152 Transcriptional regulator, MARR family; helix-turn 93.35
3lsg_A103 Two-component response regulator YESN; structural 93.33
2nyx_A168 Probable transcriptional regulatory protein, RV14; 93.32
1u8b_A133 ADA polyprotein; protein-DNA complex, methylation, 93.31
2hoe_A 380 N-acetylglucosamine kinase; TM1224, structural gen 93.27
3oio_A113 Transcriptional regulator (ARAC-type DNA-binding c 93.27
2gxg_A146 146AA long hypothetical transcriptional regulator; 93.27
2k9s_A107 Arabinose operon regulatory protein; activator, ar 93.27
1or7_A194 Sigma-24, RNA polymerase sigma-E factor; regulatio 93.26
3la7_A243 Global nitrogen regulator; activator, DNA-binding, 93.23
3cjn_A162 Transcriptional regulator, MARR family; silicibact 93.23
1gdt_A183 GD resolvase, protein (gamma delta resolvase); pro 93.21
1rp3_A239 RNA polymerase sigma factor sigma-28 (FLIA); trans 93.2
3dkw_A227 DNR protein; CRP-FNR, HTH, beta barrel, dimerizati 93.18
3tgn_A146 ADC operon repressor ADCR; helix-turn-helix, trans 93.17
2d6y_A 202 Putative TETR family regulatory protein; helix-tur 93.14
3egq_A170 TETR family transcriptional regulator; DNA-binding 93.14
3ppb_A 195 Putative TETR family transcription regulator; DNA- 93.13
2gau_A232 Transcriptional regulator, CRP/FNR family; structu 93.13
2x4h_A139 Hypothetical protein SSO2273; transcription; 2.30A 93.13
3on4_A 191 Transcriptional regulator, TETR family; structural 93.12
1s3j_A155 YUSO protein; structural genomics, MARR transcript 93.12
1ojl_A304 Transcriptional regulatory protein ZRAR; response 93.1
3lwj_A 202 Putative TETR-family transcriptional regulator; st 93.09
3e6c_C250 CPRK, cyclic nucleotide-binding protein; CPRK, hal 93.09
3vpr_A 190 Transcriptional regulator, TETR family; all alpha, 93.09
4dyq_A140 Gene 1 protein; GP1, octamer, DNA-binding, viral p 93.09
3oou_A108 LIN2118 protein; protein structure initiative, PSI 93.03
3e6m_A161 MARR family transcriptional regulator; APC88769, s 92.99
3fx3_A237 Cyclic nucleotide-binding protein; helix_TURN_heli 92.96
2rae_A 207 Transcriptional regulator, ACRR family protein; TE 92.95
3anp_C 204 Transcriptional repressor, TETR family; all alpha 92.93
2qtq_A 213 Transcriptional regulator, TETR family; transcript 92.92
3f1b_A 203 TETR-like transcriptional regulator; APC5888, rhod 92.9
3lhq_A 220 Acrab operon repressor (TETR/ACRR family); structu 92.88
3kcc_A260 Catabolite gene activator; helix-turn-helix, CAMP, 92.87
2v57_A 190 TETR family transcriptional repressor LFRR; DNA-bi 92.85
3k2z_A 196 LEXA repressor; winged helix-turn-helix, SOS syste 92.83
2h09_A155 Transcriptional regulator MNTR; transcription regu 92.81
3knw_A 212 Putative transcriptional regulator (TETR/ACRR FAM; 92.79
2fq4_A 192 Transcriptional regulator, TETR family; DNA-bindin 92.78
3jth_A98 Transcription activator HLYU; transcription factor 92.76
2frh_A127 SARA, staphylococcal accessory regulator A; winged 92.76
3jw4_A148 Transcriptional regulator, MARR/EMRR family; DNA-b 92.75
3dcf_A 218 Transcriptional regulator of the TETR/ACRR family; 92.73
2zcm_A 192 Biofilm operon icaabcd HTH-type negative transcri 92.72
3qbm_A 199 TETR transcriptional regulator; DNA/RNA-binding th 92.69
3mkl_A120 HTH-type transcriptional regulator GADX; PSI2, MCS 92.69
2g7s_A 194 Transcriptional regulator, TETR family; APC5906, P 92.68
2kko_A108 Possible transcriptional regulatory protein (possi 92.66
3ljl_A156 Transcriptional regulator LUXT; structural genomic 92.65
4aci_A 191 HTH-type transcriptional repressor ACNR; aconitase 92.61
3cdh_A155 Transcriptional regulator, MARR family; helix-turn 92.59
3dpj_A 194 Transcription regulator, TETR family; APC88616, si 92.59
2dg7_A 195 Putative transcriptional regulator; helix-turn-hel 92.59
1ku9_A152 Hypothetical protein MJ223; putative transcription 92.58
2oa4_A101 SIR5; structure, structural genomics, PSI-2, prote 92.54
1yse_A141 DNA-binding protein SATB1; all helical, DNA-bindin 92.54
2jrt_A95 Uncharacterized protein; solution, structure, NESG 92.53
3kz9_A 206 SMCR; transcriptional regulator, quorum S DNA-bind 92.5
1z91_A147 Organic hydroperoxide resistance transcriptional; 92.46
3bni_A 229 Putative TETR-family transcriptional regulator; st 92.45
2dg6_A 222 Putative transcriptional regulator; winged-helix m 92.44
4fx0_A148 Probable transcriptional repressor protein; helix- 92.43
3vp5_A 189 Transcriptional regulator; heme, sensor protein, T 92.43
2eh3_A 179 Transcriptional regulator; all alpha proteins, tet 92.41
3fm5_A150 Transcriptional regulator; MCSG, PF04017, PSI, MAR 92.4
3hsr_A140 HTH-type transcriptional regulator SARZ; helix-tur 92.39
1tbx_A99 ORF F-93, hypothetical 11.0 kDa protein; sulfolobu 92.35
3o60_A185 LIN0861 protein; PSI, MCSG, structural genomics, m 92.31
3bru_A 222 Regulatory protein, TETR family; structural genomi 92.31
1pb6_A 212 Hypothetical transcriptional regulator YCDC; helix 92.3
3vib_A 210 MTRR; helix-turn-helix motif, DNA binding, DNA bin 92.26
3gzi_A 218 Transcriptional regulator, TETR family; TETR famil 92.25
3bhq_A 211 Transcriptional regulator; bacterial RE proteins, 92.24
3dew_A 206 Transcriptional regulator, TETR family; S genomics 92.24
3nqo_A189 MARR-family transcriptional regulator; structural 92.24
2jj7_A 186 Hemolysin II regulatory protein; DNA-binding prote 92.23
2fu4_A83 Ferric uptake regulation protein; DNA binding doma 92.22
1u78_A141 TC3 transposase, transposable element TC3 transpos 92.19
3f0c_A 216 TETR-molecule A, transcriptional regulator; MCSG,P 92.16
3frq_A 195 Repressor protein MPHR(A); macrolide antibiotic. r 92.11
3szt_A237 QCSR, quorum-sensing control repressor; quorum sen 92.11
3loc_A 212 HTH-type transcriptional regulator RUTR; helix-tur 92.11
4a0z_A 190 Transcription factor FAPR; lipid homeostasis; HET: 92.1
2yve_A 185 Transcriptional regulator; helix-turn-helix, TETR- 92.09
3pas_A 195 TETR family transcription regulator; structural ge 92.09
3rh2_A 212 Hypothetical TETR-like transcriptional regulator; 92.08
3clo_A258 Transcriptional regulator; NP_811094.1, bacterial 92.07
3deu_A166 Transcriptional regulator SLYA; MARR, WING-helix, 92.0
2kfs_A148 Conserved hypothetical regulatory protein; WHTH, D 91.97
2d5v_A164 Hepatocyte nuclear factor 6; transcription factor, 91.96
3mnl_A 203 KSTR, transcriptional regulatory protein (probably 91.96
3f3x_A144 Transcriptional regulator, MARR family, putative; 91.92
2lfw_A157 PHYR sigma-like domain; signal transduction, respo 91.89
3cwr_A 208 Transcriptional regulator, TETR family; YP_425770. 91.88
3c2b_A 221 Transcriptional regulator, TETR family; structural 91.87
2qwt_A 196 Transcriptional regulator, TETR family; structural 91.86
3e7q_A 215 Transcriptional regulator; structural genomics, PS 91.85
2ibd_A 204 Possible transcriptional regulator; probable trans 91.83
2fxa_A207 Protease production regulatory protein HPR; protea 91.81
3cjd_A 198 Transcriptional regulator, TETR family; YP_510936. 91.8
2nx4_A 194 Transcriptional regulator, TETR family protein; HT 91.8
3dn7_A194 Cyclic nucleotide binding regulatory protein; stru 91.8
2oer_A 214 Probable transcriptional regulator; helix-turn-hel 91.79
2dg8_A 193 Putative TETR-family transcriptional regulatory P; 91.76
1vi0_A 206 Transcriptional regulator; structural genomics; HE 91.73
2hku_A 215 A putative transcriptional regulator; structural g 91.71
3nxc_A 212 HTH-type protein SLMA; nucleoid occlusion, cell di 91.69
2g3b_A 208 Putative TETR-family transcriptional regulator; tr 91.68
3b81_A 203 Transcriptional regulator, ACRR family; NP_350189. 91.67
2zb9_A 214 Putative transcriptional regulator; transcription 91.67
2rek_A 199 Putative TETR-family transcriptional regulator; su 91.61
4aik_A151 Transcriptional regulator SLYA; transcription, tra 91.57
2o7t_A 199 Transcriptional regulator; transcription regulator 91.54
2wui_A 210 MEXZ, transcriptional regulator; gene regulation, 91.53
2gen_A 197 Probable transcriptional regulator; APC6095, TETR 91.53
1r1t_A122 Transcriptional repressor SMTB; zinc, transcriptio 91.49
2i10_A 202 Putative TETR transcriptional regulator; structura 91.48
3mvp_A 217 TETR/ACRR transcriptional regulator; PSI, MCSG, st 91.47
3g7r_A 221 Putative transcriptional regulator; TETR, all-heli 91.47
1okr_A123 MECI, methicillin resistance regulatory protein ME 91.47
3b73_A111 PHIH1 repressor-like protein; winged-helix-turn-he 91.45
2jsc_A118 Transcriptional regulator RV1994C/MT2050; cadmium, 91.42
2hyt_A 197 TETR-family transcriptional regulator; structural 91.4
3bja_A139 Transcriptional regulator, MARR family, putative; 91.39
2q0o_A236 Probable transcriptional activator protein TRAR; h 91.39
2qib_A 231 TETR-family transcriptional regulator; HTH DNA bin 91.34
3nnr_A 228 Transcriptional regulator, TETR family; TETR-famil 91.26
2np5_A 203 Transcriptional regulator; TETR family, structural 91.26
3col_A 196 Putative transcription regulator; structural genom 91.25
3rd3_A 197 Probable transcriptional regulator; 2.40A {Pseudom 91.19
1uly_A 192 Hypothetical protein PH1932; helix-turn-helix, str 91.16
3q0w_A 236 HTH-type transcriptional regulator EThr; TETR fami 91.16
2bgc_A238 PRFA; bacterial infection, human pathogen, transcr 91.16
3v6g_A 208 Probable transcriptional regulatory protein (PROB 91.15
1mkm_A 249 ICLR transcriptional regulator; structural genomic 91.14
3bjb_A 207 Probable transcriptional regulator, TETR family P; 91.13
3g7d_A 443 PHPD; non heme Fe(II) dioxygenase, cupin, biosynth 91.12
1xmk_A79 Double-stranded RNA-specific adenosine deaminase; 91.11
3rqi_A184 Response regulator protein; structural genomics, s 91.09
3crj_A 199 Transcription regulator; APC88200, TETR, structura 91.08
1rkt_A 205 Protein YFIR; transcription regulator, structural 91.02
2id3_A 225 Putative transcriptional regulator; structural gen 90.96
3s5r_A 216 Transcriptional regulator TETR family; DNA/RNA-bin 90.96
2pz9_A 226 Putative regulatory protein; structural genomics, 90.85
1b4a_A149 Arginine repressor; helix turn helix; 2.50A {Geoba 90.83
1zk8_A 183 Transcriptional regulator, TETR family; TETR membe 90.83
2guh_A 214 Putative TETR-family transcriptional regulator; he 90.8
2gfn_A 209 HTH-type transcriptional regulator PKSA related P; 90.76
2zcx_A 231 SCO7815, TETR-family transcriptional regulator; he 90.76
3npi_A 251 TETR family regulatory protein; structural genomic 90.73
2q24_A 194 Putative TETR family transcriptional regulator; st 90.67
2o0m_A 345 Transcriptional regulator, SORC family; structural 90.67
1sfu_A75 34L protein; protein/Z-DNA complex, DNA binding pr 90.65
1l3l_A234 Transcriptional activator protein TRAR; helix-turn 90.63
3uj3_X193 DNA-invertase; helix-turn-helix, site-specific rec 90.59
1ui5_A 215 A-factor receptor homolog; helix-turn-helix, alpha 90.58
3he0_A 196 Transcriptional regulator, TETR family; ACRR, vibr 90.58
2bv6_A142 MGRA, HTH-type transcriptional regulator MGRA; mul 90.56
3eup_A 204 Transcriptional regulator, TETR family; structural 90.56
2w53_A 219 Repressor, SMet; antibiotic resistance, multi-drug 90.53
2obp_A96 Putative DNA-binding protein; structural genomics, 90.4
2id6_A 202 Transcriptional regulator, TETR family; 1.75A {The 90.37
3g1o_A 255 Transcriptional regulatory repressor protein (TETR 90.34
3qao_A 249 LMO0526 protein, MERR-like transcriptional regulat 90.29
1p6r_A82 Penicillinase repressor; transcription regulation, 90.28
3geu_A 189 Intercellular adhesion protein R; TETR family, int 90.22
1z7u_A112 Hypothetical protein EF0647; winged-helix-turn-hel 90.21
3pqk_A102 Biofilm growth-associated repressor; helix-turn-he 89.98
3rkx_A 323 Biotin-[acetyl-COA-carboxylase] ligase; biotin pro 89.97
3jsj_A 190 Putative TETR-family transcriptional regulator; DN 89.97
1t33_A 224 Putative transcriptional repressor (TETR/ACRR FAM; 89.93
2xdn_A 210 HTH-type transcriptional regulator TTGR; transcrip 89.85
2ras_A 212 Transcriptional regulator, TETR family; bacterial 89.84
1bl0_A129 Protein (multiple antibiotic resistance protein), 89.79
3szp_A 291 Transcriptional regulator, LYSR family; winged hel 89.75
1o5l_A213 Transcriptional regulator, CRP family; TM1171, str 89.73
2oi8_A 216 Putative regulatory protein SCO4313; TETR, structu 89.72
2hzt_A107 Putative HTH-type transcriptional regulator YTCD; 89.69
3bqy_A 209 Putative TETR family transcriptional regulator; st 89.66
2of7_A 260 Putative TETR-family transcriptional regulator; AP 89.65
2iai_A 230 Putative transcriptional regulator SCO3833; struct 89.61
3f6o_A118 Probable transcriptional regulator, ARSR family pr 89.59
2xrn_A 241 HTH-type transcriptional regulator TTGV; DNA-bindi 89.58
3c07_A 273 Putative TETR-family transcriptional regulator; AP 89.57
4b8x_A147 SCO5413, possible MARR-transcriptional regulator; 89.57
1sgm_A 191 Putative HTH-type transcriptional regulator YXAF; 89.5
1ixc_A 294 CBNR, LYSR-type regulatory protein; long alpha hel 89.42
3cdl_A 203 Transcriptional regulator AEFR; APC88582, TETR, ps 89.39
1r8e_A 278 Multidrug-efflux transporter regulator; protein-DN 89.39
3hta_A 217 EBRA repressor; TETR family, DNA binding protein, 89.37
2f2e_A146 PA1607; transcription factor, helix-TRUN-helix, AP 89.36
2esn_A 310 Probable transcriptional regulator; PA0477, APC582 89.27
1y6u_A70 XIS, excisionase from transposon TN916; structure, 89.27
3hhg_A 306 Transcriptional regulator, LYSR family; transcript 89.21
2xpw_A 207 Tetracycline repressor protein class D; transcript 89.16
2opt_A 234 Actii protein; helical protein, TETR family, APO-p 89.15
3hrs_A 214 Metalloregulator SCAR; DTXR/MNTR family member, tr 89.09
2fbq_A 235 Probable transcriptional regulator; PA3006, APC589 88.88
3qp6_A265 CVIR transcriptional regulator; quorum sensing, ag 88.83
1l9z_H438 Sigma factor SIGA; helix-turn-helix, coiled-coil, 88.69
2hyj_A 200 Putative TETR-family transcriptional regulator; HT 88.64
3boq_A160 Transcriptional regulator, MARR family; MARR famil 88.62
2hxi_A 241 Putative transcriptional regulator; structural gen 88.39
3u2r_A168 Regulatory protein MARR; structural genomics, PSI- 88.35
1u3e_M174 HNH homing endonuclease; HNH catalytic motif, heli 88.24
4ich_A 311 Transcriptional regulator; structural genomics, PS 88.18
2ijl_A135 AGR_C_4647P, molybdenum-binding transcriptional re 88.18
1iuf_A144 Centromere ABP1 protein; riken structural genomics 88.14
3cta_A 230 Riboflavin kinase; structural genomics, transferas 88.11
2k4b_A99 Transcriptional regulator; DNA binding protein, wi 87.91
2g7g_A 213 RHA04620, putative transcriptional regulator; heli 87.9
1sd4_A126 Penicillinase repressor; BLAI, MECI, methicillin, 87.85
3fxq_A 305 LYSR type regulator of TSAMBCD; transcriptional re 87.74
3aqt_A 245 Bacterial regulatory proteins, TETR family; helix- 87.74
1bia_A 321 BIRA bifunctional protein; transcription regulatio 87.67
1l0o_C243 Sigma factor; bergerat fold, helix-turn-helix, pro 87.65
1v4r_A102 Transcriptional repressor; helix-turn-helix, winge 87.64
1z0x_A 220 Transcriptional regulator, TETR family; structural 87.58
2b0l_A102 GTP-sensing transcriptional pleiotropic repressor; 87.48
4hku_A 178 LMO2814 protein, TETR transcriptional regulator; s 87.31
1rr7_A129 Middle operon regulator; MOR, transcription; 2.20A 87.3
2qko_A 215 Possible transcriptional regulator, TETR family P; 87.27
1k78_A149 Paired box protein PAX5; paired domain, ETS domain 87.25
2iu5_A 195 DHAS, YCEG, HTH-type dhaklm operon transcriptional 87.24
2og0_A52 Excisionase; protein-DNA complex, DNA architectura 87.0
3ni7_A 213 Bacterial regulatory proteins, TETR family; transc 86.94
3him_A 211 Probable transcriptional regulator; TETR, bacteria 86.78
4ham_A134 LMO2241 protein; structural genomics, PSI-biology, 86.75
2y2z_A 267 SIM16, SIMR, putative repressor simreg2; transcrip 86.7
3nrg_A 217 TETR family transcriptional regulator; structural 86.64
2o0y_A 260 Transcriptional regulator; ICLR-family, structural 86.62
3ccy_A 203 Putative TETR-family transcriptional regulator; AP 86.56
3tqn_A113 Transcriptional regulator, GNTR family; regulatory 86.53
2g9w_A138 Conserved hypothetical protein; DNA-binding domain 86.48
2g7u_A 257 Transcriptional regulator; ICLR family, structural 86.4
2g7l_A 243 TETR-family transcriptional regulator; APC6062, pr 86.21
3f6v_A151 Possible transcriptional regulator, ARSR family pr 86.21
2np3_A 212 Putative TETR-family regulator; transcriptional re 86.08
2fd5_A 180 Transcriptional regulator; DNA-binding protein, st 86.07
3on2_A 199 Probable transcriptional regulator; protein struct 85.97
3fiw_A 211 Putative TETR-family transcriptional regulator; TE 85.96
2vn2_A128 DNAD, chromosome replication initiation protein; D 85.96
3isp_A 303 HTH-type transcriptional regulator RV1985C/MT2039; 85.84
3lsj_A 220 DEST; transcriptional repressor, TETR family, DNA- 85.83
3neu_A125 LIN1836 protein; structural genomics, PSI-2, prote 85.83
3plo_X193 DNA-invertase; resolvase, helix-turn-helix, serine 85.8
2vpr_A 207 Tetracycline resistance repressor protein; transcr 85.66
4ac0_A 202 Tetracycline repressor protein class B from trans 85.65
2fbk_A181 Transcriptional regulator, MARR family; winged-hel 85.43
2y75_A129 HTH-type transcriptional regulator CYMR; DNA bindi 85.27
2fsw_A107 PG_0823 protein; alpha-beta structure, helix-turn- 85.27
3gbg_A276 TCP pilus virulence regulatory protein; cupin, hel 85.26
1fx7_A 230 Iron-dependent repressor IDER; DTXR, iron-dependen 85.15
3mq0_A 275 Transcriptional repressor of the blcabc operon; he 84.87
3r4k_A 260 Transcriptional regulator, ICLR family; DNA/RNA-bi 84.83
>2jvl_A TRMBF1; coactivator, helix-turn-helix, Pro binding, transcription; NMR {Trichoderma reesei} Back     alignment and structure
Probab=99.75  E-value=7.4e-18  Score=96.74  Aligned_cols=76  Identities=30%  Similarity=0.488  Sum_probs=66.7

Q ss_pred             chhhhhhhccCCCCCCC--------HHHHHHHHH--hCCCCHHHHHHHhCCCHHHHHHHHcCCCCCCHHHHHHHHHHhCC
Q 038591            5 GAVINMRKLDEGTEPDT--------PRQIQRARL--GKKMSQPDLANQINQRPQVVSEYENGKAVPNQTVLAKMEKAIGV   74 (82)
Q Consensus         5 ~~~~~~~~~~~~~~~~~--------~~~lk~~r~--~~g~s~~elA~~~gis~~~i~~~e~g~~~p~~~~~~~la~~lgv   74 (82)
                      ..+++..+++.....+.        +.+|+.+|.  ..|+||.+||+.+|+|+++|++||+|...|+.+.+.+||++|||
T Consensus        11 ~~~~~~~~~d~~~~~~~~~~~~~~~g~~lk~~R~~~~~glsq~elA~~~gis~~~is~~E~G~~~p~~~~l~~ia~~l~v   90 (107)
T 2jvl_A           11 TEGQRLTKVDRSDDIIKPKTVGKEVGKAIEQGRQKFEPTMTQAELGKEIGETAATVASYERGTATPDQNILSKMERVLNV   90 (107)
T ss_dssp             CCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHTTSSSCCCHHHHHHHHTCCHHHHHHHTTTCSCCCHHHHHHHHHTTTC
T ss_pred             CcccccccccccccccCHHHHHHHHHHHHHHHHHHHHcCCCHHHHHHHHCcCHHHHHHHHcCCCCCCHHHHHHHHHHHCc
Confidence            34566666666555432        899999999  99999999999999999999999999999999999999999999


Q ss_pred             CCcccc
Q 038591           75 KLRVKI   80 (82)
Q Consensus        75 ~~~e~~   80 (82)
                      ++++.+
T Consensus        91 ~~~e~~   96 (107)
T 2jvl_A           91 KLRGAN   96 (107)
T ss_dssp             BSSSSS
T ss_pred             CHhhhc
Confidence            999865



>2ewt_A BLDD, putative DNA-binding protein; the DNA-binding domain of BLDD; 1.81A {Streptomyces coelicolor} Back     alignment and structure
>3qq6_A HTH-type transcriptional regulator SINR; helix-turn-helix motif, biofilm, repressor, SINI; 1.90A {Bacillus subtilis} Back     alignment and structure
>3s8q_A R-M controller protein; protein-DNA complex, helix-turn-helix; HET: DNA; 2.10A {Enterobacter SP} SCOP: a.35.1.0 PDB: 3clc_A* 3ufd_A* Back     alignment and structure
>3omt_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; 1.65A {Cytophaga hutchinsonii} Back     alignment and structure
