Citrus Sinensis ID: 038591
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 82 | ||||||
| 225445278 | 144 | PREDICTED: multiprotein-bridging factor | 0.987 | 0.562 | 0.651 | 3e-21 | |
| 147852829 | 144 | hypothetical protein VITISV_034625 [Viti | 0.987 | 0.562 | 0.640 | 4e-21 | |
| 19225065 | 145 | ethylene-responsive transciptional coact | 1.0 | 0.565 | 0.622 | 1e-20 | |
| 21553721 | 148 | ethylene-responsive transcriptional coac | 1.0 | 0.554 | 0.644 | 1e-19 | |
| 297831282 | 148 | ATMBF1C/MBF1C [Arabidopsis lyrata subsp. | 1.0 | 0.554 | 0.644 | 1e-19 | |
| 15230125 | 148 | multiprotein-bridging factor 1c [Arabido | 1.0 | 0.554 | 0.644 | 1e-19 | |
| 449443143 | 145 | PREDICTED: multiprotein-bridging factor | 0.939 | 0.531 | 0.635 | 2e-19 | |
| 255546543 | 146 | Multiprotein-bridging factor, putative [ | 1.0 | 0.561 | 0.6 | 2e-19 | |
| 350535769 | 146 | ethylene-responsive transcriptional coac | 1.0 | 0.561 | 0.6 | 3e-19 | |
| 357500453 | 146 | Ethylene-responsive transciptional coact | 1.0 | 0.561 | 0.611 | 4e-18 |
| >gi|225445278|ref|XP_002284605.1| PREDICTED: multiprotein-bridging factor 1c [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 105 bits (262), Expect = 3e-21, Method: Compositional matrix adjust.
Identities = 58/89 (65%), Positives = 65/89 (73%), Gaps = 8/89 (8%)
Query: 2 KTAGAVINMRKLDEGTEP--------DTPRQIQRARLGKKMSQPDLANQINQRPQVVSEY 53
K A ++N RKLDEGTEP D + IQ+ARL KKMSQ +LA IN+RPQVV EY
Sbjct: 56 KKAAPIMNTRKLDEGTEPAALDRVSVDVRQLIQKARLEKKMSQAELAKLINERPQVVQEY 115
Query: 54 ENGKAVPNQTVLAKMEKAIGVKLRVKIRK 82
ENGKAVPNQ VLAKMEK +GVKLR KI K
Sbjct: 116 ENGKAVPNQAVLAKMEKVLGVKLRGKISK 144
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|147852829|emb|CAN79519.1| hypothetical protein VITISV_034625 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|19225065|gb|AAL32037.2|AF439278_1 ethylene-responsive transciptional coactivator-like protein [Retama raetam] | Back alignment and taxonomy information |
|---|
| >gi|21553721|gb|AAM62814.1| ethylene-responsive transcriptional coactivator, putative [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|297831282|ref|XP_002883523.1| ATMBF1C/MBF1C [Arabidopsis lyrata subsp. lyrata] gi|297329363|gb|EFH59782.1| ATMBF1C/MBF1C [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|15230125|ref|NP_189093.1| multiprotein-bridging factor 1c [Arabidopsis thaliana] gi|75274343|sp|Q9LV58.1|MBF1C_ARATH RecName: Full=Multiprotein-bridging factor 1c gi|9294040|dbj|BAB01997.1| ethylene-responsive transcriptional coactivator-like protein [Arabidopsis thaliana] gi|28466837|gb|AAO44027.1| At3g24500 [Arabidopsis thaliana] gi|110735899|dbj|BAE99925.1| putative ethylene-responsive transcriptional coactivator [Arabidopsis thaliana] gi|332643384|gb|AEE76905.1| multiprotein-bridging factor 1c [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|449443143|ref|XP_004139340.1| PREDICTED: multiprotein-bridging factor 1c-like [Cucumis sativus] gi|449521076|ref|XP_004167557.1| PREDICTED: multiprotein-bridging factor 1c-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|255546543|ref|XP_002514331.1| Multiprotein-bridging factor, putative [Ricinus communis] gi|223546787|gb|EEF48285.1| Multiprotein-bridging factor, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|350535769|ref|NP_001234468.1| ethylene-responsive transcriptional coactivator [Solanum lycopersicum] gi|5669634|gb|AAD46402.1|AF096246_1 ethylene-responsive transcriptional coactivator [Solanum lycopersicum] gi|161898092|gb|ABX80140.1| multiprotein bridging factor ER24 [Solanum lycopersicum] | Back alignment and taxonomy information |
|---|
| >gi|357500453|ref|XP_003620515.1| Ethylene-responsive transciptional coactivator-like protein [Medicago truncatula] gi|355495530|gb|AES76733.1| Ethylene-responsive transciptional coactivator-like protein [Medicago truncatula] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 82 | ||||||
| TAIR|locus:2091747 | 148 | MBF1C "multiprotein bridging f | 1.0 | 0.554 | 0.655 | 1.9e-21 | |
| SGD|S000007253 | 151 | MBF1 "Transcriptional coactiva | 0.817 | 0.443 | 0.535 | 5.4e-15 | |
| TAIR|locus:2098994 | 142 | MBF1B "multiprotein bridging f | 0.939 | 0.542 | 0.458 | 1.1e-14 | |
| TAIR|locus:2041509 | 142 | MBF1A "multiprotein bridging f | 0.939 | 0.542 | 0.447 | 3e-14 | |
| WB|WBGene00003148 | 156 | mbf-1 [Caenorhabditis elegans | 0.865 | 0.455 | 0.518 | 3e-14 | |
| DICTYBASE|DDB_G0273775 | 104 | cinD-2 "putative helix-turn-he | 0.743 | 0.586 | 0.573 | 4.9e-14 | |
| DICTYBASE|DDB_G0273061 | 104 | cinD-1 "putative helix-turn-he | 0.743 | 0.586 | 0.573 | 4.9e-14 | |
| MGI|MGI:1891227 | 148 | Edf1 "endothelial differentiat | 0.865 | 0.479 | 0.468 | 3.4e-13 | |
| RGD|1308073 | 148 | Edf1 "endothelial differentiat | 0.865 | 0.479 | 0.468 | 3.4e-13 | |
| CGD|CAL0003442 | 151 | MBF1 [Candida albicans (taxid: | 0.841 | 0.456 | 0.452 | 4.4e-13 |
| TAIR|locus:2091747 MBF1C "multiprotein bridging factor 1C" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 251 (93.4 bits), Expect = 1.9e-21, P = 1.9e-21
Identities = 59/90 (65%), Positives = 65/90 (72%)