>3kz3_A Repressor protein CI; five helix bundle, DNA-binding, transcription, transcription regulation; 1.64A {Enterobacteria phage lambda} Back     alignment and structure
>3g5g_A Regulatory protein; transcriptional regulator, helix-turn-helix, restriction- modification, transcription regulator; 2.80A {Enterobacter SP} PDB: 3fya_A Back     alignment and structure
>1y7y_A C.AHDI; helix-turn-helix, DNA-binding protein, transcriptional regulator, transcription regulator; 1.69A {Aeromonas hydrophila} SCOP: a.35.1.3 Back     alignment and structure
>3f6w_A XRE-family like protein; helix-turn-helix, DNA binding protein, xenobiotic response E family of transcriptional regulators; HET: MSE BTB; 1.85A {Pseudomonas syringae PV} Back     alignment and structure
>3lfp_A CSP231I C protein; transcriptional regulator, DNA binding protein, helix-turn-H restriction-modification, transcription; 2.00A {Citrobacter SP} PDB: 3lis_A Back     alignment and structure
>2r1j_L Repressor protein C2; protein-DNA complex, helix-turn-helix, DNA-binding, transcription, transcription regulation; 1.53A {Enterobacteria phage P22} SCOP: a.35.1.2 PDB: 3jxb_C 3jxc_L 3jxd_L Back     alignment and structure
>2k9q_A Uncharacterized protein; all helix, helix-turn-helix, plasmid, structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides thetaiotaomicron} Back     alignment and structure
>3b7h_A Prophage LP1 protein 11; structural genomics, PSI2, MCSG, protein structure initiative, midwest center for structural genomics; 2.00A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>2b5a_A C.BCLI; helix-turn-helix motif, gene regulation; 1.54A {Bacillus caldolyticus} SCOP: a.35.1.3 Back     alignment and structure
>3op9_A PLI0006 protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG, transcription regulat; HET: MSE; 1.90A {Listeria innocua} Back     alignment and structure
>3ivp_A Putative transposon-related DNA-binding protein; APC62618, clostridium diffic structural genomics, PSI-2, protein structure initiative; HET: PG4; 2.02A {Clostridium difficile} Back     alignment and structure
>1x57_A Endothelial differentiation-related factor 1; HMBF1alpha, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.35.1.12 Back     alignment and structure
>1adr_A P22 C2 repressor; transcription regulation; NMR {Enterobacteria phage P22} SCOP: a.35.1.2 Back     alignment and structure
>2kpj_A SOS-response transcriptional repressor, LEXA; NESG, GFT, structural genomics, PSI-2, protein structure initiative; NMR {Eubacterium rectale atcc 33656} Back     alignment and structure
>3vk0_A NHTF, transcriptional regulator; HTH motif, XRE transcription factor, DNA binding protein; 1.88A {Neisseria meningitidis} Back     alignment and structure
>3eus_A DNA-binding protein; structural genomics, PSI2,MCSG, protein structure initiative, midwest center for structural genomic binding; 1.80A {Silicibacter pomeroyi} Back     alignment and structure
>3trb_A Virulence-associated protein I; mobIle and extrachromosomal element functions, DNA binding P; 2.00A {Coxiella burnetii} Back     alignment and structure
>2xi8_A Putative transcription regulator; HTH DNA-binding motif; HET: GOL; 1.21A {Enterococcus faecalis} PDB: 2gzu_A 1utx_A* 2xj3_A 2xiu_A Back     alignment and structure
>3bs3_A Putative DNA-binding protein; XRE-family, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.65A {Bacteroides fragilis} Back     alignment and structure
>3mlf_A Transcriptional regulator; structural genomics, helix-turn-helix XRE-family like protei transcription regulator, PSI-2; 2.60A {Staphylococcus aureus subsp} Back     alignment and structure
>1lmb_3 Protein (lambda repressor); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 1.80A {Enterobacteria phage lambda} SCOP: a.35.1.2 PDB: 1lrp_A 1rio_A 1lli_A* Back     alignment and structure
>2wiu_B HTH-type transcriptional regulator HIPB; transferase transcription complex, serine kinase, DNA-bindin mercury derivative, repressor; 2.35A {Escherichia coli} PDB: 3dnv_B* 3dnw_B* 3hzi_B* Back     alignment and structure
>3fmy_A HTH-type transcriptional regulator MQSA (YGIT/B3021); helix-turn-helix, DNA-binding, transcription regulation, DNA binding protein; HET: MEQ; 1.40A {Escherichia coli k-12} Back     alignment and structure
>3f52_A CLP gene regulator (CLGR); helix-turn-helix motif, transcriptional ACTI human pathogen, transcription activator; 1.75A {Corynebacterium glutamicum} PDB: 3f51_A Back     alignment and structure
>2a6c_A Helix-turn-helix motif; putative transcriptional regulator, structural genomics, JOI for structural genomics, JCSG; HET: CIT; 1.90A {Nitrosomonas europaea} SCOP: a.35.1.13 Back     alignment and structure
>1r69_A Repressor protein CI; gene regulating protein; 2.00A {Phage 434} SCOP: a.35.1.2 PDB: 1pra_A 1per_L 1rpe_L* 2or1_L* 1r63_A 2r63_A 1sq8_A Back     alignment and structure
>3cec_A Putative antidote protein of plasmid maintenance; structural genomics, joint center for structural genomics, J protein structure initiative; HET: MSE; 1.60A {Nostoc punctiforme} Back     alignment and structure
>1b0n_A Protein (SINR protein); transcription regulator, antagonist, sporulation; 1.90A {Bacillus subtilis} SCOP: a.34.1.1 a.35.1.3 PDB: 2yal_A Back     alignment and structure
>4ghj_A Probable transcriptional regulator; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: MSE; 1.75A {Vibrio vulnificus} Back     alignment and structure
>2ict_A Antitoxin HIGA; helix-turn-helix, structural genomics, PSI-2, protein struct initiative, northeast structural genomics consortium, NESG; 1.63A {Escherichia coli} SCOP: a.35.1.3 PDB: 2icp_A Back     alignment and structure
>1zug_A Phage 434 CRO protein; gene regulating protein, transcription regulation; NMR {Phage 434} SCOP: a.35.1.2 PDB: 2cro_A 3cro_L* Back     alignment and structure
>3fym_A Putative uncharacterized protein; HTH DNA binding, DNA binding protein; 1.00A {Staphylococcus aureus subsp} Back     alignment and structure
>2ef8_A C.ECOT38IS, putative transcription factor; helix-turn-helix, DNA binding protein, transcription regulator; HET: CME; 1.95A {Enterobacteria phage P2} Back     alignment and structure
>2wus_R RODZ, putative uncharacterized protein; structural protein, cell WALL morphogenesis, bacterial cytos bacterial actin; 2.90A {Thermotoga maritima} Back     alignment and structure
>2l49_A C protein; P2 bacteriophage, P2 C, direct repeats, DNA-binding protein, binding protein; NMR {Enterobacteria phage P2} PDB: 2xcj_A Back     alignment and structure
>2o38_A Hypothetical protein; alpha-beta, helix-turn-helix, structural genomics, PSI-2, PR structure initiative; 1.83A {Rhodopseudomonas palustris} SCOP: a.35.1.13 Back     alignment and structure
>2ppx_A AGR_C_3184P, uncharacterized protein ATU1735; HTH-motif, XRE-family, structural genomics, PSI-2, protein structure initiative; 2.00A {Agrobacterium tumefaciens str} SCOP: a.35.1.3 Back     alignment and structure
>2eby_A Putative HTH-type transcriptional regulator YBAQ; hypothetical protein, JW0472, structural genomics, NPPSFA; 2.25A {Escherichia coli} Back     alignment and structure
>1y9q_A Transcriptional regulator, HTH_3 family; transcriptional regulaator, strucutral genomics, protein structure initiative, PSI; 1.90A {Vibrio cholerae} SCOP: a.35.1.8 b.82.1.15 Back     alignment and structure
>3kxa_A NGO0477 protein, putative uncharacterized protein; NEW protein fold, OPPF, STRU genomics, oxford protein production facility; 2.80A {Neisseria gonorrhoeae} Back     alignment and structure
>2bnm_A Epoxidase; oxidoreductase, cupin, HTH, cation-dependant, zinc, fosfomycin; 1.7A {Streptomyces wedmorensis} SCOP: a.35.1.3 b.82.1.10 PDB: 1zz7_A 1zz8_A 1zz9_A 1zzb_A 1zz6_A 1zzc_A 2bnn_A 2bno_A 3scf_A 3scg_A 3sch_A Back     alignment and structure
>2ofy_A Putative XRE-family transcriptional regulator; transcription regulator, structural genomics, PS protein structure initiative; 1.70A {Rhodococcus SP} SCOP: a.35.1.3 Back     alignment and structure
>3bd1_A CRO protein; transcription factor, helix-turn-helix, prophage, structural evolution, transcription; 1.40A {Xylella fastidiosa} Back     alignment and structure
>3r1f_A ESX-1 secretion-associated regulator ESPR; helix-turn-helix, transcription factor, helix-turn-helix transcription factor; 2.50A {Mycobacterium tuberculosis} Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>3qwg_A ESX-1 secretion-associated regulator ESPR; N-terminal helix-turn-helix motif, transcription factor, transcription; 1.99A {Mycobacterium tuberculosis} PDB: 3qf3_A 3qyx_A Back     alignment and structure
>3pxp_A Helix-turn-helix domain protein; DNA-binding, basic helix-loop-helix motif, BHLH motif, lambd repressor-like DNA-binding fold; HET: MSE MYR; 2.30A {Chloroflexus aurantiacus} Back     alignment and structure
>3o9x_A Uncharacterized HTH-type transcriptional regulato; HTH-XRE DNA binding motif, transcriptional regulator, bacter antitoxin, Zn binding protein, transcription regulator-DNA; HET: DNA; 2.10A {Escherichia coli} PDB: 3gn5_A* 3gn5_B* 2kz8_A Back     alignment and structure
>2awi_A PRGX; repressor, pheromone, DNA binding, regulatory domain, transcription; 2.25A {Enterococcus faecalis} SCOP: a.35.1.11 a.118.8.4 PDB: 2axv_A 2axu_A 2aw6_A 2axz_A 2grl_A 2grm_A Back     alignment and structure
>4ich_A Transcriptional regulator; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, transcription RE; 1.95A {Saccharomonospora viridis} Back     alignment and structure
>1neq_A DNA-binding protein NER; NMR {Enterobacteria phage MU} SCOP: a.35.1.2 PDB: 1ner_A Back     alignment and structure
>2p5t_A Putative transcriptional regulator PEZA; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae} Back     alignment and structure
>3bdn_A Lambda repressor; repressor, allostery; HET: DNA; 3.91A {Enterobacteria phage lambda} Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>2l1p_A DNA-binding protein SATB1; PSI-biology, NESG, structural genomics, protein structure in northeast structural genomics consortium; NMR {Homo sapiens} PDB: 3nzl_A* Back     alignment and structure
>2fjr_A Repressor protein CI; genetic switch, regulation, cooperativity, transcription regulator; 1.95A {Enterobacteria phage 186} PDB: 2fkd_A Back     alignment and structure
>2auw_A Hypothetical protein NE0471; alpha-beta structure, structural genomics, PSI, protein STRU initiative; 1.85A {Nitrosomonas europaea} SCOP: a.35.1.10 d.331.1.1 Back     alignment and structure
>1dw9_A Cyanate lyase; cyanate degradation, structural genomics, PSI, protei structure initiative, midwest center for structural genomic; HET: SO4; 1.65A {Escherichia coli} SCOP: a.35.1.4 d.72.1.1 PDB: 1dwk_A* 2ivq_A 2ivb_A 2iu7_A 2iv1_A 2iuo_A 2ivg_A Back     alignment and structure
>1nr3_A MTH0916, DNA-binding protein TFX; northeast structural genomics consortium, reduced- dimensionality PSI; NMR {Methanothermobacterthermautotrophicus} SCOP: d.236.1.1 Back     alignment and structure
>1rzs_A Antirepressor, regulatory protein CRO; helix-turn-helix, DNA-binding protein, structural evolution, transcription; NMR {Enterobacteria phage P22} SCOP: a.35.1.2 Back     alignment and structure
>1uxc_A FRUR (1-57), fructose repressor; DNA-binding protein, LACI family, transc regulation; NMR {Escherichia coli} SCOP: a.35.1.5 PDB: 1uxd_A Back     alignment and structure
>2l8n_A Transcriptional repressor CYTR; bacterial gene repressor, helix turn helix binding domain, L family, transcription regulation, binding protein; NMR {Escherichia coli} PDB: 2lcv_A Back     alignment and structure
>1zx4_A P1 PARB, plasmid partition PAR B protein, PARB; translation; HET: CIT; 2.98A {Enterobacteria phage P1} PDB: 2ntz_A Back     alignment and structure
>3g7d_A PHPD; non heme Fe(II) dioxygenase, cupin, biosynthetic protein; 1.80A {Streptomyces viridochromogenes} PDB: 3gbf_A 3rzz_A Back     alignment and structure
>1s4k_A Putative cytoplasmic protein YDIL; structural genomics, MCSG, PSI, PROT structure initiative; 1.90A {Salmonella typhimurium} SCOP: a.35.1.6 Back     alignment and structure
>2h8r_A Hepatocyte nuclear factor 1-beta; trasncription factor, POU, homeo, protein-DNA, human disease; 3.20A {Homo sapiens} Back     alignment and structure
>2pij_A Prophage PFL 6 CRO; transcription factor, helix-turn-helix, structural evolution, transcription; 1.70A {Pseudomonas fluorescens} Back     alignment and structure
>1ic8_A Hepatocyte nuclear factor 1-alpha; transcription regulation, DNA-binding, POU domain, diabetes, disease mutation, MODY3, transcription/DNA comple; 2.60A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 Back     alignment and structure
>2hin_A GP39, repressor protein; transcription factor, dimer interface, helix-turn-helix; 1.05A {Enterobacteria phage N15} PDB: 3qws_A Back     alignment and structure
>2l0k_A Stage III sporulation protein D; SPOIIID, solution structure, DNA binding, bacillus subti transcription factor, transcription; NMR {Bacillus subtilis} Back     alignment and structure
>2cw1_A SN4M; lambda CRO fold, de novo protein; NMR {Synthetic} SCOP: k.46.1.1 Back     alignment and structure
>1zs4_A Regulatory protein CII; helix-turn-helix, transcription activator, transcription-DNA; HET: DNA; 1.70A {Enterobacteria phage lambda} SCOP: a.35.1.9 Back     alignment and structure
>1jhf_A LEXA repressor; LEXA SOS repressor, hydrolase; 1.80A {Escherichia coli} SCOP: a.4.5.2 b.87.1.1 PDB: 1jhh_A 3jso_A* 3jsp_A* 3k3r_E* 1jhc_A 1jhe_A 1lea_A 1leb_A Back     alignment and structure
>1xwr_A Regulatory protein CII; all-alpha fold, DNA binding protein; 2.56A {Bacteriophage lambda} SCOP: a.35.1.9 PDB: 1zpq_A Back     alignment and structure
>2ao9_A Phage protein; structural genomics, nine-fold NCS., PSI, protein structure initiative, midwest center for structural genomics, MCSG, U function; 1.90A {Bacillus cereus} SCOP: a.4.1.17 Back     alignment and structure
>2x48_A CAG38821; archeal virus, viral protein; 2.60A {Sulfolobus islandicus rod-shaped virusorganism_taxid} Back     alignment and structure
>2hsg_A Glucose-resistance amylase regulator; CCPA, transcriptional regulator, transcription regulator; 2.50A {Bacillus megaterium} SCOP: a.35.1.5 c.93.1.1 PDB: 1rzr_G 2jcg_A 1zvv_A 3oqo_A* 3oqm_A* 3oqn_A* Back     alignment and structure
>1qpz_A PURA, protein (purine nucleotide synthesis repressor); transcription regulation, DNA-binding, purine biosynthesis; HET: DNA HPA; 2.50A {Escherichia coli} SCOP: a.35.1.5 c.93.1.1 PDB: 1bdi_A* 1qp0_A* 1qp4_A* 1pnr_A* 1wet_A* 1zay_A* 1vpw_A* 2pue_A* 2puf_A* 2pug_A* 1bdh_A* 1qp7_A* 1qqa_A* 1qqb_A* 2puc_A* 2pua_A* 2pub_A* 2pud_A* 1jfs_A* 1jh9_A* ... Back     alignment and structure
>3kjx_A Transcriptional regulator, LACI family; LACL family, protein structure initiative II(PSI II), NYSGXRC, structural genomics; 2.33A {Silicibacter pomeroyi} Back     alignment and structure
>1tc3_C Protein (TC3 transposase); DNA binding, helix-turn-helix, TC1/mariner family, complex (transposase/DNA), DNA binding protein/DNA complex; HET: DNA; 2.45A {Caenorhabditis elegans} SCOP: a.4.1.2 Back     alignment and structure
>1jhg_A Trp operon repressor; complex (regulatory protein-peptide), DNA-binding regulatory complex (regulatory protein-peptide) complex; HET: TRP; 1.30A {Escherichia coli} SCOP: a.4.12.1 PDB: 1co0_A* 1mi7_R 1p6z_R 1wrp_R* 1zt9_A* 2oz9_R* 3ssw_R 3wrp_A 1rcs_A* 1wrs_R* 1wrt_R 2xdi_A 3ssx_R* 1trr_A* 1tro_A* Back     alignment and structure
>3h5t_A Transcriptional regulator, LACI family; DNA-dependent, protein structure initiative II(PSI II), NYSGXRC, 11232D), structural genomics; 2.53A {Corynebacterium glutamicum} Back     alignment and structure
>1jko_C HIN recombinase, DNA-invertase HIN; water-mediated recognition, protein-DNA complex, A10G mutant, DNA binding protein/DNA complex; 2.24A {Synthetic} SCOP: a.4.1.2 PDB: 1ijw_C* 1jj6_C* 1jj8_C* 1hcr_A 1jkp_C 1jkq_C 1jkr_C Back     alignment and structure
>2w7n_A TRFB transcriptional repressor protein; INCP, plasmid, repressor, DNA-binding, transcription/DNA; HET: BRU; 1.85A {Escherichia coli} Back     alignment and structure
>2ovg_A Phage lambda CRO; transcription factor, helix-turn-helix, bacteriophage, flexi transcription; 1.35A {Enterobacteria phage lambda} PDB: 2ecs_A 1cop_D 4cro_A* 5cro_O 1orc_A 2orc_A 2a63_A 1d1l_A 6cro_A* 3orc_A* 1d1m_B Back     alignment and structure
>2o20_A Catabolite control protein A; CCPA, transcriptional regulator, helix-turn-helix, transcrip; 1.90A {Lactococcus lactis} Back     alignment and structure
>1j9i_A GPNU1 DBD;, terminase small subunit; DNA binding domain, homodimer, viral assembly, winged helix-turn-helix, viral protein; NMR {Enterobacteria phage lambda} SCOP: a.6.1.5 Back     alignment and structure
>3dbi_A Sugar-binding transcriptional regulator, LACI FAM; structural genomics, sugar-binding transcriptional regulator structure initiative, PSI-2; HET: MSE; 2.45A {Escherichia coli K12} Back     alignment and structure
>2csf_A DNA-binding protein SATB2; CUT domain, special AT-rich sequence-binding protein 2, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.35.1.7 Back     alignment and structure
>3h5o_A Transcriptional regulator GNTR; transcription regulator, GNTR,chromobacterium violaceum, PSI, SGX, DNA-binding; 2.30A {Chromobacterium violaceum} Back     alignment and structure
>1x3u_A Transcriptional regulatory protein FIXJ; helix-turn-helix; NMR {Sinorhizobium meliloti} Back     alignment and structure
>3e3m_A Transcriptional regulator, LACI family; structural genomics, DNA-binding, plasmid, transcription regulation, PSI-2; 1.60A {Silicibacter pomeroyi} Back     alignment and structure
>3jvd_A Transcriptional regulators; structural genomics, PSI-2, sugar binding protein, transcrip regulation, protein structure initiative; 2.30A {Corynebacterium glutamicum} Back     alignment and structure
>3me5_A Cytosine-specific methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 1.75A {Shigella flexneri 2A} PDB: 3lx6_A Back     alignment and structure
>3ctp_A Periplasmic binding protein/LACI transcriptional; structural genomics, protein structure initiative; HET: XLF; 1.41A {Alkaliphilus metalliredigens} Back     alignment and structure
>3e7l_A Transcriptional regulator (NTRC family); sigma43 activator, AAA+ ATPase, response regulator, transcriptional activator, ATP-binding; 2.25A {Aquifex aeolicus} PDB: 4fth_A Back     alignment and structure
>2jn6_A Protein CGL2762, transposase; GFT PSI-2, protein structure, structural genomics, protein structure initiative; NMR {Corynebacterium glutamicum} SCOP: a.4.1.19 Back     alignment and structure
>1jye_A Lactose operon repressor; gene regulation, protein stability, protein DNA-binding, transcription; 1.70A {Escherichia coli} SCOP: c.93.1.1 PDB: 1lbi_A 1lbg_A* 1lbh_A 1jyf_A 3edc_A 1efa_A* 1jwl_A* 2pe5_A* 1tlf_A* 2p9h_A* 2paf_A* 1cjg_A* 1l1m_A 1osl_A 2kei_A* 2kej_A* 2kek_A* 2bjc_A 1lqc_A 1lcc_A* ... Back     alignment and structure
>1qgp_A Protein (double stranded RNA adenosine deaminase); Z-alpha-Z-DNA binding domain, RNA-editing, Z-DNA recognition, ADAR1, helix- turn-helix; NMR {Homo sapiens} SCOP: a.4.5.19 Back     alignment and structure
>2elh_A CG11849-PA, LD40883P; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Drosophila melanogaster} Back     alignment and structure
>2htj_A P fimbrial regulatory protein KS71A; winged helix-turn-helix, PAP PILI, transcription activator; NMR {Escherichia coli} SCOP: a.4.5.73 Back     alignment and structure
>1qbj_A Protein (double-stranded RNA specific adenosine D (ADAR1)); protein-Z-DNA complex, hydrolase-DNA complex; HET: DNA; 2.10A {Homo sapiens} SCOP: a.4.5.19 PDB: 3f21_A* 3f22_A* 3f23_A* 3irr_A* 3irq_D* 2gxb_A 2acj_A 2l54_A Back     alignment and structure
>2glo_A Brinker CG9653-PA; protein-DNA complex, helix-turn-helix motif, transcription/DNA complex; NMR {Drosophila melanogaster} Back     alignment and structure
>3bil_A Probable LACI-family transcriptional regulator; structural genomics, unknown function, PSI-2, protein structure initiative; 2.50A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>1z4h_A TORI, TOR inhibition protein; winged helix, reverse turn, protein binding, DNA binding protein; NMR {Escherichia coli} Back     alignment and structure
>1g2h_A Transcriptional regulatory protein TYRR homolog; protein structure, , DNA-binding domain, helix- turn-helix motif; NMR {Haemophilus influenzae} SCOP: a.4.1.12 Back     alignment and structure
>1hlv_A CENP-B, major centromere autoantigen B; helix-turn-helix, protein-DNA complex, riken structural genomics/proteomics initiative, RSGI; 2.50A {Homo sapiens} SCOP: a.4.1.7 a.4.1.7 PDB: 1bw6_A Back     alignment and structure
>2p7v_B Sigma-70, RNA polymerase sigma factor RPOD; RSD, regulator of sigma 70, sigma 70 domain 4, transcription, regulation, helix-turn-helix; 2.60A {Escherichia coli} SCOP: a.4.13.2 Back     alignment and structure
>1e3o_C Octamer-binding transcription factor 1; transcription factor, POU domain, dimer, DNA binding; 1.9A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 PDB: 1gt0_C 1hf0_A* 1cqt_A* 1o4x_A 1oct_C* 1pou_A 1pog_A 1hdp_A Back     alignment and structure
>1pdn_C Protein (PRD paired); protein-DNA complex, double helix, PAX, paired domain, DNA-binding protein, gene regulation/DNA complex; HET: DNA; 2.50A {Drosophila melanogaster} SCOP: a.4.1.5 Back     alignment and structure
>2jml_A DNA binding domain/transcriptional regulator; anti-repressor, MERR, carotenogenesis; HET: DNA; NMR {Myxococcus xanthus} Back     alignment and structure
>1u78_A TC3 transposase, transposable element TC3 transposase; transposon DNA, bipartite DNA-binding, HTH- motif, DNA binding protein/DNA complex; 2.69A {Caenorhabditis elegans} SCOP: a.4.1.2 a.4.1.2 Back     alignment and structure
>2heo_A Z-DNA binding protein 1; protein DLM1-Z-DNA complex, immune system-DNA complex; 1.70A {Mus musculus} PDB: 1j75_A Back     alignment and structure
>2o8x_A Probable RNA polymerase sigma-C factor; promoter recognition, transcription regulation, helix-turn-H motif, transcription; 3.00A {Mycobacterium tuberculosis} Back     alignment and structure
>2jpc_A SSRB; DNA binding protein, structural genomics, PSI-2, protein structure initiative; NMR {Salmonella typhimurium} Back     alignment and structure
>2xsd_C POU domain, class 3, transcription factor 1; transcription-DNA complex, SOX; 2.05A {Mus musculus} Back     alignment and structure
>1au7_A Protein PIT-1, GHF-1; complex (DNA-binding protein/DNA), pituitary, CPHD, POU domain, transcription factor, transcription/DNA complex; HET: DNA; 2.30A {Rattus norvegicus} SCOP: a.4.1.1 a.35.1.1 Back     alignment and structure
>1r71_A Transcriptional repressor protein KORB; INCP, plasmid partitioning, protein-DNA complex, heilx-turn- helix motif, transcription factor; HET: BRU; 2.20A {Escherichia coli} SCOP: a.4.14.1 Back     alignment and structure
>1je8_A Nitrate/nitrite response regulator protein NARL; protein-DNA complex, two-component response regulator, helix-turn-helix, DNA bending; 2.12A {Escherichia coli} SCOP: a.4.6.2 PDB: 1zg1_A 1zg5_A Back     alignment and structure
>3hug_A RNA polymerase sigma factor; ECF sigma factor, zinc binding anti-sigma factor, oxidative transcription regulation; 2.35A {Mycobacterium tuberculosis} Back     alignment and structure
>1ntc_A Protein (nitrogen regulation protein (NTRC)); helix-turn-helix, FIS, four-helix bundle, transcription regulation; NMR {Salmonella typhimurium} SCOP: a.4.1.12 Back     alignment and structure
>2vz4_A Tipal, HTH-type transcriptional activator TIPA; transcription, resistance, antibiotic; 2.90A {Streptomyces lividans} Back     alignment and structure
>1k78_A Paired box protein PAX5; paired domain, ETS domain, transcription factor, transcription/DNA complex; 2.25A {Homo sapiens} SCOP: a.4.1.5 a.4.1.5 PDB: 1mdm_A 6pax_A Back     alignment and structure
>2dk5_A DNA-directed RNA polymerase III 39 kDa polypeptide; structural genomics, winged helix domain, NPPSFA; NMR {Homo sapiens} SCOP: a.4.5.85 Back     alignment and structure
>1ku3_A Sigma factor SIGA; helix-turn-helix, transcription; 1.80A {Thermus aquaticus} SCOP: a.4.13.2 PDB: 1ku7_A 1rio_H 3n97_A* Back     alignment and structure
>1xn7_A Hypothetical protein YHGG; alpha+beta, GFT structural genomics, protein structure initiative, PSI, NESG; NMR {Escherichia coli} SCOP: a.4.5.62 Back     alignment and structure
>2w48_A Sorbitol operon regulator; SORC, activator, repressor, DNA-binding, transcription, transcription regulator, transcription regulation; 3.20A {Klebsiella pneumoniae} Back     alignment and structure
>3ulq_B Transcriptional regulatory protein COMA; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} PDB: 2krf_A Back     alignment and structure
>2ox6_A Hypothetical protein SO3848; structural genomics, PSI-2, MCSG, Pro structure initiative; 1.70A {Shewanella oneidensis} SCOP: a.35.1.6 Back     alignment and structure
>1vz0_A PARB, chromosome partitioning protein PARB; nuclear protein, chromosome segregation, DNA-binding, helix-turn-helix; 2.3A {Thermus thermophilus} SCOP: a.4.14.1 d.268.1.1 Back     alignment and structure
>1x2l_A CUT-like 2, homeobox protein CUX-2; CUT domain, human homeobox protein CUX-2, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.35.1.7 Back     alignment and structure
>1wh6_A CUT-like 2, homeobox protein CUX-2; CUT domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, transcription; NMR {Homo sapiens} SCOP: a.35.1.7 Back     alignment and structure
>1fse_A GERE; helix-turn-helix DNA-binding protein transcriptional regulat transcription; 2.05A {Bacillus subtilis} SCOP: a.4.6.2 Back     alignment and structure
>3kor_A Possible Trp repressor; putative DNA-binding Trp repressor, TRPR like protein, struc genomics, transcription; 1.60A {Staphylococcus aureus} Back     alignment and structure
>2o4a_A DNA-binding protein SATB1; protein-DNA complex, transcription, transcription/DNA complex; HET: DNA; 1.75A {Homo sapiens} SCOP: a.35.1.7 PDB: 2o49_A* Back     alignment and structure
>1eto_A FIS, factor for inversion stimulation; transcriptional activation region, DNA-binding protein, transcription activator; 1.90A {Escherichia coli} SCOP: a.4.1.12 PDB: 1etq_A 1ety_A 1fia_A 3fis_A 3iv5_A* 3jr9_A* 3jra_A* 3jrb_A* 3jrc_A* 3jrd_A* 3jre_A* 3jrf_A* 3jrg_A* 3jrh_A* 3jri_A* 1f36_A 1etv_A 1etk_A 1etx_A 1fip_A ... Back     alignment and structure
>1tty_A Sigma-A, RNA polymerase sigma factor RPOD; helix-turn-helix, transcription; NMR {Thermotoga maritima} SCOP: a.4.13.2 Back     alignment and structure
>1sfx_A Conserved hypothetical protein AF2008; structural genomics, HTH MOT protein structure initiative, midwest center for structural genomics; 1.55A {Archaeoglobus fulgidus} SCOP: a.4.5.50 Back     alignment and structure
>1r8d_A Transcription activator MTAN; protein-DNA complex, transcription/DNA complex; 2.70A {Bacillus subtilis} SCOP: a.6.1.3 PDB: 1jbg_A Back     alignment and structure
>2d1h_A ST1889, 109AA long hypothetical transcriptional regulator; helix-turn-helix, intermolecular and intramolecular S-S bond structural genomics; 2.05A {Sulfolobus tokodaii} SCOP: a.4.5.50 Back     alignment and structure
>2k27_A Paired box protein PAX-8; paired domain, solution structure, triple frequency, 3D NMR, induced FIT, alternative splicing, developmental protein; NMR {Homo sapiens} Back     alignment and structure
>2rn7_A IS629 ORFA; helix, all alpha, unknown function, structural genomics, PSI-2, protein structure initiative; NMR {Shigella flexneri} Back     alignment and structure
>3r0a_A Putative transcriptional regulator; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.31A {Methanosarcina mazei} Back     alignment and structure
>1oyi_A Double-stranded RNA-binding protein; (alpha+beta) helix-turn-helix, viral protein; NMR {Vaccinia virus} SCOP: a.4.5.19 Back     alignment and structure
>3c57_A Two component transcriptional regulatory protein; response regulator, two-component regulatory system, DNA-BIN protein; 1.70A {Mycobacterium tuberculosis} PDB: 1zlk_A 1zlj_A Back     alignment and structure
>1s7o_A Hypothetical UPF0122 protein SPY1201/SPYM3_0842/SPS1042/SPYM18_1152; putative DNA binding protein, structural genomics; 2.31A {Streptococcus pyogenes serotype M3} SCOP: a.4.13.3 Back     alignment and structure
>2k02_A Ferrous iron transport protein C; FEOC, iron-sulfur, metal-binding, metal binding protein; NMR {Klebsiella pneumoniae subsp} Back     alignment and structure
>3cuo_A Uncharacterized HTH-type transcriptional regulato; DNA-binding transcriptional regulator, structural genomics, MCSG; 2.00A {Escherichia coli K12} Back     alignment and structure
>2o3f_A Putative HTH-type transcriptional regulator YBBH; APC85504, putative transcriptional regulator YBBH; HET: MLY; 1.75A {Bacillus subtilis} SCOP: a.4.1.20 Back     alignment and structure
>2cfx_A HTH-type transcriptional regulator LRPC; transcriptional regulation, DNA binding, FFRP; 2.4A {Bacillus subtilis} SCOP: a.4.5.32 d.58.4.2 Back     alignment and structure
>3d1n_I POU domain, class 6, transcription factor 1; protein-DNA complex, helix-turn-helix (HTH), DNA-binding, homeobox, nucleus, transcription regulation; 2.51A {Homo sapiens} Back     alignment and structure
>2rnj_A Response regulator protein VRAR; HTH LUXR-type domain, DNA binding domain, activator, antibiotic resistance, cytoplasm, DNA-binding; NMR {Staphylococcus aureus} Back     alignment and structure
>1wiz_A DNA-binding protein SATB2; helix bundle, KIAA1034 protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: a.35.1.7 Back     alignment and structure
>3l1p_A POU domain, class 5, transcription factor 1; POU, transcription factor DNA complex, pore, stem cells; HET: DNA; 2.80A {Mus musculus} PDB: 1ocp_A Back     alignment and structure
>1p4w_A RCSB; solution structure, DNA binding domain, DNA binding protein; NMR {Erwinia amylovora} SCOP: a.4.6.2 Back     alignment and structure
>2jt1_A PEFI protein; solution structure, winged helix-turn-helix, transcripti regulatory protein, structural genomics, PSI-2; NMR {Salmonella typhimurium LT2} Back     alignment and structure
>2w25_A Probable transcriptional regulatory protein; transcription regulation, mutant, RV3291C, Glu104Ala, DNA-binding; 2.15A {Mycobacterium tuberculosis} PDB: 2vbw_A* 2vbx_A* 2vby_A* 2vbz_A* 2vc0_A 2vc1_A 2w24_A 2ivm_A 2w29_A 2qz8_A Back     alignment and structure
>3frw_A Putative Trp repressor protein; structural genomics, APC21159, PSI-2, P structure initiative; 2.05A {Ruminococcus obeum atcc 29174} PDB: 3g1c_A Back     alignment and structure
>2p5k_A Arginine repressor; DNA-binding domain, winged helix-turn-helix (WHTH), DNA binding protein; 1.00A {Bacillus subtilis} SCOP: a.4.5.3 PDB: 2p5l_C* Back     alignment and structure
>2cg4_A Regulatory protein ASNC; DNA binding, FFRP, LRP family, transcription, DNA- binding, transcription regulation; 2.4A {Escherichia coli} SCOP: a.4.5.32 d.58.4.2 Back     alignment and structure
>2pg4_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, DNA binding protein; HET: MSE CIT; 2.21A {Aeropyrum pernix} SCOP: a.4.5.48 Back     alignment and structure
>2p5v_A Transcriptional regulator, LRP/ASNC family; NMB0573, structu genomics; 1.99A {Neisseria meningitidis} PDB: 2p6s_A 2p6t_A Back     alignment and structure
>1ub9_A Hypothetical protein PH1061; helix-turn-helix motif, winged helix motif, structural genom transcription; 2.05A {Pyrococcus horikoshii} SCOP: a.4.5.28 Back     alignment and structure
>2dbb_A Putative HTH-type transcriptional regulator PH006; ASNC family, helix-turn-helix (HTH) domain, structural genom NPPSFA; 2.00A {Pyrococcus horikoshii} Back     alignment and structure
>1q06_A Transcriptional regulator CUER; MERR family transcriptional regulator, copper efflux regulator; 2.07A {Escherichia coli} SCOP: a.6.1.3 PDB: 1q05_A 1q07_A Back     alignment and structure
>1xsv_A Hypothetical UPF0122 protein SAV1236; helix-turn-helix, putative DNA-binding protein, signal recognition particle, unknown function; 1.70A {Staphylococcus aureus subsp} SCOP: a.4.13.3 Back     alignment and structure
>1y0u_A Arsenical resistance operon repressor, putative; structural genomics, protein structure initiative, PSI; HET: MSE; 1.60A {Archaeoglobus fulgidus} SCOP: a.4.5.5 Back     alignment and structure
>3bpv_A Transcriptional regulator; MARR, DNA binding, transcription factor, winged helix motif, DNA-binding; 1.40A {Methanobacterium thermoautotrophicum} PDB: 3bpx_A* Back     alignment and structure
>3hh0_A Transcriptional regulator, MERR family; protein structure initiative II(PSI II), NYSGXRC, 11183J, structural genomics; 2.67A {Bacillus cereus atcc 14579} Back     alignment and structure
>3bdd_A Regulatory protein MARR; putative multiple antibiotic-resistance repressor, structura genomics, joint center for structural genomics, JCSG; 2.20A {Streptococcus suis} Back     alignment and structure
>3nrv_A Putative transcriptional regulator (MARR/EMRR FAM; PSI-2, protein structure initiati structural genomics; HET: MSE; 2.00A {Acinetobacter SP} Back     alignment and structure
>3iwf_A Transcription regulator RPIR family; transcriptional, N-terminal, PSI, MCSG, structural genomics, midwest center structural genomics; 1.40A {Staphylococcus epidermidis} Back     alignment and structure
>3ech_A MEXR, multidrug resistance operon repressor; winged helix, helix-turn-helix, protein-peptide complex; 1.80A {Pseudomonas aeruginosa} SCOP: a.4.5.28 PDB: 1lnw_A 3mex_A Back     alignment and structure
>3g3z_A NMB1585, transcriptional regulator, MARR family; transcription factor, structur genomics, oxford protein production facility; 2.10A {Neisseria meningitidis serogroup B} Back     alignment and structure
>2cyy_A Putative HTH-type transcriptional regulator PH151; structural genomics, pyrococcus horikosii OT3, NPPSFA; HET: MSE GLN; 1.80A {Pyrococcus horikoshii} SCOP: a.4.5.32 d.58.4.2 Back     alignment and structure
>2pn6_A ST1022, 150AA long hypothetical transcriptional regulator; LRP/ASNC family Gln binding, structural genomics, NPPSFA; HET: GLN; 1.44A {Sulfolobus tokodaii} PDB: 2efn_A* 2e7x_A* 2e7w_A* 2yx4_A* 2efq_A* 2pmh_A* 2yx7_A* 2efp_A* 2efo_A* Back     alignment and structure
>1r1u_A CZRA, repressor protein; zinc, DNA binding, transcriptional regulation, winged HTH protein, transcription repressor; 2.00A {Staphylococcus aureus} SCOP: a.4.5.5 PDB: 1r1v_A 2kjb_A 2kjc_A Back     alignment and structure
>3t72_q RNA polymerase sigma factor RPOD, DNA-directed RN polymerase subunit beta; winged-helix motif, transcription activation, DNA-binding; 4.33A {Escherichia coli} PDB: 1tlh_B Back     alignment and structure
>2ia0_A Putative HTH-type transcriptional regulator PF086; ASNC, PSI, structural genomics, southeast collaboratory for structural genomics; 2.37A {Pyrococcus furiosus} Back     alignment and structure
>2nnn_A Probable transcriptional regulator; structural genomics, PSI-2, protein structure initiative, M center for structural genomics, MCSG; 2.40A {Pseudomonas aeruginosa} Back     alignment and structure
>1u2w_A CADC repressor, cadmium efflux system accessory protein; LEAD, SOFT metal ION resistance, ARSR/SM family, DNA binding protein; 1.90A {Staphylococcus aureus} SCOP: a.4.5.5 PDB: 3f72_A Back     alignment and structure
>3mzy_A RNA polymerase sigma-H factor; PSI, MCSG, structural genomics, midwest center for structura genomics, protein structure initiative; 2.50A {Fusobacterium nucleatum subsp} Back     alignment and structure
>1i1g_A Transcriptional regulator LRPA; helix-turn-helix, LRP/ASNC family; 2.90A {Pyrococcus furiosus} SCOP: a.4.5.32 d.58.4.2 Back     alignment and structure
>2hr3_A Probable transcriptional regulator; MCSG, structural genomics, PSI-2, protein structure initiati midwest center for structural genomics; 2.40A {Pseudomonas aeruginosa} SCOP: a.4.5.28 Back     alignment and structure
>3oop_A LIN2960 protein; protein structure initiative, PSI-2, structural genomics, MI center for structural genomics, MCSG, unknown function; 1.78A {Listeria innocua} Back     alignment and structure
>3gp4_A Transcriptional regulator, MERR family; structural genomics, DNA-BI transcription regulator, PSI-2; 1.85A {Listeria monocytogenes str} Back     alignment and structure
>2wte_A CSA3; antiviral protein, viral resistance, winged helix-turn-helix prnai nucleotide-binding domain; HET: MSE; 1.80A {Sulfolobus solfataricus} Back     alignment and structure
>2oz6_A Virulence factor regulator; winged helix, helix-turn-helix, transcription factor, CAMP-B proteins, CAMP receptor protein; HET: CMP; 2.80A {Pseudomonas aeruginosa} SCOP: a.4.5.4 b.82.3.2 Back     alignment and structure
>2oqg_A Possible transcriptional regulator, ARSR family P; winged-helix-turn-helix, structural genomics, PSI-2, protein structure initiative; 1.54A {Rhodococcus SP} Back     alignment and structure
>2a61_A Transcriptional regulator TM0710; APC4350, MCSG, midwest center for structural genomics, PSI, protein structure initiative, MARR; 1.80A {Thermotoga maritima} SCOP: a.4.5.28 Back     alignment and structure
>2rdp_A Putative transcriptional regulator MARR; PFAM PF01047, winged-helix binding motif, structural genomics, PSI-2; 2.30A {Geobacillus stearothermophilus} Back     alignment and structure
>2lkp_A Transcriptional regulator, ARSR family; symmetric homodimer, NI(II) binding protein, DNA binding Pro transcription regulator; NMR {Mycobacterium tuberculosis} Back     alignment and structure
>2fa5_A Transcriptional regulator MARR/EMRR family; multiple antibiotics resistance repressor, XCC structural genomics, X-RAY diffraction; 1.80A {Xanthomonas campestris} Back     alignment and structure
>3ryp_A Catabolite gene activator; CAMP receptor protein (CRP), allostery, DNA binding cyclic A transcription regulator; HET: CMP; 1.60A {Escherichia coli} PDB: 2cgp_A* 3hif_A 1g6n_A* 3ryr_A* 1i5z_A* 1j59_A* 1lb2_A* 1run_A* 1zrc_A* 1zrd_A* 1zre_A* 1zrf_A* 2gzw_A* 2wc2_A 3iyd_G* 3n4m_A* 3qop_A* 3rdi_A* 3rou_A* 3rpq_A* ... Back     alignment and structure
>1on2_A Transcriptional regulator MNTR; helix-turn-helix, DNA-binding protein, metalloregulatory protein; 1.61A {Bacillus subtilis} SCOP: a.4.5.24 a.76.1.1 PDB: 2ev0_A 1on1_A 2ev5_A 2ev6_A* 2f5c_A 2f5d_A 2f5e_A 2f5f_A 2hyf_A* 2hyg_D 3r60_A* 3r61_A* Back     alignment and structure
>2zkz_A Transcriptional repressor PAGR; protein-DNA, HTH motif, dimer, DN binding, transcription regulation; 2.00A {Bacillus anthracis} Back     alignment and structure
>3mky_B Protein SOPB; partition, F plasmid, centromere, DNA binding protein- complex; HET: DNA; 2.86A {Escherichia coli} PDB: 3mkw_B* 3mkz_A* Back     alignment and structure
>3bro_A Transcriptional regulator; helix_TURN_helix, multiple antibiotic resistance protein (MA structural genomics, PSI-2, protein structure initiative; HET: MSE; 2.04A {Oenococcus oeni} SCOP: a.4.5.28 Back     alignment and structure
>2zcw_A TTHA1359, transcriptional regulator, FNR/CRP family; stationary phase, DNA-binding, transcription regulation; 1.50A {Thermus thermophilus} Back     alignment and structure
>4hbl_A Transcriptional regulator, MARR family; HTH, transcription factor, DNA binding; 2.50A {Staphylococcus epidermidis} Back     alignment and structure
>2fbi_A Probable transcriptional regulator; MARR, APC5816, structural genomic protein structure initiative; 2.10A {Pseudomonas aeruginosa} SCOP: a.4.5.28 Back     alignment and structure
>2fbh_A Transcriptional regulator PA3341; MARR, transcription regulator, APC5857, structural genomics, protein structure initiative; 1.80A {Pseudomonas aeruginosa} SCOP: a.4.5.28 Back     alignment and structure
>2eth_A Transcriptional regulator, putative, MAR family; MARR family, structural genomics, joint center for structura genomics, JCSG; 2.30A {Thermotoga maritima} SCOP: a.4.5.28 Back     alignment and structure
>2f07_A YVDT; helix-turn-helix, transcription; HET: BTB; 2.30A {Bacillus subtilis subsp} Back     alignment and structure
>1jgs_A Multiple antibiotic resistance protein MARR; transcription regulation, DNA-binding, repressor, transcription; HET: SAL; 2.30A {Escherichia coli} SCOP: a.4.5.28 Back     alignment and structure
>1j5y_A Transcriptional regulator, biotin repressor famil; structural genomics, TM1602, BIOT repressor family, JCSG, conserved hypothetical protein; 2.30A {Thermotoga maritima} SCOP: a.4.5.1 d.94.2.1 Back     alignment and structure
>3s2w_A Transcriptional regulator, MARR family; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics; 2.45A {Methanosarcina mazei} Back     alignment and structure
>3eco_A MEPR; mutlidrug efflux pump regulator winged helix-turn-helix motif, DNA-binding, transcription, transcription regulation; 2.40A {Staphylococcus aureus} SCOP: a.4.5.0 Back     alignment and structure
>3dv8_A Transcriptional regulator, CRP/FNR family; cyclic nucleotide-binding domain, structural genomics, joint for structural genomics; 2.55A {Eubacterium rectale atcc 33656} Back     alignment and structure
>3iwz_A CAP-like, catabolite activation-like protein; XCC, pathogenicity, CRP, CLP, C-DI-GMP receptor, quorum SENS binding, transcription; 2.30A {Xanthomonas campestris PV} Back     alignment and structure
>3b02_A Transcriptional regulator, CRP family; structural genomics, riken structural genomics/proteomics in RSGI; 1.92A {Thermus thermophilus} PDB: 2zdb_A Back     alignment and structure
>3e97_A Transcriptional regulator, CRP/FNR family; YP_604437.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.86A {Deinococcus geothermalis dsm 11300} Back     alignment and structure
>3i4p_A Transcriptional regulator, ASNC family; PSI, structural genom protein structure initiative, midwest center for structural genomics; 2.30A {Agrobacterium tumefaciens str} Back     alignment and structure
>3kkc_A TETR family transcriptional regulator; APC20805, structural genomics, PSI-2, protein structure initiative; 2.50A {Streptococcus agalactiae 2603V} Back     alignment and structure
>2qww_A Transcriptional regulator, MARR family; YP_013417.1, multiple antibiotic-resistance repressor (MARR) structural genomics; HET: MSE; 2.07A {Listeria monocytogenes str} Back     alignment and structure
>3mn2_A Probable ARAC family transcriptional regulator; structural genomics, PSI-2, protein structure initiative; 1.80A {Rhodopseudomonas palustris} Back     alignment and structure
>2fmy_A COOA, carbon monoxide oxidation system transcription RE COOA-1; DNA transcription regulator, DNA binding protein; HET: HEM; 2.20A {Carboxydothermus hydrogenoformans} PDB: 2hkx_A* Back     alignment and structure
>4ev0_A Transcription regulator, CRP family; CAMP binding, winged helix-turn-helix motif, DNA binding, transcription activator; HET: CMP; 2.40A {Thermus thermophilus} Back     alignment and structure
>1lj9_A Transcriptional regulator SLYA; HTH DNA binding protein, structural genomics, PSI, protein structure initiative; 1.60A {Enterococcus faecalis} SCOP: a.4.5.28 Back     alignment and structure
>3d0s_A Transcriptional regulatory protein; CAMP receptor protein (CRP), dimer, inactive(APO, unliganded allostery, DNA binding, cyclic AMP; 2.00A {Mycobacterium tuberculosis} PDB: 3i54_A* 3i59_A* 3mzh_A* 3h3u_A* 3r6s_A* Back     alignment and structure
>1ft9_A Carbon monoxide oxidation system transcription regulator; heme sensor, catabolite gene activator protein; HET: HEM; 2.60A {Rhodospirillum rubrum} SCOP: a.4.5.4 b.82.3.1 Back     alignment and structure
>1wh8_A CUT-like 2, homeobox protein CUX-2; CUT domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, transcription; NMR {Homo sapiens} SCOP: a.35.1.7 Back     alignment and structure
>3kp7_A Transcriptional regulator TCAR; multiple drug resistance, biofilm, transcription regulation, binding, transcription regulator; 2.30A {Staphylococcus epidermidis RP62A} PDB: 3kp3_A* 3kp4_A* 3kp5_A* 3kp2_A* 3kp6_A Back     alignment and structure
>2qvo_A Uncharacterized protein AF_1382; PSI, structural genomics, southeast collaboratory for structural genomics; 1.85A {Archaeoglobus fulgidus dsm 4304} PDB: 3o3k_A 3ov8_A Back     alignment and structure
>1z05_A Transcriptional regulator, ROK family; structural genomics, protein structure initiative, midwest center for structural genomics; 2.00A {Vibrio cholerae o1 biovar eltor} SCOP: a.4.5.63 c.55.1.10 c.55.1.10 Back     alignment and structure
>3k0l_A Repressor protein; helix-turn-helix, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.35A {Acinetobacter SP} Back     alignment and structure
>3qkx_A Uncharacterized HTH-type transcriptional regulato; structural genomics, joint center for structural genomics; HET: MSE; 2.35A {Haemophilus influenzae} Back     alignment and structure
>2zhg_A Redox-sensitive transcriptional activator SOXR; oxidative stress, MERR family, activator; HET: DNA; 2.80A {Escherichia coli} PDB: 2zhh_A Back     alignment and structure
>1z6r_A MLC protein; transcriptional repressor, ROK family protein, DNA binding P helix-turn-helix, phosphotransferase system; 2.70A {Escherichia coli} SCOP: a.4.5.63 c.55.1.10 c.55.1.10 PDB: 3bp8_A Back     alignment and structure
>1q1h_A TFE, transcription factor E, TFE; TFIIE, transcription initiation, preinitiation complex, RNA polymerase II, transcription bubble; 2.90A {Sulfolobus solfataricus} SCOP: a.4.5.41 Back     alignment and structure
>2r0q_C Putative transposon TN552 DNA-invertase BIN3; site-specific recombinase, resolvase, DNA-binding protein, protein-DNA complex, DNA integration, DNA invertase, DNA recombination; 3.20A {Staphylococcus aureus} Back     alignment and structure
>3bqz_B HTH-type transcriptional regulator QACR; multidrug resistance, TETR, malachite green, DNA- binding, plasmid, repressor; HET: MGR; 2.17A {Staphylococcus aureus} PDB: 3br1_B* 3br3_B* 3pm1_B* 1rkw_B* 1jt0_A* 1jty_B* 1jum_B* 1jup_B* 1jtx_B* 1jus_B* 2dtz_B 2gby_B* 2hq5_B 3br2_B* 3br5_B* 1qvt_B* 1qvu_B* 3br0_B* 3br6_B* 1jt6_B* ... Back     alignment and structure
>3gpv_A Transcriptional regulator, MERR family; protein structure initiative II(PSI II), NYSGXRC, structural genomics; 1.90A {Bacillus thuringiensis serovarkonkukian} Back     alignment and structure
>2pex_A Transcriptional regulator OHRR; transcription regulator; 1.90A {Xanthomonas campestris} PDB: 2pfb_A Back     alignment and structure
>1zyb_A Transcription regulator, CRP family; NP_813211.1, structural genomics, joint center for structura genomics, JCSG; 2.15A {Bacteroides thetaiotaomicron} SCOP: a.4.5.4 b.82.3.2 Back     alignment and structure
>3bj6_A Transcriptional regulator, MARR family; helix-turn-helix, trasnscription regulator, STR genomics, PSI-2, protein structure initiative; 2.01A {Silicibacter pomeroyi dss-3} Back     alignment and structure
>3lsg_A Two-component response regulator YESN; structural genomics, PSI-2, protein structure initiative, MCSG; 2.05A {Fusobacterium nucleatum} Back     alignment and structure
>2nyx_A Probable transcriptional regulatory protein, RV14; alpha/beta, structural genomics, PSI-2; 2.30A {Mycobacterium tuberculosis} Back     alignment and structure
>1u8b_A ADA polyprotein; protein-DNA complex, methylation, zinc, helix-turn-helix, metal binding protein/DNA complex; 2.10A {Escherichia coli} PDB: 1zgw_A* 1wpk_A* 1adn_A 1eyf_A Back     alignment and structure
>2hoe_A N-acetylglucosamine kinase; TM1224, structural genomics, PSI-2, protein structure initiative, joint center structural genomics, JCSG; 2.46A {Thermotoga maritima} SCOP: a.4.5.63 c.55.1.10 c.55.1.10 Back     alignment and structure
>3oio_A Transcriptional regulator (ARAC-type DNA-binding containing proteins); PSI-2, midwest center for structural genomics; 1.65A {Chromobacterium violaceum} Back     alignment and structure
>2gxg_A 146AA long hypothetical transcriptional regulator; winged helix; 1.45A {Sulfolobus tokodaii} PDB: 2eb7_A 2yr2_A 3gez_A 3gf2_A* 3gfi_A 3gfm_A 3gfj_A 3gfl_A Back     alignment and structure
>2k9s_A Arabinose operon regulatory protein; activator, arabinose catabolism, carbohydrate metabolism, cytoplasm, DNA-binding, repressor, transcription; NMR {Escherichia coli} Back     alignment and structure
>1or7_A Sigma-24, RNA polymerase sigma-E factor; regulation, DNA-binding, transmembrane, transcription; 2.00A {Escherichia coli} SCOP: a.4.13.2 a.177.1.1 PDB: 2h27_A Back     alignment and structure
>3la7_A Global nitrogen regulator; activator, DNA-binding, transcription, transcription regulation; HET: BOG; 1.90A {Anabaena} PDB: 3la2_A* 3la3_A* 2xko_A* 2xgx_A* 2xhk_A* 2xkp_A* Back     alignment and structure
>3cjn_A Transcriptional regulator, MARR family; silicibacter pomeroy structural genomics, PSI-2, protein structure initiative; 1.95A {Silicibacter pomeroyi dss-3} Back     alignment and structure
>1gdt_A GD resolvase, protein (gamma delta resolvase); protein-DNA complex, double helix, overhanging base, DNA binding protein/DNA complex; 3.00A {Escherichia coli} SCOP: a.4.1.2 c.53.1.1 PDB: 1zr4_A 1zr2_A 2gm4_A 1res_A 1ret_A Back     alignment and structure
>1rp3_A RNA polymerase sigma factor sigma-28 (FLIA); transcription; 2.30A {Aquifex aeolicus} SCOP: a.4.13.1 a.4.13.2 a.177.1.1 PDB: 1sc5_A Back     alignment and structure
>3dkw_A DNR protein; CRP-FNR, HTH, beta barrel, dimerization helix, homodimer, transcription regulator; 3.60A {Pseudomonas aeruginosa} Back     alignment and structure
>3tgn_A ADC operon repressor ADCR; helix-turn-helix, transcriptional regulator, transcription; 2.00A {Streptococcus pneumoniae} Back     alignment and structure
>2d6y_A Putative TETR family regulatory protein; helix-turn-helix, gene regulation; HET: TLA; 2.30A {Streptomyces coelicolor} SCOP: a.4.1.9 a.121.1.1 Back     alignment and structure
>3egq_A TETR family transcriptional regulator; DNA-binding, transcription regulation, bacterial regulatory DNA/RNA-binding 3-helical bundle fold; HET: MSE PE8; 2.55A {Archaeoglobus fulgidus} Back     alignment and structure
>3ppb_A Putative TETR family transcription regulator; DNA-binding, helix-turn-helix motif, HTH motif, DNA/RNA-BIND helical bundle fold; HET: MSE PG4; 2.10A {Shewanella loihica} Back     alignment and structure
>2gau_A Transcriptional regulator, CRP/FNR family; structural genomics, porphyromona gingivalis, PSI, protein structure initiative; 1.90A {Porphyromonas gingivalis} SCOP: a.4.5.4 b.82.3.2 Back     alignment and structure
>2x4h_A Hypothetical protein SSO2273; transcription; 2.30A {Sulfolobus solfataricus} Back     alignment and structure
>3on4_A Transcriptional regulator, TETR family; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics; HET: MSE; 1.85A {Legionella pneumophila subsp} Back     alignment and structure
>1s3j_A YUSO protein; structural genomics, MARR transcriptional regulator family, PSI, protein structure initiative; HET: MSE; 2.25A {Bacillus subtilis} SCOP: a.4.5.28 Back     alignment and structure
>1ojl_A Transcriptional regulatory protein ZRAR; response regulator, two component system, AAA domain, NTRC family, DNA-binding; HET: ATP; 3.0A {Salmonella typhimurium} Back     alignment and structure
>3lwj_A Putative TETR-family transcriptional regulator; structural G joint center for structural genomics, JCSG, protein structu initiative; 2.07A {Syntrophomonas wolfei subsp} Back     alignment and structure
>3e6c_C CPRK, cyclic nucleotide-binding protein; CPRK, halorespiration; HET: DNA 3C4; 1.80A {Desulfitobacterium hafniense} SCOP: a.4.5.4 b.82.3.2 PDB: 3e6b_A* 3e5u_C* 3e6d_A 3e5x_A* 3e5q_A 2h6b_A* 2h6c_A Back     alignment and structure
>3vpr_A Transcriptional regulator, TETR family; all alpha, helix-turn-helix, transcriptional repressor, DNA protein; 2.27A {Thermus thermophilus} Back     alignment and structure
>4dyq_A Gene 1 protein; GP1, octamer, DNA-binding, viral protein; 1.50A {Shigella phage SF6} PDB: 4dyc_A 4dyr_A 3hef_A 4dzj_A 4dzp_A Back     alignment and structure
>3oou_A LIN2118 protein; protein structure initiative, PSI-2, structural genomics, MI center for structural genomics, MCSG, unknown function; HET: BTB; 1.57A {Listeria innocua} Back     alignment and structure
>3e6m_A MARR family transcriptional regulator; APC88769, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; 2.20A {Silicibacter pomeroyi} Back     alignment and structure
>3fx3_A Cyclic nucleotide-binding protein; helix_TURN_helix, CAMP regulatory protein, structural genomi 2, protein structure initiative; 2.20A {Ruegeria pomeroyi} PDB: 3h3z_A* Back     alignment and structure
>2rae_A Transcriptional regulator, ACRR family protein; TETR/ACRR family transcriptional regulator, structural genom 2, RHA08332, MCSG; 2.20A {Rhodococcus SP} Back     alignment and structure
>3anp_C Transcriptional repressor, TETR family; all alpha protein, DNA, acyl-COA; HET: DCC DAO; 1.95A {Thermus thermophilus} PDB: 3ang_C* Back     alignment and structure
>2qtq_A Transcriptional regulator, TETR family; transcription regulator, DNA/RNA-binding 3-helical bundle FO turn helix motif, HTH motif; HET: MSE; 1.85A {Novosphingobium aromaticivorans} PDB: 2rha_A* Back     alignment and structure
>3f1b_A TETR-like transcriptional regulator; APC5888, rhodococcus SP. RHA1, structural genomics, PS protein structure initiative; 2.40A {Rhodococcus} Back     alignment and structure
>3lhq_A Acrab operon repressor (TETR/ACRR family); structural genomics, IDP02616, csgid, DNA-binding, transcription, transcription regulation; 1.56A {Salmonella enterica subsp} PDB: 3bcg_A 2qop_A Back     alignment and structure
>3kcc_A Catabolite gene activator; helix-turn-helix, CAMP, CAMP-binding, DNA-binding nucleotide-binding, transcription, transcription regulation; HET: CMP; 1.66A {Escherichia coli} Back     alignment and structure
>2v57_A TETR family transcriptional repressor LFRR; DNA-binding, transcription regulation; HET: PRL; 1.90A {Mycobacterium smegmatis} PDB: 2wgb_A Back     alignment and structure
>3k2z_A LEXA repressor; winged helix-turn-helix, SOS system, autoca cleavage, DNA damage, DNA repair, DNA replication, DNA-BIND hydrolase; 1.37A {Thermotoga maritima} Back     alignment and structure
>2h09_A Transcriptional regulator MNTR; transcription regulator, diphtheria toxin, manganese transport, structural genomics, NPPSFA; 2.10A {Escherichia coli} Back     alignment and structure
>3knw_A Putative transcriptional regulator (TETR/ACRR FAM; TETR-like protein, MCSG, PSI, structural genomics, protein S initiative; 2.45A {Acinetobacter SP} Back     alignment and structure
>2fq4_A Transcriptional regulator, TETR family; DNA-binding protein, bacillu structural genomics, PSI, protein structure initiative; 1.79A {Bacillus cereus} SCOP: a.4.1.9 a.121.1.1 Back     alignment and structure
>3jth_A Transcription activator HLYU; transcription factor, RTXA, DNA-binding, transcription regulation; 2.00A {Vibrio vulnificus} Back     alignment and structure
>2frh_A SARA, staphylococcal accessory regulator A; winged-helix protein, divalent metal binding, transcription; 2.50A {Staphylococcus aureus} SCOP: a.4.5.28 PDB: 2fnp_A 1fzp_D Back     alignment and structure
>3jw4_A Transcriptional regulator, MARR/EMRR family; DNA-binding protein, structural genomics, PSI-2, protein structure initiative; HET: MSE; 2.10A {Clostridium acetobutylicum} SCOP: a.4.5.0 Back     alignment and structure
>3dcf_A Transcriptional regulator of the TETR/ACRR family; YP_290855.1, structural genomics, joint center for structural genomics, JCSG; 2.50A {Thermobifida fusca YX} Back     alignment and structure
>2zcm_A Biofilm operon icaabcd HTH-type negative transcri regulator ICAR; helix-turn-helix, TETR family, repressor; 1.33A {Staphylococcus epidermidis} PDB: 2zcn_A Back     alignment and structure
>3qbm_A TETR transcriptional regulator; DNA/RNA-binding three-helical bundle, structural genomics, J center for structural genomics, JCSG; HET: MSE PGE; 1.80A {Chloroflexus aurantiacus} Back     alignment and structure
>3mkl_A HTH-type transcriptional regulator GADX; PSI2, MCSG, structural genomics, protein structure initiativ midwest center for structural genomics; 2.15A {Escherichia coli} Back     alignment and structure
>2g7s_A Transcriptional regulator, TETR family; APC5906, PSI, protein structure initiat midwest center for structural genomics, MCSG; HET: MSE; 1.40A {Agrobacterium tumefaciens str} SCOP: a.4.1.9 a.121.1.1 Back     alignment and structure
>2kko_A Possible transcriptional regulatory protein (possibly ARSR-family); NESG, DNA-binding, transcription regulation, WHTH, homodimer; NMR {Mycobacterium bovis} PDB: 3gw2_A Back     alignment and structure
>3ljl_A Transcriptional regulator LUXT; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MES; 3.20A {Vibrio parahaemolyticus} Back     alignment and structure
>4aci_A HTH-type transcriptional repressor ACNR; aconitase, citrate, TETR superfamily; HET: CIT; 1.65A {Corynebacterium glutamicum} PDB: 4ac6_A* Back     alignment and structure
>3cdh_A Transcriptional regulator, MARR family; helix-turn-hleix, structura genomics, PSI-2, protein structure initiative; 2.69A {Silicibacter pomeroyi dss-3} Back     alignment and structure
>3dpj_A Transcription regulator, TETR family; APC88616, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; HET: MES; 1.90A {Silicibacter pomeroyi} Back     alignment and structure
>2dg7_A Putative transcriptional regulator; helix-turn-helix motif, TETR family, gene regulation; 2.30A {Streptomyces coelicolor} Back     alignment and structure
>1ku9_A Hypothetical protein MJ223; putative transcription factor, homodimeric winged-helix fold, structural genomics, PSI; 2.80A {Methanocaldococcus jannaschii} SCOP: a.4.5.36 Back     alignment and structure
>2oa4_A SIR5; structure, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; NMR {Silicibacter pomeroyi} SCOP: a.4.12.3 Back     alignment and structure
>1yse_A DNA-binding protein SATB1; all helical, DNA-binding domain, T-cell development; NMR {Homo sapiens} SCOP: a.35.1.7 Back     alignment and structure
>2jrt_A Uncharacterized protein; solution, structure, NESG, PSI, target RHR5, structural genomics, protein structure initiative; NMR {Rhodobacter sphaeroides} Back     alignment and structure
>3kz9_A SMCR; transcriptional regulator, quorum S DNA-binding, transcription regulation, transcription regula; HET: MSE; 2.10A {Vibrio vulnificus} PDB: 2pbx_A Back     alignment and structure
>1z91_A Organic hydroperoxide resistance transcriptional; OHRR, MARR family, bacterial transcription factor, DNA bindi protein; 2.50A {Bacillus subtilis} SCOP: a.4.5.28 PDB: 1z9c_A* Back     alignment and structure
>3bni_A Putative TETR-family transcriptional regulator; structural genomics, APC7281; HET: PG4; 2.30A {Streptomyces coelicolor A3} Back     alignment and structure
>2dg6_A Putative transcriptional regulator; winged-helix motif, MERR family, gene regulation; 2.20A {Streptomyces coelicolor} Back     alignment and structure
>4fx0_A Probable transcriptional repressor protein; helix-turn-helix, DNA binding, transcription regulator; 2.70A {Mycobacterium tuberculosis} PDB: 4fx4_A* Back     alignment and structure
>3vp5_A Transcriptional regulator; heme, sensor protein, TETR superf transcription; HET: HEM; 1.90A {Lactococcus lactis} PDB: 3vox_A 3vok_A* Back     alignment and structure
>2eh3_A Transcriptional regulator; all alpha proteins, tetracyclin repressor-like, C-terminal D homeodomain-like, DNA/RNA-binding 3-helical bundle; 1.55A {Aquifex aeolicus} Back     alignment and structure
>3fm5_A Transcriptional regulator; MCSG, PF04017, PSI, MARR, structu genomics, protein structure initiative, midwest center for structural genomics; HET: GOL; 2.00A {Rhodococcus jostii} Back     alignment and structure
>3hsr_A HTH-type transcriptional regulator SARZ; helix-turn-helix, cysteine disulfide, MARR-family transcript regulator, DNA-binding; 1.90A {Staphylococcus aureus subsp} PDB: 3hse_A 3hrm_A 4gxo_A Back     alignment and structure
>1tbx_A ORF F-93, hypothetical 11.0 kDa protein; sulfolobus spindle virus, winged helix, fusellovirus; 2.70A {Sulfolobus virus 1} SCOP: a.4.5.48 Back     alignment and structure
>3o60_A LIN0861 protein; PSI, MCSG, structural genomics, midwest center for structura genomics, protein structure initiative, unknown function; 2.80A {Listeria innocua} Back     alignment and structure
>3bru_A Regulatory protein, TETR family; structural genomics, APC88928, PSI-2, protein structur initiative; 2.30A {Rhodobacter sphaeroides 2} Back     alignment and structure
>1pb6_A Hypothetical transcriptional regulator YCDC; helix-loop-helix, dimer, structural genomics, PSI, protein structure initiative; 2.50A {Escherichia coli} PDB: 3loc_A* Back     alignment and structure
>3vib_A MTRR; helix-turn-helix motif, DNA binding, DNA binding protein; HET: CXS; 2.40A {Neisseria gonorrhoeae} Back     alignment and structure
>3gzi_A Transcriptional regulator, TETR family; TETR family transcriptional regulator, structural genomics, center for structural genomics, JCSG; 2.05A {Shewanella loihica pv-4} Back     alignment and structure
>3bhq_A Transcriptional regulator; bacterial RE proteins, structural genomics, joint center for structural JCSG, protein structure initiative, PSI-2; HET: MSE; 1.54A {Mesorhizobium loti} Back     alignment and structure
>3dew_A Transcriptional regulator, TETR family; S genomics, PSI-2, protein structure initiative, midwest CENT structural genomics, MCSG; HET: MSE; 1.75A {Geobacter sulfurreducens} Back     alignment and structure
>3nqo_A MARR-family transcriptional regulator; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE PG4; 2.20A {Clostridium difficile} Back     alignment and structure
>2jj7_A Hemolysin II regulatory protein; DNA-binding protein, transcription regulation, DNA-binding, family, transcription, transcriptional regulator; 2.10A {Bacillus cereus} PDB: 2wv1_A 2jk3_A 2fx0_A Back     alignment and structure
>2fu4_A Ferric uptake regulation protein; DNA binding domain, helix-turn-helix, DNA binding protein; 1.80A {Escherichia coli} Back     alignment and structure
>1u78_A TC3 transposase, transposable element TC3 transposase; transposon DNA, bipartite DNA-binding, HTH- motif, DNA binding protein/DNA complex; 2.69A {Caenorhabditis elegans} SCOP: a.4.1.2 a.4.1.2 Back     alignment and structure
>3f0c_A TETR-molecule A, transcriptional regulator; MCSG,PSI, SAD, structural genomics, protein structure initiative; 2.96A {Cytophaga hutchinsonii} Back     alignment and structure
>3frq_A Repressor protein MPHR(A); macrolide antibiotic. repressor, biosensor, erythromycin, STRPTOMYCES, natural products, biosynthesis, DNA-binding; HET: ERY; 1.76A {Escherichia coli} PDB: 3g56_A Back     alignment and structure
>3szt_A QCSR, quorum-sensing control repressor; quorum sensing acyl-homoserine lactone, helix-turn-helix, transcription factor, 3-OXO-C12 HSL; HET: OHN; 2.55A {Pseudomonas aeruginosa} Back     alignment and structure
>3loc_A HTH-type transcriptional regulator RUTR; helix-turn-helix, putative transcriptional regulator, dimer, structural genomics, PSI; HET: MSE; 2.50A {Escherichia coli} Back     alignment and structure
>4a0z_A Transcription factor FAPR; lipid homeostasis; HET: MLC; 1.90A {Staphylococcus aureus} PDB: 4a0y_A 4a0x_A* 4a12_A Back     alignment and structure
>2yve_A Transcriptional regulator; helix-turn-helix, TETR-family; HET: MBT; 1.40A {Corynebacterium glutamicum} PDB: 1v7b_A 2zoy_A 2yvh_A 2dh0_A* 2zoz_A* Back     alignment and structure
>3pas_A TETR family transcription regulator; structural genomics, joint center for structural genomics, J protein structure initiative; HET: MSE; 1.90A {Marinobacter aquaeolei} Back     alignment and structure
>3rh2_A Hypothetical TETR-like transcriptional regulator; DNA/RNA-binding 3-helical bundle, structural genomics, joint for structural genomics; 2.42A {Shewanella amazonensis} Back     alignment and structure
>3clo_A Transcriptional regulator; NP_811094.1, bacterial regulatory proteins, LUXR family, structural genomics; 2.04A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>3deu_A Transcriptional regulator SLYA; MARR, WING-helix, transcription regulator, activator, DNA-binding, repressor; HET: SAL; 2.30A {Salmonella typhimurium} SCOP: a.4.5.28 Back     alignment and structure
>2kfs_A Conserved hypothetical regulatory protein; WHTH, DNA binding, phosphorylation, DNA-binding protein; NMR {Mycobacterium tuberculosis} Back     alignment and structure
>2d5v_A Hepatocyte nuclear factor 6; transcription factor, transcription-DNA complex; 2.00A {Rattus norvegicus} PDB: 1s7e_A Back     alignment and structure
>3mnl_A KSTR, transcriptional regulatory protein (probably TETR; TETR family of transcriptional regulator, all-helical; 1.80A {Mycobacterium tuberculosis} Back     alignment and structure
>3f3x_A Transcriptional regulator, MARR family, putative; DNA binding protein, DNA-binding, transcription regulation; 1.90A {Sulfolobus solfataricus} Back     alignment and structure
>2lfw_A PHYR sigma-like domain; signal transduction, response regulator, sigma factor mimicr sigma factor, general stress response, signaling protein; NMR {Sphingomonas SP} Back     alignment and structure
>3cwr_A Transcriptional regulator, TETR family; YP_425770.1, transcriptional regulator of TETR family, bacterial regulatory proteins; 1.50A {Rhodospirillum rubrum atcc 11170} Back     alignment and structure
>3c2b_A Transcriptional regulator, TETR family; structural genomics, APC5923, PSI-2, PR structure initiative; 2.10A {Agrobacterium tumefaciens str} Back     alignment and structure
>2qwt_A Transcriptional regulator, TETR family; structural genomics, PSI-2, protein structure initiative; 2.30A {Mycobacterium vanbaalenii pyr-1} Back     alignment and structure
>3e7q_A Transcriptional regulator; structural genomics, PSI, MCSG, P structure initiative, midwest center for structural genomic binding; 2.20A {Pseudomonas aeruginosa} Back     alignment and structure
>2ibd_A Possible transcriptional regulator; probable transcriptional regulatory protein, rhodococcus SP. structural genomics, PSI-2; 1.50A {Rhodococcus SP} Back     alignment and structure
>2fxa_A Protease production regulatory protein HPR; protease porduction, regulation, STR genomics, PSI, protein structure initiative; HET: PGE P6G 1PE; 2.40A {Bacillus subtilis} SCOP: a.4.5.28 Back     alignment and structure
>3cjd_A Transcriptional regulator, TETR family; YP_510936.1, putative TETR transcriptional regulator, struct genomics; HET: STE; 1.79A {Jannaschia SP} Back     alignment and structure
>2nx4_A Transcriptional regulator, TETR family protein; HTH DNA binding motif, structural genomics, PSI-2, Pro structure initiative; 1.70A {Rhodococcus SP} Back     alignment and structure
>3dn7_A Cyclic nucleotide binding regulatory protein; structural genomics, APC88869, cyclic nucleotide binding REG protein, PSI-2; 1.80A {Cytophaga hutchinsonii} Back     alignment and structure
>2oer_A Probable transcriptional regulator; helix-turn-helix, alpha-beta, structural genomics, PSI-2, protein structure initiative; 2.00A {Pseudomonas aeruginosa} Back     alignment and structure
>2dg8_A Putative TETR-family transcriptional regulatory P; helix-turn-helix motif, gene regulation; 2.21A {Streptomyces coelicolor} Back     alignment and structure
>1vi0_A Transcriptional regulator; structural genomics; HET: MSE DCC; 1.65A {Bacillus subtilis} SCOP: a.4.1.9 a.121.1.1 Back     alignment and structure
>2hku_A A putative transcriptional regulator; structural genomics, APC6040, TET rhodococcus SP. RHA1, PSI-2, protein structure initiative; HET: PG4; 2.00A {Rhodococcus SP} SCOP: a.4.1.9 a.121.1.1 Back     alignment and structure
>3nxc_A HTH-type protein SLMA; nucleoid occlusion, cell division, TETR family member, DNA B protein; 2.50A {Escherichia coli} Back     alignment and structure
>2g3b_A Putative TETR-family transcriptional regulator; transcription regulator, structural genomics, P protein structure initiative; HET: MSE; 2.00A {Rhodococcus SP} SCOP: a.4.1.9 a.121.1.1 Back     alignment and structure
>3b81_A Transcriptional regulator, ACRR family; NP_350189.1, predicted DNA-binding transcriptional regulator TETR/ACRR family; 2.10A {Clostridium acetobutylicum atcc 824} Back     alignment and structure
>2zb9_A Putative transcriptional regulator; transcription regulator, TETR family, helix-turn-helix, DNA- binding, transcription regulation; 2.25A {Streptomyces coelicolor} Back     alignment and structure
>2rek_A Putative TETR-family transcriptional regulator; sulfur, SAD, structural genomics, PSI-2, protein structure initiative; 1.86A {Streptomyces coelicolor A3} Back     alignment and structure
>4aik_A Transcriptional regulator SLYA; transcription, transcription factor; 1.85A {Yersinia pseudotuberculosis} PDB: 4aih_A 4aij_A 3qpt_A* 3q5f_A* Back     alignment and structure
>2o7t_A Transcriptional regulator; transcription regulator, DNA/RNA-binding 3-helical bundle FO turn helix motif, HTH motif; HET: UNL; 2.10A {Corynebacterium glutamicum} SCOP: a.4.1.9 a.121.1.1 Back     alignment and structure
>2wui_A MEXZ, transcriptional regulator; gene regulation, transcription regulation, TETR, DNA-binding transcription; 2.90A {Pseudomonas aeruginosa} Back     alignment and structure
>2gen_A Probable transcriptional regulator; APC6095, TETR family, structural genomics, PSI, protein structure initiative; 1.70A {Pseudomonas aeruginosa PAO1} SCOP: a.4.1.9 a.121.1.1 Back     alignment and structure
>1r1t_A Transcriptional repressor SMTB; zinc, transcriptional regulation, winged HTH protein, DNA binding, transcription repressor; 1.70A {Synechococcus elongatus pcc 7942} SCOP: a.4.5.5 PDB: 1r23_A 1smt_A 1r22_A Back     alignment and structure
>2i10_A Putative TETR transcriptional regulator; structural genomics, APC5890, TETR family, PSI-2, protein ST initiative; HET: MSE NPO PGE; 2.05A {Rhodococcus SP} SCOP: a.4.1.9 a.121.1.1 Back     alignment and structure
>3mvp_A TETR/ACRR transcriptional regulator; PSI, MCSG, structural genomics, midwest center for structura genomics, protein structure initiative; 1.85A {Streptococcus mutans} Back     alignment and structure
>3g7r_A Putative transcriptional regulator; TETR, all-helical, structural genomics, PSI-2, protein structure initiative; 1.38A {Streptomyces coelicolor A3} Back     alignment and structure
>1okr_A MECI, methicillin resistance regulatory protein MECI; bacterial antibiotic resistance, MECI protein, transcriptional regulatory element; 2.4A {Staphylococcus aureus} SCOP: a.4.5.39 PDB: 1sax_A 1sd7_A 2d45_A 1sd6_A Back     alignment and structure
>3b73_A PHIH1 repressor-like protein; winged-helix-turn-helix, structural genomics, PSI-2, protein structure initiative; 2.12A {Haloarcula marismortui atcc 43049} Back     alignment and structure
>2hyt_A TETR-family transcriptional regulator; structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.64A {Pectobacterium atrosepticum} Back     alignment and structure
>3bja_A Transcriptional regulator, MARR family, putative; NP_978771.1, putative MARR-like transcription regulator, MAR structural genomics; 2.38A {Bacillus cereus} Back     alignment and structure
>2q0o_A Probable transcriptional activator protein TRAR; helix-turn-helix, two-helix coiled coil; HET: LAE; 2.00A {Rhizobium SP} Back     alignment and structure
>2qib_A TETR-family transcriptional regulator; HTH DNA binding, STRU genomics, MCSG, PSI-2, protein structure initiative; HET: P6G; 1.70A {Streptomyces coelicolor A3} Back     alignment and structure
>3nnr_A Transcriptional regulator, TETR family; TETR-family transcriptional regulator, structural genomics, center for structural genomics, JCSG; HET: MSE; 2.49A {Marinobacter aquaeolei} Back     alignment and structure
>2np5_A Transcriptional regulator; TETR family, structural genomics, protein structure initiative, midwest center for structural genomics, MCSG; HET: MSE LMT NDS; 1.80A {Rhodococcus SP} SCOP: a.4.1.9 a.121.1.1 Back     alignment and structure
>3col_A Putative transcription regulator; structural genomics, PSI-2, protein structure initiative, midwest CENT structural genomics, MCSG; HET: MSE; 2.10A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>3rd3_A Probable transcriptional regulator; 2.40A {Pseudomonas aeruginosa} Back     alignment and structure
>1uly_A Hypothetical protein PH1932; helix-turn-helix, structural genomics, DNA binding protein; 2.50A {Pyrococcus horikoshii} SCOP: a.4.5.58 PDB: 2cwe_A Back     alignment and structure
>3q0w_A HTH-type transcriptional regulator EThr; TETR family, transcriptional repressor, transcription-transc inhibitor complex; HET: LL5; 1.60A {Mycobacterium tuberculosis} PDB: 3o8g_A* 3o8h_A* 3q0u_A* 3q0v_A* 3g1m_A* 3q3s_A* 3sdg_A* 3sfi_A* 1u9n_A* 1u9o_A* 3tp3_A 3qpl_A 3g1l_A* 1t56_A 3tp0_A* Back     alignment and structure
>2bgc_A PRFA; bacterial infection, human pathogen, transcriptional regulat transcription; HET: PR3; 2.3A {Listeria monocytogenes} SCOP: a.4.5.4 b.82.3.3 PDB: 2beo_A* 1omi_A Back     alignment and structure
>3v6g_A Probable transcriptional regulatory protein (PROB family); helix-turn-helix DNA binding domain; 1.82A {Mycobacterium tuberculosis} Back     alignment and structure
>1mkm_A ICLR transcriptional regulator; structural genomics, winged helix-turn-helix, PSI, protein structure initiative; 2.20A {Thermotoga maritima} SCOP: a.4.5.33 d.110.2.2 Back     alignment and structure
>3bjb_A Probable transcriptional regulator, TETR family P; APC7331, rhodococcus SP. RHA1, structural genomics, PS protein structure initiative; 2.50A {Rhodococcus SP} Back     alignment and structure
>3g7d_A PHPD; non heme Fe(II) dioxygenase, cupin, biosynthetic protein; 1.80A {Streptomyces viridochromogenes} PDB: 3gbf_A 3rzz_A Back     alignment and structure
>1xmk_A Double-stranded RNA-specific adenosine deaminase; winged helix-turn-helix, RNA editing, interferon, ADAR1, hydrolase; 0.97A {Homo sapiens} SCOP: a.4.5.19 Back     alignment and structure
>3rqi_A Response regulator protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: PHD CIT; 1.70A {Burkholderia pseudomallei} Back     alignment and structure
>3crj_A Transcription regulator; APC88200, TETR, structura genomics, PSI-2, protein structure initiative; HET: MSE; 2.60A {Haloarcula marismortui atcc 43049} Back     alignment and structure
>1rkt_A Protein YFIR; transcription regulator, structural genomics, PSI, protein S initiative, midwest center for structural genomics, MCSG; 1.95A {Bacillus subtilis} SCOP: a.4.1.9 a.121.1.1 Back     alignment and structure
>2id3_A Putative transcriptional regulator; structural genomics, PSI-2, prote structure initiative; 1.70A {Streptomyces coelicolor} SCOP: a.4.1.9 a.121.1.1 Back     alignment and structure
>3s5r_A Transcriptional regulator TETR family; DNA/RNA-binding 3-helical bundle, tetracyclin repressor-like structural genomics; 2.60A {Syntrophus aciditrophicus} Back     alignment and structure
>2pz9_A Putative regulatory protein; structural genomics, transcriptional regulator, PSI, protein structure initiative; 2.80A {Streptomyces coelicolor A3} Back     alignment and structure
>1b4a_A Arginine repressor; helix turn helix; 2.50A {Geobacillus stearothermophilus} SCOP: a.4.5.3 d.74.2.1 PDB: 1f9n_A Back     alignment and structure
>1zk8_A Transcriptional regulator, TETR family; TETR member,transcriptional regulator, STRU genomics, PSI, protein structure initiative; 2.15A {Bacillus cereus atcc 14579} SCOP: a.4.1.9 a.121.1.1 Back     alignment and structure
>2guh_A Putative TETR-family transcriptional regulator; helix-turn-helix, TETR fold, structural genomics, PSI, prote structure initiative; HET: MSE; 1.52A {Rhodococcus SP} Back     alignment and structure
>2gfn_A HTH-type transcriptional regulator PKSA related P; transcriptional regulato PSI-2, regulatory protein, structural genomics, protein STR initiative; 1.90A {Rhodococcus SP} SCOP: a.4.1.9 a.121.1.1 Back     alignment and structure
>2zcx_A SCO7815, TETR-family transcriptional regulator; helix-turn-helix, DNA-binding, transcription regulation; 2.22A {Streptomyces coelicolor} Back     alignment and structure
>3npi_A TETR family regulatory protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; 2.96A {Corynebacterium diphtheriae} Back     alignment and structure
>2q24_A Putative TETR family transcriptional regulator; structural genomics, PSI, protein structure initiative; 1.80A {Streptomyces coelicolor A3} Back     alignment and structure
>2o0m_A Transcriptional regulator, SORC family; structural genomics, protein structure initiative, midwest center for structural genomics, MCSG; 1.60A {Enterococcus faecalis} SCOP: c.124.1.8 Back     alignment and structure
>1sfu_A 34L protein; protein/Z-DNA complex, DNA binding protein/DNA complex; 2.00A {Yaba-like disease virus} SCOP: a.4.5.19 Back     alignment and structure
>1l3l_A Transcriptional activator protein TRAR; helix-turn-helix DNA binding motif, alpha/beta/alpha sandwich; HET: LAE; 1.66A {Agrobacterium tumefaciens} SCOP: a.4.6.2 d.110.5.1 PDB: 1h0m_A* Back     alignment and structure
>3uj3_X DNA-invertase; helix-turn-helix, site-specific recombinase, recombination; 3.51A {Enterobacteria phage MU} PDB: 3plo_X Back     alignment and structure
>1ui5_A A-factor receptor homolog; helix-turn-helix, alpha-helix-bundle, antibiotic; 2.40A {Streptomyces coelicolor} SCOP: a.4.1.9 a.121.1.1 PDB: 1ui6_A Back     alignment and structure
>3he0_A Transcriptional regulator, TETR family; ACRR, vibrio parahaemolytic structural genomics, PSI-2, protein structure initiative; HET: MSE; 2.20A {Vibrio parahaemolyticus} Back     alignment and structure
>2bv6_A MGRA, HTH-type transcriptional regulator MGRA; multidrug resistance regulator, virulence determinant, transcriptional factors; 2.8A {Staphylococcus aureus} SCOP: a.4.5.28 Back     alignment and structure
>3eup_A Transcriptional regulator, TETR family; structural genomics, MCSG, protein structure initiative, midwest center for STRU genomics; 1.99A {Cytophaga hutchinsonii} Back     alignment and structure
>2w53_A Repressor, SMet; antibiotic resistance, multi-drug efflux pump, transcription regulation, transcriptional repressor, DNA binding; 2.00A {Stenotrophomonas maltophilia} PDB: 3p9t_A* Back     alignment and structure
>2obp_A Putative DNA-binding protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE; 1.70A {Ralstonia eutropha} SCOP: a.4.5.71 Back     alignment and structure
>2id6_A Transcriptional regulator, TETR family; 1.75A {Thermotoga maritima} SCOP: a.4.1.9 a.121.1.1 PDB: 3ih2_A 3ih3_A 3ih4_A 1zkg_A* 2iek_A* 1z77_A* Back     alignment and structure
>3g1o_A Transcriptional regulatory repressor protein (TETR-family) EThr; TERT family, transcriptional repressor, DNA-binding; HET: RF1; 1.85A {Mycobacterium tuberculosis} Back     alignment and structure
>3qao_A LMO0526 protein, MERR-like transcriptional regulator; structural genomics, the center for structural genomics of I diseases, csgid; 1.87A {Listeria monocytogenes} Back     alignment and structure
>1p6r_A Penicillinase repressor; transcription regulation, DNA-binding, winged helix protein, bacterial resistance to antibiotics; NMR {Bacillus licheniformis} SCOP: a.4.5.39 PDB: 2p7c_B Back     alignment and structure
>3geu_A Intercellular adhesion protein R; TETR family, intercellular adhesion regulator, IDP00851, DNA repressor, transcription; HET: MSE; 1.90A {Staphylococcus aureus} Back     alignment and structure
>1z7u_A Hypothetical protein EF0647; winged-helix-turn-helix, MARR, structural genomics, PSI, Pro structure initiative; 2.20A {Enterococcus faecalis} SCOP: a.4.5.69 Back     alignment and structure
>3pqk_A Biofilm growth-associated repressor; helix-turn-helix motif, winged-helix fold, transcriptional R DNA binding, transcription; 2.09A {Xylella fastidiosa} PDB: 3pqj_A Back     alignment and structure
>3rkx_A Biotin-[acetyl-COA-carboxylase] ligase; biotin protein ligase, 3 domains, enzyme DNA binding, biotin coupling domains; 2.10A {Staphylococcus aureus} PDB: 3rir_A* 3rkw_A 3rky_A* 3v7c_A* 3v7s_A* 3v8j_A 3v7r_A 3v8k_A* 3v8l_A* 4dq2_A* Back     alignment and structure
>3jsj_A Putative TETR-family transcriptional regulator; DNA-binding, transcription regulation; 2.10A {Streptomyces avermitilis ma-4680} Back     alignment and structure
>1t33_A Putative transcriptional repressor (TETR/ACRR FAM; structural genomics, TETR/CCRR FA helix turn helix DNA binding domain, PSI; 2.20A {Salmonella typhimurium} SCOP: a.4.1.9 a.121.1.1 Back     alignment and structure
>2xdn_A HTH-type transcriptional regulator TTGR; transcription regulation, TETR family; 2.20A {Pseudomonas putida} PDB: 2uxu_A* 2uxi_A* 2uxo_A* 2uxp_A* 2uxh_A* Back     alignment and structure
>2ras_A Transcriptional regulator, TETR family; bacterial regulatory proteins, DNA-binding, DNA binding 3-helical bundle fold; 1.80A {Novosphingobium aromaticivorans} Back     alignment and structure
>1bl0_A Protein (multiple antibiotic resistance protein), DNA (5'- D(*CP*CP*GP*AP*TP*GP*CP*CP*AP*CP*GP*TP*TP*TP*TP*GP*CP*TP*AP *AP*AP*TP* CP*C)-3')...; transcriptional activator; HET: DNA; 2.30A {Escherichia coli} SCOP: a.4.1.8 a.4.1.8 PDB: 1xs9_A Back     alignment and structure
>3szp_A Transcriptional regulator, LYSR family; winged helix-turn helix, DNA-binding, transcription factor; 2.20A {Vibrio cholerae} PDB: 3t1b_B Back     alignment and structure
>1o5l_A Transcriptional regulator, CRP family; TM1171, structural GE JCSG, PSI, protein structure initiative, joint center for S genomics; 2.30A {Thermotoga maritima} SCOP: b.82.3.2 Back     alignment and structure
>2oi8_A Putative regulatory protein SCO4313; TETR, structural genomics, PSI-2, P structure initiative; 2.50A {Streptomyces coelicolor} SCOP: a.4.1.9 a.121.1.1 Back     alignment and structure
>2hzt_A Putative HTH-type transcriptional regulator YTCD; DNA-binding protein, HTH-type transcription regulators, structural genomics, PSI-2; HET: CSU MSE; 2.00A {Bacillus subtilis} SCOP: a.4.5.69 Back     alignment and structure
>3bqy_A Putative TETR family transcriptional regulator; structural genomics, strept coelicolor, PSI-2, protein structure initiative; 1.95A {Streptomyces coelicolor A3} Back     alignment and structure
>2of7_A Putative TETR-family transcriptional regulator; APC7240, streptomyces coelicolor A3, structural genomics, PSI-2; 2.30A {Streptomyces coelicolor} Back     alignment and structure
>2iai_A Putative transcriptional regulator SCO3833; structural genomics, TETR, unknow function, PSI-2, protein structure initiative; 1.65A {Streptomyces coelicolor} Back     alignment and structure
>3f6o_A Probable transcriptional regulator, ARSR family protein; transcriptional regulator,RHA00566,MCSG, structural genomics, PSI-2; 1.90A {Rhodococcus SP} Back     alignment and structure
>2xrn_A HTH-type transcriptional regulator TTGV; DNA-binding protein, tetramer gene regulator, cooperative DN binding, multidrug binding protein; 2.90A {Pseudomonas putida} PDB: 2xro_A Back     alignment and structure
>3c07_A Putative TETR-family transcriptional regulator; APC6322, structural GEN PSI-2, protein structure initiative; 2.70A {Streptomyces coelicolor A3} SCOP: a.4.1.9 a.121.1.1 PDB: 2ofl_A* Back     alignment and structure
>4b8x_A SCO5413, possible MARR-transcriptional regulator; winged helix motif; HET: CME; 1.25A {Streptomyces coelicolor} Back     alignment and structure
>1sgm_A Putative HTH-type transcriptional regulator YXAF; structural genomics, PSI, protein structure initiative; 2.00A {Bacillus subtilis} SCOP: a.4.1.9 a.121.1.1 Back     alignment and structure
>1ixc_A CBNR, LYSR-type regulatory protein; long alpha helix connecting DNA binding and regulatory domai binding protein; 2.20A {Cupriavidus necator} SCOP: a.4.5.37 c.94.1.1 PDB: 1iz1_A Back     alignment and structure
>3cdl_A Transcriptional regulator AEFR; APC88582, TETR, pseudomonas syringae PV. tomato STR. DC3000, structural genomics, PSI-2; HET: MSE; 2.36A {Pseudomonas syringae PV} Back     alignment and structure
>1r8e_A Multidrug-efflux transporter regulator; protein-DNA complex, MERR-family transcription activator, MU binding protein; HET: P4P; 2.40A {Bacillus subtilis} SCOP: a.6.1.3 d.60.1.1 PDB: 1exi_A* 1exj_A* 3iao_A 3q5p_A* 3d71_A* 3q3d_A* 3q1m_A* 3q2y_A* 3q5r_A* 3q5s_A* 3d70_A 3d6z_A* 3d6y_A* 1bow_A 2bow_A* Back     alignment and structure
>3hta_A EBRA repressor; TETR family, DNA binding protein, multidrug resistance, MULT binding protein, DNA-binding, transcription; 2.30A {Streptomyces lividans} PDB: 3hth_A* 3hti_A* 3htj_A* 3iuv_A Back     alignment and structure
>2f2e_A PA1607; transcription factor, helix-TRUN-helix, APC5613, structural genomics, PSI, protein structure initiative; HET: GLC; 1.85A {Pseudomonas aeruginosa} SCOP: a.4.5.69 Back     alignment and structure
>2esn_A Probable transcriptional regulator; PA0477, APC5828,transcription, PSI, protein struc initiative, MCSG; 2.10A {Pseudomonas aeruginosa} SCOP: a.4.5.37 c.94.1.1 Back     alignment and structure
>1y6u_A XIS, excisionase from transposon TN916; structure, DNA architectural protein, tyrosine recombinase, winged-helix protein; NMR {Enterococcus faecalis} Back     alignment and structure
>3hhg_A Transcriptional regulator, LYSR family; transcription factor, structur genomics, oxford protein production facility, OPPF; 3.20A {Neisseria meningitidis serogroup B} Back     alignment and structure
>2xpw_A Tetracycline repressor protein class D; transcription, transcription regulator, helix-turn-helix, ME coordination; HET: OTC MES; 1.44A {Escherichia coli} PDB: 1bjy_A* 1bj0_A 1du7_A* 1ork_A* 2fj1_A* 1bjz_A* 2o7o_A* 2x6o_A* 2x9d_A* 2xps_A* 2xpt_A* 2vke_A* 2xpu_A* 2xpv_A* 2tct_A* 2xb5_A* 2trt_A* 2xrl_A* 1qpi_A* 1a6i_A ... Back     alignment and structure
>2opt_A Actii protein; helical protein, TETR family, APO-protein, transcriptional R transcription; 2.05A {Streptomyces coelicolor} PDB: 3b6a_A* 3b6c_A* Back     alignment and structure
>3hrs_A Metalloregulator SCAR; DTXR/MNTR family member, transcription; 2.70A {Streptococcus gordonii} PDB: 3hrt_A 3hru_A Back     alignment and structure
>2fbq_A Probable transcriptional regulator; PA3006, APC5893, structural genom protein structure initiative; 1.80A {Pseudomonas aeruginosa} SCOP: a.4.1.9 a.121.1.1 Back     alignment and structure
>3qp6_A CVIR transcriptional regulator; quorum sensing, agonist, antagonist, LUXR, acylated homoseri lactone, transcription factor; HET: HL6; 2.00A {Chromobacterium violaceum} PDB: 3qp5_A* Back     alignment and structure
>1l9z_H Sigma factor SIGA; helix-turn-helix, coiled-coil, transcription/DNA complex; 6.50A {Thermus aquaticus} SCOP: i.8.1.1 Back     alignment and structure
>2hyj_A Putative TETR-family transcriptional regulator; HTH DNA binding motif, structural genomics, PSI-2, Pro structure initiative; 2.19A {Streptomyces coelicolor} SCOP: a.4.1.9 a.121.1.1 Back     alignment and structure
>3boq_A Transcriptional regulator, MARR family; MARR famil structural genomics, PSI-2, protein structure initiative; 2.39A {Silicibacter pomeroyi dss-3} Back     alignment and structure
>2hxi_A Putative transcriptional regulator; structural genomics, APC6293, TET streptomyces coelicolor A3(2), PSI-2; 1.70A {Streptomyces coelicolor} Back     alignment and structure
>3u2r_A Regulatory protein MARR; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, helix-turn-helix; 2.20A {Planctomyces limnophilus} Back     alignment and structure
>1u3e_M HNH homing endonuclease; HNH catalytic motif, helix-turn-helix DNA binding domain, PR complex, DNA binding protein-DNA complex; 2.92A {Bacillus phage SPO1} SCOP: d.4.1.3 d.285.1.1 Back     alignment and structure
>4ich_A Transcriptional regulator; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, transcription RE; 1.95A {Saccharomonospora viridis} Back     alignment and structure
>2ijl_A AGR_C_4647P, molybdenum-binding transcriptional repressor; structural GE DNA-binding protein, PSI-2, PROT structure initiative; 2.30A {Agrobacterium tumefaciens str} Back     alignment and structure
>1iuf_A Centromere ABP1 protein; riken structural genomics/proteomics initiative, RSGI, structural genomics, DNA binding protein; NMR {Schizosaccharomyces pombe} SCOP: a.4.1.7 a.4.1.7 Back     alignment and structure
>3cta_A Riboflavin kinase; structural genomics, transferase, PSI-2, protein structure initiative; 2.20A {Thermoplasma acidophilum dsm 1728} SCOP: a.4.5.28 b.43.5.2 Back     alignment and structure
>2k4b_A Transcriptional regulator; DNA binding protein, winged helix; NMR {Lactococcus lactis subsp} Back     alignment and structure
>2g7g_A RHA04620, putative transcriptional regulator; helix-turn-helix, structural genomics, PSI, protein structur initiative; 2.01A {Rhodococcus SP} SCOP: a.4.1.9 a.121.1.1 Back     alignment and structure
>1sd4_A Penicillinase repressor; BLAI, MECI, methicillin, B-lactam, DNA binding PR; 2.00A {Staphylococcus aureus} SCOP: a.4.5.39 PDB: 1xsd_A Back     alignment and structure
>3fxq_A LYSR type regulator of TSAMBCD; transcriptional regulator, LTTR, TSAR, WHTH, DNA- transcription, transcription regulation; 1.85A {Comamonas testosteroni} PDB: 3fxr_A* 3fxu_A* 3fzj_A 3n6t_A 3n6u_A* Back     alignment and structure
>3aqt_A Bacterial regulatory proteins, TETR family; helix-turn-helix, all alpha, transcription, transcription RE transcription regulator; 2.50A {Corynebacterium glutamicum} PDB: 3aqs_A Back     alignment and structure
>1bia_A BIRA bifunctional protein; transcription regulation; 2.30A {Escherichia coli} SCOP: a.4.5.1 b.34.1.1 d.104.1.2 PDB: 1bib_A* 1hxd_A* 2ewn_A* Back     alignment and structure
>1l0o_C Sigma factor; bergerat fold, helix-turn-helix, protein binding; HET: ADP; 2.90A {Geobacillus stearothermophilus} SCOP: a.4.13.2 Back     alignment and structure
>1v4r_A Transcriptional repressor; helix-turn-helix, winged-helix, gene regulation; NMR {Streptomyces} SCOP: a.4.5.6 Back     alignment and structure
>1z0x_A Transcriptional regulator, TETR family; structural genomics, PSI, P structure initiative; 2.40A {Enterococcus faecalis} SCOP: a.4.1.9 a.121.1.1 Back     alignment and structure
>2b0l_A GTP-sensing transcriptional pleiotropic repressor; CODY, DNA-binding, nucleotide-binding, transcript regulation, winged HTH motif.; 2.90A {Bacillus subtilis} SCOP: a.4.5.66 Back     alignment and structure
>4hku_A LMO2814 protein, TETR transcriptional regulator; structural genomics, PSI-biology; 2.30A {Listeria monocytogenes} Back     alignment and structure
>1rr7_A Middle operon regulator; MOR, transcription; 2.20A {Enterobacteria phage MU} SCOP: a.4.1.14 Back     alignment and structure
>2qko_A Possible transcriptional regulator, TETR family P; TETR family protein, structural genomics, P protein structure initiative; 2.35A {Rhodococcus SP} Back     alignment and structure
>1k78_A Paired box protein PAX5; paired domain, ETS domain, transcription factor, transcription/DNA complex; 2.25A {Homo sapiens} SCOP: a.4.1.5 a.4.1.5 PDB: 1mdm_A 6pax_A Back     alignment and structure
>2iu5_A DHAS, YCEG, HTH-type dhaklm operon transcriptional activator; synthase, TETR family; 1.6A {Lactococcus lactis subsp} SCOP: a.4.1.9 a.121.1.1 Back     alignment and structure
>2og0_A Excisionase; protein-DNA complex, DNA architectural protein, 'winged'HELI protein, phage excision; 1.90A {Enterobacteria phage lambda} SCOP: a.6.1.7 PDB: 1lx8_A 1rh6_A 2ief_A Back     alignment and structure
>3ni7_A Bacterial regulatory proteins, TETR family; transcriptional regulator, structural genomics, PSI-2, structure initiative; HET: MSE; 2.78A {Nitrosomonas europaea} Back     alignment and structure
>3him_A Probable transcriptional regulator; TETR, bacterial, RHA1, PSI-2, MCSG, structural midwest center for structural genomics; 2.20A {Rhodococcus jostii} Back     alignment and structure
>4ham_A LMO2241 protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, winged helix-turn-helix, four helix bundle; 1.91A {Listeria monocytogenes} Back     alignment and structure
>2y2z_A SIM16, SIMR, putative repressor simreg2; transcription, simocyclinone regulator, TETR-family; 1.95A {Streptomyces antibioticus} PDB: 2y30_A* 2y31_A* 3zql_A Back     alignment and structure
>3nrg_A TETR family transcriptional regulator; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 2.56A {Chloroflexus aurantiacus} Back     alignment and structure
>2o0y_A Transcriptional regulator; ICLR-family, structural genomics, protein structure initiative, midwest center for structural genomics, MCSG; 2.00A {Rhodococcus SP} Back     alignment and structure
>3ccy_A Putative TETR-family transcriptional regulator; APC88698, structural G PSI-2, protein structure initiative; HET: MSE; 2.01A {Bordetella parapertussis 12822} Back     alignment and structure
>3tqn_A Transcriptional regulator, GNTR family; regulatory functions; 2.80A {Coxiella burnetii} Back     alignment and structure
>2g9w_A Conserved hypothetical protein; DNA-binding domain, bacterial transcription repressor, DNA B protein; 1.80A {Mycobacterium tuberculosis} SCOP: a.4.5.39 Back     alignment and structure
>2g7u_A Transcriptional regulator; ICLR family, structural genomics, PSI, protein structure initiative, midwest center for struc genomics; 2.30A {Rhodococcus SP} Back     alignment and structure
>2g7l_A TETR-family transcriptional regulator; APC6062, protein structure initiativ midwest center for structural genomics, MCSG; 2.10A {Streptomyces coelicolor} SCOP: a.4.1.9 a.121.1.1 Back     alignment and structure
>3f6v_A Possible transcriptional regulator, ARSR family protein; probable transcriptional repressor ARSR family, structural genomics, PSI-2; 1.48A {Rhodococcus SP} Back     alignment and structure
>2np3_A Putative TETR-family regulator; transcriptional regulator, structural genomics, PSI-2, structure initiative; HET: MSE; 2.35A {Streptomyces coelicolor} SCOP: a.4.1.9 a.121.1.1 Back     alignment and structure
>2fd5_A Transcriptional regulator; DNA-binding protein, structural G PSI, protein structure initiative, midwest center for struc genomics, MCSG; 1.70A {Pseudomonas aeruginosa} SCOP: a.4.1.9 a.121.1.1 Back     alignment and structure
>3on2_A Probable transcriptional regulator; protein structure initiative, PSI-2, structural genomics, MI center for structural genomics, MCSG; HET: MSE PG6; 1.96A {Rhodococcus jostii} Back     alignment and structure
>3fiw_A Putative TETR-family transcriptional regulator; TETR-family transcriptional regulator streptomyces, structur genomics, PSI-2; 2.20A {Streptomyces coelicolor} Back     alignment and structure
>2vn2_A DNAD, chromosome replication initiation protein; DNA replication, primosome; 2.3A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>3isp_A HTH-type transcriptional regulator RV1985C/MT2039; ROD shaped structure, DNA binding domain, regulatory domain, DNA-binding; 2.70A {Mycobacterium tuberculosis} Back     alignment and structure
>3lsj_A DEST; transcriptional repressor, TETR family, DNA-binding, transcription, transcription regulation; HET: PLM COA; 2.30A {Pseudomonas aeruginosa} PDB: 3lsp_A* 3lsr_A* Back     alignment and structure
>3neu_A LIN1836 protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG, unknown function; 1.58A {Listeria innocua} Back     alignment and structure
>2vpr_A Tetracycline resistance repressor protein; transcription, metal-binding, antibiotic resistance, transcr regulator; HET: TDC; 2.49A {Pasteurella multocida} Back     alignment and structure
>4ac0_A Tetracycline repressor protein class B from trans TN1 0; transcription; HET: MIY; 2.45A {Escherichia coli} Back     alignment and structure
>2fbk_A Transcriptional regulator, MARR family; winged-helix-turn-helix; 2.30A {Deinococcus radiodurans} SCOP: a.4.5.28 Back     alignment and structure
>2y75_A HTH-type transcriptional regulator CYMR; DNA binding protein; 2.00A {Bacillus subtilis} Back     alignment and structure
>2fsw_A PG_0823 protein; alpha-beta structure, helix-turn-helix, winged-helix-turn-HE structural genomics, PSI, protein structure initiative; HET: MSE; 2.16A {Porphyromonas gingivalis} SCOP: a.4.5.69 Back     alignment and structure
>3gbg_A TCP pilus virulence regulatory protein; cupin, helix-turn-helix, ARAC family, activator, DNA-binding transcription, transcription regulation; HET: PAM; 1.90A {Vibrio cholerae} Back     alignment and structure
>1fx7_A Iron-dependent repressor IDER; DTXR, iron-dependent regulator, signaling protein; 2.00A {Mycobacterium tuberculosis} SCOP: a.4.5.24 a.76.1.1 b.34.1.2 PDB: 1u8r_A Back     alignment and structure
>3mq0_A Transcriptional repressor of the blcabc operon; helix-turn-helix, GAF fold, transcription repressor; 1.79A {Agrobacterium tumefaciens} Back     alignment and structure
>3r4k_A Transcriptional regulator, ICLR family; DNA/RNA-binding 3-helical bundle, profilin-like, structural joint center for structural genomics, JCSG; 2.46A {Ruegeria SP} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 82
d1y7ya169 a.35.1.3 (A:5-73) Restriction-modification control 7e-10
d2b5aa177 a.35.1.3 (A:1-77) Regulatory protein C.BclI {Bacil 5e-08
d1utxa_66 a.35.1.3 (A:) Putative transcription regulator Cyl 1e-07
d2r1jl166 a.35.1.2 (L:3-68) P22 C2 repressor, DNA-binding do 1e-06
d1y9qa179 a.35.1.8 (A:4-82) Probable transcriptional regulat 1e-06
d1b0na268 a.35.1.3 (A:1-68) SinR repressor, DNA-binding doma 3e-06
d2croa_65 a.35.1.2 (A:) cro 434 {Bacteriophage 434 [TaxId: 1 6e-05
d2ppxa162 a.35.1.3 (A:30-91) Uncharacterized protein Atu1735 1e-04
d1r69a_63 a.35.1.2 (A:) 434 C1 repressor, DNA-binding domain 6e-04
d2auwa167 a.35.1.10 (A:88-154) Hypothetical protein NE0471 C 8e-04
>d1y7ya1 a.35.1.3 (A:5-73) Restriction-modification controller protein C.AhdI {Aeromonas hydrophila [TaxId: 644]} Length = 69 Back     information, alignment and structure

class: All alpha proteins
fold: lambda repressor-like DNA-binding domains
superfamily: lambda repressor-like DNA-binding domains
family: SinR domain-like
domain: Restriction-modification controller protein C.AhdI
species: Aeromonas hydrophila [TaxId: 644]
 Score = 47.8 bits (114), Expect = 7e-10
 Identities = 11/54 (20%), Positives = 23/54 (42%)

Query: 23 RQIQRARLGKKMSQPDLANQINQRPQVVSEYENGKAVPNQTVLAKMEKAIGVKL 76
          ++++  R  K +SQ  LA         V   E G+   +   + K+  A+ ++ 
Sbjct: 12 QRLRELRTAKGLSQETLAFLSGLDRSYVGGVERGQRNVSLVNILKLATALDIEP 65


>d2b5aa1 a.35.1.3 (A:1-77) Regulatory protein C.BclI {Bacillus caldolyticus [TaxId: 1394]} Length = 77 Back     information, alignment and structure
>d1utxa_ a.35.1.3 (A:) Putative transcription regulator CylR2 {Enterococcus faecalis [TaxId: 1351]} Length = 66 Back     information, alignment and structure
>d2r1jl1 a.35.1.2 (L:3-68) P22 C2 repressor, DNA-binding domain {Salmonella bacteriophage P22 [TaxId: 10754]} Length = 66 Back     information, alignment and structure
>d1y9qa1 a.35.1.8 (A:4-82) Probable transcriptional regulator VC1968, N-terminal domain {Vibrio cholerae [TaxId: 666]} Length = 79 Back     information, alignment and structure
>d1b0na2 a.35.1.3 (A:1-68) SinR repressor, DNA-binding domain {Bacillus subtilis [TaxId: 1423]} Length = 68 Back     information, alignment and structure
>d2croa_ a.35.1.2 (A:) cro 434 {Bacteriophage 434 [TaxId: 10712]} Length = 65 Back     information, alignment and structure
>d2ppxa1 a.35.1.3 (A:30-91) Uncharacterized protein Atu1735 {Agrobacterium tumefaciens [TaxId: 358]} Length = 62 Back     information, alignment and structure
>d1r69a_ a.35.1.2 (A:) 434 C1 repressor, DNA-binding domain {Bacteriophage 434 [TaxId: 10712]} Length = 63 Back     information, alignment and structure
>d2auwa1 a.35.1.10 (A:88-154) Hypothetical protein NE0471 C-terminal domain {Nitrosomonas europaea [TaxId: 915]} Length = 67 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query82
d1y7ya169 Restriction-modification controller protein C.AhdI 99.81
d2r1jl166 P22 C2 repressor, DNA-binding domain {Salmonella b 99.79
d1x57a178 Endothelial differentiation-related factor 1, EDF1 99.78
d1b0na268 SinR repressor, DNA-binding domain {Bacillus subti 99.78
d1y9qa179 Probable transcriptional regulator VC1968, N-termi 99.78
d1utxa_66 Putative transcription regulator CylR2 {Enterococc 99.78
d2b5aa177 Regulatory protein C.BclI {Bacillus caldolyticus [ 99.77
d2croa_65 cro 434 {Bacteriophage 434 [TaxId: 10712]} 99.77
d1r69a_63 434 C1 repressor, DNA-binding domain {Bacteriophag 99.75
d2icta187 Antitoxin HigA {Escherichia coli [TaxId: 562]} 99.75
d1lmb3_87 lambda C1 repressor, DNA-binding domain {Bacteriop 99.74
d2a6ca169 HTH-motif protein NE1354 {Nitrosomonas europaea [T 99.72
d2o38a189 Hypothetical protein RPA3824 {Rhodopseudomonas pal 99.68
d2ofya182 Putative transcriptional regulator RHA1_ro04071 {R 99.67
d2ppxa162 Uncharacterized protein Atu1735 {Agrobacterium tum 99.62
d2auwa167 Hypothetical protein NE0471 C-terminal domain {Nit 99.47
d2bnma171 Hydroxypropylphosphonic acid epoxidase Fom4, N-ter 98.63
d2hsga157 Glucose-resistance amylase regulator CcpA, N-termi 98.53
d1efaa159 Lac repressor (LacR), N-terminal domain {Escherich 98.45
d1qpza157 Purine repressor (PurR), N-terminal domain {Escher 98.4
d1dwka186 Cyanase N-terminal domain {Escherichia coli [TaxId 98.26
d1uxda_59 Fructose repressor (FruR), N-terminal domain {Esch 98.23
d1ic8a294 Hepatocyte nuclear factor 1a (LFB1/HNF1) {Human (H 98.04
d1nera_74 Ner {Bacteriophage mu [TaxId: 10677]} 97.92
d1ijwc_47 HIN recombinase (DNA-binding domain) {Synthetic} 97.88
d2awia165 PrgX {Enterococcus faecalis [TaxId: 1351]} 97.61
d1e3oc275 Oct-1 {Human (Homo sapiens) [TaxId: 9606]} 97.52
d1au7a272 Pit-1 {Rat (Rattus norvegicus) [TaxId: 10116]} 97.32
d1gdta143 gamma,delta resolvase (C-terminal domain) {Escheri 97.31
d1hlva166 DNA-binding domain of centromere binding protein B 97.3
d2jn6a189 Uncharacterized protein Cgl2762 {Corynebacterium g 97.23
d1s4ka_120 Putative cytoplasmic protein YdiL {Salmonella typh 97.17
d1vz0a193 Putative partitioning protein ParB/Spo0J {Thermus 97.08
d1z05a171 Transcriptional regulator VC2007 N-terminal domain 97.03
d1z6ra170 Mlc protein N-terminal domain {Escherichia coli [T 96.83
d1biaa163 Biotin repressor, N-terminal domain {Escherichia c 96.71
d2csfa188 DNA-binding protein SATB2 {Human (Homo sapiens) [T 96.67
d1j5ya165 Putative transcriptional regulator TM1602, N-termi 96.61
d1umqa_60 Photosynthetic apparatus regulatory protein PprA ( 96.59
d1r71a_114 Transcriptional repressor protein KorB DNA-binding 96.59
d1i5za169 Catabolite gene activator protein (CAP), C-termina 96.58
d2cfxa163 Transcriptional regulator LrpC {Bacillus subtilis 96.51
d2hoea162 N-acetylglucosamine kinase {Thermotoga maritima [T 96.36
d3e5ua180 Chlorophenol reduction protein CprK {Desulfitobact 96.31
d2o4aa183 DNA-binding protein SATB1 {Human (Homo sapiens) [T 96.3
d2gaua181 Transcriptional regulator PG0396, C-terminal domai 96.26
d2cg4a163 Regulatory protein AsnC {Escherichia coli [TaxId: 96.24
d1p4wa_87 Transcriptional regulator RcsB {Erwinia amylovora 96.23
d2ox6a1162 Hypothetical protein SO3848 {Shewanella oneidensis 96.21
d1k78a163 Pax-5 {Human (Homo sapiens) [TaxId: 9606]} 96.17
d1i1ga160 LprA {Archaeon Pyrococcus furiosus [TaxId: 2261]} 96.15
d1zyba173 Probable transcription regulator BT4300, C-termina 96.14
d2cyya160 Putative transcriptional regulator PH1519 {Archaeo 96.11
d1rp3a271 Sigma factor sigma-28 (FliA) {Aquifex aeolicus [Ta 96.08
d2ao9a1120 Phage protein BC1890 {Bacillus cereus [TaxId: 1396 96.06
d1a04a167 Nitrate/nitrite response regulator (NarL) {Escheri 96.01
d1ft9a180 CO-sensing protein CooA, C-terminal domain {Rhodos 96.0
d1etxa_89 FIS protein {Escherichia coli [TaxId: 562]} 95.96
d1s7ea280 Hepatocyte nuclear factor 6 {Mouse (Mus musculus) 95.9
d2zcwa182 Transcriptional regulator TTHA1359, C-terminal dom 95.87
d1fsea_67 Germination protein GerE {Bacillus subtilis [TaxId 95.65
d1l3la165 Quorum-sensing transcription factor TraR, C-termin 95.62
d2bgca1100 Listeriolysin regulatory protein PrfA, C-terminal 95.54
d1rzsa_61 cro p22 {Bacteriophage p22 [TaxId: 10754]} 95.53
d1v7ba174 Transcriptional regulator Cgl2612 {Corynebacterium 95.44
d2d1ha1109 Hypothetical transcriptional regulator ST1889 {Sul 95.42
d2g7ga165 Putative transcriptional regulator Rha04620 {Rhodo 95.41
d1q06a_127 Transcriptional regulator CueR {Escherichia coli [ 95.37
d1or7a168 SigmaE factor (RpoE) {Escherichia coli [TaxId: 562 95.33
d1g2ha_61 Transcriptional regulator TyrR, C-terminal domain 95.3
d1ku3a_61 Sigma70 (SigA, RpoD) {Thermus aquaticus [TaxId: 27 95.15
d2o3fa183 Putative transcriptional regulator YbbH {Bacillus 95.15
d1r8da_109 Multidrug transporter activator MtaN {Bacillus sub 95.14
d1jt6a171 Multidrug binding protein QacR {Staphylococcus aur 95.13
d1z0xa168 Transcriptional regulator EF0787 {Enterococcus fae 95.13
d1j9ia_68 Terminase gpNU1 subunit domain {Bacteriophage lamb 95.11
d2fbqa179 Transcriptional regulator PsrA {Pseudomonas aerugi 95.09
d1pdnc_123 Paired protein (prd) {Fruit fly (Drosophila melano 95.08
d3ctaa185 Ta1064 (RFK), N-terminal domain {Thermoplasma acid 95.08
d2g7sa174 Putative transcriptional regulator Atu0279 {Agroba 95.06
d1ntca_91 DNA-binding domain of NTRC {Salmonella typhimurium 95.03
d2i10a169 Putative transcriptional regulator RHA1_ro09068 {R 95.0
d2vkva162 Tetracyclin repressor (Tet-repressor, TetR) {Esche 94.97
d1t56a173 Ethr repressor {Mycobacterium tuberculosis [TaxId: 94.96
d1s7oa_106 Hypothetical protein SPy1201 {Streptococcus pyogen 94.91
d2a61a1139 Transcriptional regulator TM0710 {Thermotoga marit 94.89
d1jhga_101 Trp repressor, TrpR {Escherichia coli [TaxId: 562] 94.89
d1mkma175 Transcriptional regulator IclR, N-terminal domain 94.88
d1x2la187 Homeobox protein Cux-2, CUTL2 {Human (Homo sapiens 94.88
d1wh8a_111 Homeobox protein Cux-2, CUTL2 {Human (Homo sapiens 94.88
d2gena170 Probable transcriptional regulator PA1836 {Pseudom 94.85
d2p7vb168 Sigma70 (SigA, RpoD) {Escherichia coli [TaxId: 562 94.83
d2np5a169 Transcriptional regulator RHA1_ro04179 {Rhodococcu 94.82
d2gfna177 Probable transcriptional regulator RHA1_ro04631 {R 94.8
d2d6ya168 Putative regulator SCO4008 {Streptomyces coelicolo 94.73
d1yioa170 Response regulatory protein StyR, C-terminal domai 94.73
d1sfxa_109 Hypothetical protein AF2008 {Archaeoglobus fulgidu 94.65
d2id6a175 Transcriptional regulator TM1030 {Thermotoga marit 94.62
d2fx0a173 Hemolysin II regulatory protein, HlyIIR {Bacillus 94.5
d2o7ta178 Transcriptional regulator Cgl1640/Cg1846 {Coryneba 94.48
d1r8ea1118 Transcription activator BmrR {Bacillus subtilis [T 94.48
d2ev0a161 Manganese transport regulator MntR {Bacillus subti 94.39
d2id3a168 Putative transcriptional regulator SCO5951 {Strept 94.32
d1pb6a172 Hypothetical transcriptional regulator YcdC {Esche 94.23
d2fq4a169 Transcriptional regulator BC3163 {Bacillus cereus 94.23
d1vi0a172 Hypothetical transcriptional regulator YsiA {Bacil 94.14
d2oi8a179 Putative regulatory protein Sco4313 {Streptomyces 94.13
d1xsva_106 Hypothetical protein SAV1236 {Staphylococcus aureu 94.12
d2hkua170 Putative transcriptional regulator RHA1_ro03468 {R 94.07
d2hyja175 Putative transcriptional regulator SCO4940 {Strept 94.03
d3c07a175 Putative transcriptional regulator SCO4850 {Strept 94.01
d1ui5a171 A-factor receptor homolog CprB {Streptomyces coeli 94.01
d1zs4a178 Regulatory protein cII {Bacteriophage lambda [TaxI 93.94
d1rkta181 Hypothetical transcriptional regulator YfiR {Bacil 93.8
d1nr3a_122 DNA-binding protein Tfx {Archaeon Methanobacterium 93.76
d3broa1135 Transcriptional regulator OEOE1854 {Oenococcus oen 93.71
d1lnwa_141 MexR repressor {Pseudomonas aeruginosa [TaxId: 287 93.69
d1d1la_61 cro lambda repressor {Bacteriophage lambda [TaxId: 93.67
d2etha1140 Putative transcriptional regulator TM0816 {Thermot 93.65
d1bl0a154 MarA {Escherichia coli [TaxId: 562]} 93.62
d1wh6a_101 Homeobox protein Cux-2, CUTL2 {Human (Homo sapiens 93.55
d1lj9a_144 Transcriptional regulator SlyA {Enterococcus faeca 93.54
d2g3ba172 Putative transcriptional regulator {Rhodococcus sp 93.49
d1ttya_87 Sigma70 (SigA, RpoD) {Thermotoga maritima [TaxId: 93.29
d2isya163 Iron-dependent regulator IdeR {Mycobacterium tuber 93.29
d1zk8a172 Transcriptional regulator BC5000 {Bacillus cereus 93.17
d2g7la168 Putative transcriptional regulator SCO7704 {Strept 93.07
d1z91a1137 Organic hydroperoxide resistance transcriptional r 92.87
d1jgsa_138 Multiple antibiotic resistance repressor, MarR {Es 92.73
d1ub9a_100 Hypothetical protein PH1061 {Archaeon Pyrococcus h 92.55
d2hr3a1145 Probable transcriptional regulator PA3067 {Pseudom 92.36
d2fbia1136 Probable transcriptional regulator PA4135 {Pseudom 92.12
d1s3ja_143 Putative transcriptional regulator YusO {Bacillus 92.08
d1ixca189 LysR-type regulatory protein CbnR {Ralstonia eutro 92.06
d1tc3c_51 Transposase tc3a1-65 {Caenorhabditis elegans [TaxI 91.9
d2np3a165 Putative transcriptional regulator SCO0857 {Strept 91.56
d1d5ya154 Rob transcription factor, N-terminal domain {Esche 91.55
d1u2wa1108 Cadmium efflux system accessory protein CadC {Stap 91.41
d2fbha1137 Transcriptional regulator PA3341 {Pseudomonas aeru 91.29
d1sgma173 Putative transcriptional regulator YxaF {Bacillus 91.18
d2fxaa1162 Protease production regulatory protein Hpr {Bacill 91.04
d1ku9a_151 DNA-binding protein Mj223 {Archaeon Methanococcus 90.96
d1jhfa171 LexA repressor, N-terminal DNA-binding domain {Esc 90.93
d2esna189 Probable LysR-type transcriptional regulator PA047 90.8
d2bv6a1136 Transcriptional regulator MgrA {Staphylococcus aur 90.79
d2fd5a176 Probable transcriptional regulator PA3133 {Pseudom 90.71
d2iu5a171 Transcriptional activator DhaS {Lactococcus lactis 90.61
d1t33a188 Putative transcriptional repressor YbiH {Salmonell 90.28
d1hw1a174 Fatty acid responsive transcription factor FadR, N 89.96
d1wh7a_80 ZF-HD homeobox protein At4g24660 {Thale cress (Ara 89.89
d1s7ea150 Hepatocyte nuclear factor 6 {Mouse (Mus musculus) 89.87
d1r1ua_94 Metal-sensing transcriptional repressor CzrA {Stap 89.79
d1r1ta_98 SmtB repressor {Cyanobacteria (Synechococcus), pcc 89.66
d3deua1140 Transcriptional regulator SlyA {Salmonella typhimu 89.24
d2frha1115 Pleiotropic regulator of virulence genes, SarA {St 88.85
d1ig7a_58 Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10 88.59
d1le8a_53 Mating type protein A1 Homeodomain {Baker's yeast 88.54
d1bl0a262 MarA {Escherichia coli [TaxId: 562]} 88.53
d1b9ma1127 N-terminal domain of molybdate-dependent transcrip 88.2
d2cqxa159 LAG1 longevity assurance homolog 5, LASS5 {Mouse ( 87.81
d3bwga178 Transcriptional regulator YydK {Bacillus subtilis 87.79
d1ulya_ 190 Hypothetical protein PH1932 {Pyrococcus horikoshii 87.62
d2dt5a174 Transcriptional repressor Rex, N-terminal domain { 87.57
d1p4xa2125 Staphylococcal accessory regulator A homolog, SarS 87.54
d1vnda_77 VND/NK-2 protein {Fruit fly (Drosophila melanogast 87.35
d1rr7a_94 Middle operon regulator, Mor {Bacteriophage Mu [Ta 87.08
d1rp3a177 Sigma factor sigma-28 (FliA) {Aquifex aeolicus [Ta 87.07
d1p7ia_53 Engrailed Homeodomain {Drosophila melanogaster [Ta 86.71
d2hs5a169 Putative transcriptional regulator RHA1_ro03477 {R 86.71
d1hsja1115 Staphylococcal accessory regulator A homolog, SarR 86.67
d1jgga_57 Even-skipped homeodomain {Fruit fly (Drosophila me 86.51
d1zq3p167 Homeotic bicoid protein {Fruit fly (Drosophila mel 86.03
d1aisb198 Transcription factor IIB (TFIIB), core domain {Arc 85.68
d1x2ma152 Lag1 longevity assurance homolog 6, LASS6 {Mouse ( 85.61
d1e3oc157 Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId 85.3
d2craa158 Homeobox protein hox-b13 {Human (Homo sapiens) [Ta 84.67
d1au7a158 Pit-1 POU homeodomain {Rat (Rattus norvegicus) [Ta 84.65
d1bw5a_66 Insulin gene enhancer protein isl-1 {Rat (Rattus n 84.65
d2e1oa157 Homeobox protein prh {Human (Homo sapiens) [TaxId: 84.37
d1b72a_88 Homeobox protein hox-b1 {Human (Homo sapiens) [Tax 84.05
d1sfua_70 34L {Yaba-like disease virus, YLDV [TaxId: 132475] 83.91
d1wi3a_71 DNA-binding protein SATB2 {Human (Homo sapiens) [T 83.81
d1fjla_65 Paired protein {Fruit fly (Drosophila melanogaster 83.78
d1vola195 Transcription factor IIB (TFIIB), core domain {Hum 83.57
d1x2na162 Homeobox protein pknox1 {Human (Homo sapiens) [Tax 83.47
d2cuea168 Paired box protein pax6 {Human (Homo sapiens) [Tax 83.26
d2p4wa1 194 Transcriptional regulatory protein PF1790 {Pyrococ 83.22
d1pufb_73 pbx1 {Human (Homo sapiens) [TaxId: 9606]} 83.09
d1k61a_60 mat alpha2 Homeodomain {Baker's yeast (Saccharomyc 82.88
d1ftta_68 Thyroid transcription factor 1 homeodomain {Rat (R 82.56
d9anta_56 Antennapedia Homeodomain {Drosophila melanogaster 82.37
d1yz8p160 Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 82.32
d1ocpa_67 Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId 81.78
d1xd7a_127 Hypothetical protein ywnA {Bacillus subtilis [TaxI 81.22
d2fbka1172 Transcriptional regulator DR1159 {Deinococcus radi 80.67
d2ecba176 Zinc fingers and homeoboxes protein 1, ZHX1 {Human 80.54
d1v4ra1100 Transcriptional repressor TraR, N-terminal domain 80.02
>d1y7ya1 a.35.1.3 (A:5-73) Restriction-modification controller protein C.AhdI {Aeromonas hydrophila [TaxId: 644]} Back     information, alignment and structure
class: All alpha proteins
fold: lambda repressor-like DNA-binding domains
superfamily: lambda repressor-like DNA-binding domains
family: SinR domain-like
domain: Restriction-modification controller protein C.AhdI
species: Aeromonas hydrophila [TaxId: 644]
Probab=99.81  E-value=4.9e-20  Score=97.43  Aligned_cols=57  Identities=21%  Similarity=0.229  Sum_probs=56.0

Q ss_pred             HHHHHHHHHhCCCCHHHHHHHhCCCHHHHHHHHcCCCCCCHHHHHHHHHHhCCCCcc
Q 038591           22 PRQIQRARLGKKMSQPDLANQINQRPQVVSEYENGKAVPNQTVLAKMEKAIGVKLRV   78 (82)
Q Consensus        22 ~~~lk~~r~~~g~s~~elA~~~gis~~~i~~~e~g~~~p~~~~~~~la~~lgv~~~e   78 (82)
                      |.+|+.+|+..||||.+||+.+|+|+++|++||+|...|+.+.+.+||++|||++++
T Consensus        11 g~~ik~~R~~~gltq~~lA~~~gis~~~i~~~E~g~~~p~~~~l~~ia~~l~v~~~~   67 (69)
T d1y7ya1          11 GQRLRELRTAKGLSQETLAFLSGLDRSYVGGVERGQRNVSLVNILKLATALDIEPRE   67 (69)
T ss_dssp             HHHHHHHHHHTTCCHHHHHHHHTCCHHHHHHHHTTCSCCBHHHHHHHHHHTTSCGGG
T ss_pred             HHHHHHHHHHcCCCHHHHHhHhCCCHHHHHHHHCCCCCCCHHHHHHHHHHhCcCHHH
Confidence            899999999999999999999999999999999999999999999999999999987



>d2r1jl1 a.35.1.2 (L:3-68) P22 C2 repressor, DNA-binding domain {Salmonella bacteriophage P22 [TaxId: 10754]} Back     information, alignment and structure
>d1x57a1 a.35.1.12 (A:8-85) Endothelial differentiation-related factor 1, EDF1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b0na2 a.35.1.3 (A:1-68) SinR repressor, DNA-binding domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1y9qa1 a.35.1.8 (A:4-82) Probable transcriptional regulator VC1968, N-terminal domain {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1utxa_ a.35.1.3 (A:) Putative transcription regulator CylR2 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d2b5aa1 a.35.1.3 (A:1-77) Regulatory protein C.BclI {Bacillus caldolyticus [TaxId: 1394]} Back     information, alignment and structure
>d2croa_ a.35.1.2 (A:) cro 434 {Bacteriophage 434 [TaxId: 10712]} Back     information, alignment and structure
>d1r69a_ a.35.1.2 (A:) 434 C1 repressor, DNA-binding domain {Bacteriophage 434 [TaxId: 10712]} Back     information, alignment and structure
>d2icta1 a.35.1.3 (A:8-94) Antitoxin HigA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lmb3_ a.35.1.2 (3:) lambda C1 repressor, DNA-binding domain {Bacteriophage lambda [TaxId: 10710]} Back     information, alignment and structure
>d2a6ca1 a.35.1.13 (A:1-69) HTH-motif protein NE1354 {Nitrosomonas europaea [TaxId: 915]} Back     information, alignment and structure
>d2o38a1 a.35.1.13 (A:28-116) Hypothetical protein RPA3824 {Rhodopseudomonas palustris [TaxId: 1076]} Back     information, alignment and structure
>d2ofya1 a.35.1.3 (A:3-84) Putative transcriptional regulator RHA1_ro04071 {Rhodococcus sp. RHA1 [TaxId: 101510]} Back     information, alignment and structure
>d2ppxa1 a.35.1.3 (A:30-91) Uncharacterized protein Atu1735 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2auwa1 a.35.1.10 (A:88-154) Hypothetical protein NE0471 C-terminal domain {Nitrosomonas europaea [TaxId: 915]} Back     information, alignment and structure
>d2bnma1 a.35.1.3 (A:6-76) Hydroxypropylphosphonic acid epoxidase Fom4, N-terminal domain {Streptomyces wedmorensis [TaxId: 43759]} Back     information, alignment and structure
>d2hsga1 a.35.1.5 (A:2-58) Glucose-resistance amylase regulator CcpA, N-terminal domain {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
>d1efaa1 a.35.1.5 (A:2-60) Lac repressor (LacR), N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qpza1 a.35.1.5 (A:2-58) Purine repressor (PurR), N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dwka1 a.35.1.4 (A:1-86) Cyanase N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1uxda_ a.35.1.5 (A:) Fructose repressor (FruR), N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ic8a2 a.35.1.1 (A:87-180) Hepatocyte nuclear factor 1a (LFB1/HNF1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nera_ a.35.1.2 (A:) Ner {Bacteriophage mu [TaxId: 10677]} Back     information, alignment and structure
>d1ijwc_ a.4.1.2 (C:) HIN recombinase (DNA-binding domain) {Synthetic} Back     information, alignment and structure
>d2awia1 a.35.1.11 (A:2-66) PrgX {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1e3oc2 a.35.1.1 (C:1-75) Oct-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1au7a2 a.35.1.1 (A:5-76) Pit-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1gdta1 a.4.1.2 (A:141-183) gamma,delta resolvase (C-terminal domain) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hlva1 a.4.1.7 (A:1-66) DNA-binding domain of centromere binding protein B (CENP-B) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2jn6a1 a.4.1.19 (A:1-89) Uncharacterized protein Cgl2762 {Corynebacterium glutamicum [TaxId: 1718]} Back     information, alignment and structure
>d1s4ka_ a.35.1.6 (A:) Putative cytoplasmic protein YdiL {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1vz0a1 a.4.14.1 (A:116-208) Putative partitioning protein ParB/Spo0J {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1z05a1 a.4.5.63 (A:10-80) Transcriptional regulator VC2007 N-terminal domain {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1z6ra1 a.4.5.63 (A:12-81) Mlc protein N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1biaa1 a.4.5.1 (A:1-63) Biotin repressor, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2csfa1 a.35.1.7 (A:8-95) DNA-binding protein SATB2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j5ya1 a.4.5.1 (A:3-67) Putative transcriptional regulator TM1602, N-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1umqa_ a.4.1.12 (A:) Photosynthetic apparatus regulatory protein PprA (RegA), DNA-binding domain {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1r71a_ a.4.14.1 (A:) Transcriptional repressor protein KorB DNA-binding domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1i5za1 a.4.5.4 (A:138-206) Catabolite gene activator protein (CAP), C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2cfxa1 a.4.5.32 (A:1-63) Transcriptional regulator LrpC {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2hoea1 a.4.5.63 (A:10-71) N-acetylglucosamine kinase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d3e5ua1 a.4.5.4 (A:148-227) Chlorophenol reduction protein CprK {Desulfitobacterium hafniense [TaxId: 49338]} Back     information, alignment and structure
>d2o4aa1 a.35.1.7 (A:370-452) DNA-binding protein SATB1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gaua1 a.4.5.4 (A:152-232) Transcriptional regulator PG0396, C-terminal domain {Porphyromonas gingivalis [TaxId: 837]} Back     information, alignment and structure
>d2cg4a1 a.4.5.32 (A:4-66) Regulatory protein AsnC {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1p4wa_ a.4.6.2 (A:) Transcriptional regulator RcsB {Erwinia amylovora [TaxId: 552]} Back     information, alignment and structure
>d2ox6a1 a.35.1.6 (A:5-166) Hypothetical protein SO3848 {Shewanella oneidensis [TaxId: 70863]} Back     information, alignment and structure
>d1k78a1 a.4.1.5 (A:19-81) Pax-5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i1ga1 a.4.5.32 (A:2-61) LprA {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1zyba1 a.4.5.4 (A:148-220) Probable transcription regulator BT4300, C-terminal domain {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d2cyya1 a.4.5.32 (A:5-64) Putative transcriptional regulator PH1519 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1rp3a2 a.4.13.2 (A:164-234) Sigma factor sigma-28 (FliA) {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d2ao9a1 a.4.1.17 (A:13-132) Phage protein BC1890 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1a04a1 a.4.6.2 (A:150-216) Nitrate/nitrite response regulator (NarL) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ft9a1 a.4.5.4 (A:134-213) CO-sensing protein CooA, C-terminal domain {Rhodospirillum rubrum [TaxId: 1085]} Back     information, alignment and structure
>d1etxa_ a.4.1.12 (A:) FIS protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1s7ea2 a.35.1.7 (A:6-85) Hepatocyte nuclear factor 6 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fsea_ a.4.6.2 (A:) Germination protein GerE {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1l3la1 a.4.6.2 (A:170-234) Quorum-sensing transcription factor TraR, C-terminal domain {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2bgca1 a.4.5.4 (A:138-237) Listeriolysin regulatory protein PrfA, C-terminal domain {Bacteria (Listeria monocytogenes) [TaxId: 1639]} Back     information, alignment and structure
>d1rzsa_ a.35.1.2 (A:) cro p22 {Bacteriophage p22 [TaxId: 10754]} Back     information, alignment and structure
>d1v7ba1 a.4.1.9 (A:1-74) Transcriptional regulator Cgl2612 {Corynebacterium glutamicum [TaxId: 1718]} Back     information, alignment and structure
>d2d1ha1 a.4.5.50 (A:1-109) Hypothetical transcriptional regulator ST1889 {Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d2g7ga1 a.4.1.9 (A:9-73) Putative transcriptional regulator Rha04620 {Rhodococcus sp. rha1 [TaxId: 101510]} Back     information, alignment and structure
>d1q06a_ a.6.1.3 (A:) Transcriptional regulator CueR {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1or7a1 a.4.13.2 (A:120-187) SigmaE factor (RpoE) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g2ha_ a.4.1.12 (A:) Transcriptional regulator TyrR, C-terminal domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1ku3a_ a.4.13.2 (A:) Sigma70 (SigA, RpoD) {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d2o3fa1 a.4.1.20 (A:1-83) Putative transcriptional regulator YbbH {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1r8da_ a.6.1.3 (A:) Multidrug transporter activator MtaN {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1jt6a1 a.4.1.9 (A:2-72) Multidrug binding protein QacR {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1z0xa1 a.4.1.9 (A:4-71) Transcriptional regulator EF0787 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1j9ia_ a.6.1.5 (A:) Terminase gpNU1 subunit domain {Bacteriophage lambda [TaxId: 10710]} Back     information, alignment and structure
>d2fbqa1 a.4.1.9 (A:2-80) Transcriptional regulator PsrA {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1pdnc_ a.4.1.5 (C:) Paired protein (prd) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d3ctaa1 a.4.5.28 (A:5-89) Ta1064 (RFK), N-terminal domain {Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d2g7sa1 a.4.1.9 (A:3-76) Putative transcriptional regulator Atu0279 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1ntca_ a.4.1.12 (A:) DNA-binding domain of NTRC {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2i10a1 a.4.1.9 (A:10-78) Putative transcriptional regulator RHA1_ro09068 {Rhodococcus sp. [TaxId: 1831]} Back     information, alignment and structure
>d2vkva1 a.4.1.9 (A:6-67) Tetracyclin repressor (Tet-repressor, TetR) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1t56a1 a.4.1.9 (A:22-94) Ethr repressor {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1s7oa_ a.4.13.3 (A:) Hypothetical protein SPy1201 {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d2a61a1 a.4.5.28 (A:5-143) Transcriptional regulator TM0710 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1jhga_ a.4.12.1 (A:) Trp repressor, TrpR {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mkma1 a.4.5.33 (A:1-75) Transcriptional regulator IclR, N-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1x2la1 a.35.1.7 (A:9-95) Homeobox protein Cux-2, CUTL2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wh8a_ a.35.1.7 (A:) Homeobox protein Cux-2, CUTL2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gena1 a.4.1.9 (A:6-75) Probable transcriptional regulator PA1836 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2p7vb1 a.4.13.2 (B:546-613) Sigma70 (SigA, RpoD) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2np5a1 a.4.1.9 (A:9-77) Transcriptional regulator RHA1_ro04179 {Rhodococcus sp. [TaxId: 1831]} Back     information, alignment and structure
>d2gfna1 a.4.1.9 (A:4-80) Probable transcriptional regulator RHA1_ro04631 {Rhodococcus sp. rha1 [TaxId: 101510]} Back     information, alignment and structure
>d2d6ya1 a.4.1.9 (A:7-74) Putative regulator SCO4008 {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1yioa1 a.4.6.2 (A:131-200) Response regulatory protein StyR, C-terminal domain {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1sfxa_ a.4.5.50 (A:) Hypothetical protein AF2008 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2id6a1 a.4.1.9 (A:1-75) Transcriptional regulator TM1030 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2fx0a1 a.4.1.9 (A:4-76) Hemolysin II regulatory protein, HlyIIR {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d2o7ta1 a.4.1.9 (A:1-78) Transcriptional regulator Cgl1640/Cg1846 {Corynebacterium glutamicum [TaxId: 1718]} Back     information, alignment and structure
>d1r8ea1 a.6.1.3 (A:3-120) Transcription activator BmrR {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2ev0a1 a.4.5.24 (A:2-62) Manganese transport regulator MntR {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2id3a1 a.4.1.9 (A:13-80) Putative transcriptional regulator SCO5951 {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1pb6a1 a.4.1.9 (A:14-85) Hypothetical transcriptional regulator YcdC {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fq4a1 a.4.1.9 (A:9-77) Transcriptional regulator BC3163 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1vi0a1 a.4.1.9 (A:6-77) Hypothetical transcriptional regulator YsiA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2oi8a1 a.4.1.9 (A:8-86) Putative regulatory protein Sco4313 {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1xsva_ a.4.13.3 (A:) Hypothetical protein SAV1236 {Staphylococcus aureus, strain Mu50 / ATCC 700699 [TaxId: 1280]} Back     information, alignment and structure
>d2hkua1 a.4.1.9 (A:18-87) Putative transcriptional regulator RHA1_ro03468 {Rhodococcus sp. RHA1 [TaxId: 101510]} Back     information, alignment and structure
>d2hyja1 a.4.1.9 (A:8-82) Putative transcriptional regulator SCO4940 {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d3c07a1 a.4.1.9 (A:15-89) Putative transcriptional regulator SCO4850 {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1ui5a1 a.4.1.9 (A:5-75) A-factor receptor homolog CprB {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1zs4a1 a.35.1.9 (A:4-81) Regulatory protein cII {Bacteriophage lambda [TaxId: 10710]} Back     information, alignment and structure
>d1rkta1 a.4.1.9 (A:2-82) Hypothetical transcriptional regulator YfiR {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1nr3a_ d.236.1.1 (A:) DNA-binding protein Tfx {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d3broa1 a.4.5.28 (A:3-137) Transcriptional regulator OEOE1854 {Oenococcus oeni [TaxId: 1247]} Back     information, alignment and structure
>d1lnwa_ a.4.5.28 (A:) MexR repressor {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1d1la_ a.35.1.2 (A:) cro lambda repressor {Bacteriophage lambda [TaxId: 10710]} Back     information, alignment and structure
>d2etha1 a.4.5.28 (A:1-140) Putative transcriptional regulator TM0816 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1bl0a1 a.4.1.8 (A:9-62) MarA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wh6a_ a.35.1.7 (A:) Homeobox protein Cux-2, CUTL2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lj9a_ a.4.5.28 (A:) Transcriptional regulator SlyA {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d2g3ba1 a.4.1.9 (A:2-73) Putative transcriptional regulator {Rhodococcus sp. rha1 [TaxId: 101510]} Back     information, alignment and structure
>d1ttya_ a.4.13.2 (A:) Sigma70 (SigA, RpoD) {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2isya1 a.4.5.24 (A:2-64) Iron-dependent regulator IdeR {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1zk8a1 a.4.1.9 (A:6-77) Transcriptional regulator BC5000 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d2g7la1 a.4.1.9 (A:16-83) Putative transcriptional regulator SCO7704 {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1z91a1 a.4.5.28 (A:8-144) Organic hydroperoxide resistance transcriptional regulator OhrR {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1jgsa_ a.4.5.28 (A:) Multiple antibiotic resistance repressor, MarR {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ub9a_ a.4.5.28 (A:) Hypothetical protein PH1061 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2hr3a1 a.4.5.28 (A:2-146) Probable transcriptional regulator PA3067 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2fbia1 a.4.5.28 (A:5-140) Probable transcriptional regulator PA4135 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1s3ja_ a.4.5.28 (A:) Putative transcriptional regulator YusO {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1ixca1 a.4.5.37 (A:1-89) LysR-type regulatory protein CbnR {Ralstonia eutropha [TaxId: 106590]} Back     information, alignment and structure
>d1tc3c_ a.4.1.2 (C:) Transposase tc3a1-65 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d2np3a1 a.4.1.9 (A:35-99) Putative transcriptional regulator SCO0857 {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1d5ya1 a.4.1.8 (A:3-56) Rob transcription factor, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1u2wa1 a.4.5.5 (A:12-119) Cadmium efflux system accessory protein CadC {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2fbha1 a.4.5.28 (A:8-144) Transcriptional regulator PA3341 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1sgma1 a.4.1.9 (A:5-77) Putative transcriptional regulator YxaF {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2fxaa1 a.4.5.28 (A:6-167) Protease production regulatory protein Hpr {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1ku9a_ a.4.5.36 (A:) DNA-binding protein Mj223 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1jhfa1 a.4.5.2 (A:2-72) LexA repressor, N-terminal DNA-binding domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2esna1 a.4.5.37 (A:3-91) Probable LysR-type transcriptional regulator PA0477 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2bv6a1 a.4.5.28 (A:5-140) Transcriptional regulator MgrA {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2fd5a1 a.4.1.9 (A:1-76) Probable transcriptional regulator PA3133 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2iu5a1 a.4.1.9 (A:1-71) Transcriptional activator DhaS {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d1t33a1 a.4.1.9 (A:1-88) Putative transcriptional repressor YbiH {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1hw1a1 a.4.5.6 (A:5-78) Fatty acid responsive transcription factor FadR, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wh7a_ a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1s7ea1 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1r1ua_ a.4.5.5 (A:) Metal-sensing transcriptional repressor CzrA {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1r1ta_ a.4.5.5 (A:) SmtB repressor {Cyanobacteria (Synechococcus), pcc7942 [TaxId: 1129]} Back     information, alignment and structure
>d3deua1 a.4.5.28 (A:2-141) Transcriptional regulator SlyA {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2frha1 a.4.5.28 (A:102-216) Pleiotropic regulator of virulence genes, SarA {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1ig7a_ a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1le8a_ a.4.1.1 (A:) Mating type protein A1 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1bl0a2 a.4.1.8 (A:63-124) MarA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2cqxa1 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 5, LASS5 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d3bwga1 a.4.5.6 (A:5-82) Transcriptional regulator YydK {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1ulya_ a.4.5.58 (A:) Hypothetical protein PH1932 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2dt5a1 a.4.5.38 (A:4-77) Transcriptional repressor Rex, N-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1p4xa2 a.4.5.28 (A:126-250) Staphylococcal accessory regulator A homolog, SarS {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1vnda_ a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1rr7a_ a.4.1.14 (A:) Middle operon regulator, Mor {Bacteriophage Mu [TaxId: 10677]} Back     information, alignment and structure
>d1rp3a1 a.4.13.1 (A:87-163) Sigma factor sigma-28 (FliA) {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1p7ia_ a.4.1.1 (A:) Engrailed Homeodomain {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2hs5a1 a.4.5.6 (A:25-93) Putative transcriptional regulator RHA1_ro03477 {Rhodococcus sp. RHA1 [TaxId: 101510]} Back     information, alignment and structure
>d1hsja1 a.4.5.28 (A:373-487) Staphylococcal accessory regulator A homolog, SarR {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1jgga_ a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1zq3p1 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1aisb1 a.74.1.2 (B:1108-1205) Transcription factor IIB (TFIIB), core domain {Archaeon Pyrococcus woesei [TaxId: 2262]} Back     information, alignment and structure
>d1x2ma1 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 6, LASS6 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1e3oc1 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2craa1 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1au7a1 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1bw5a_ a.4.1.1 (A:) Insulin gene enhancer protein isl-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2e1oa1 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b72a_ a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sfua_ a.4.5.19 (A:) 34L {Yaba-like disease virus, YLDV [TaxId: 132475]} Back     information, alignment and structure
>d1wi3a_ a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fjla_ a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1vola1 a.74.1.2 (A:113-207) Transcription factor IIB (TFIIB), core domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x2na1 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cuea1 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2p4wa1 a.4.5.64 (A:1-194) Transcriptional regulatory protein PF1790 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1pufb_ a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k61a_ a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ftta_ a.4.1.1 (A:) Thyroid transcription factor 1 homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d9anta_ a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1yz8p1 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ocpa_ a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1xd7a_ a.4.5.55 (A:) Hypothetical protein ywnA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2fbka1 a.4.5.28 (A:8-179) Transcriptional regulator DR1159 {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d2ecba1 a.4.1.1 (A:8-83) Zinc fingers and homeoboxes protein 1, ZHX1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v4ra1 a.4.5.6 (A:1-100) Transcriptional repressor TraR, N-terminal domain {Streptomyces sp. [TaxId: 1931]} Back     information, alignment and structure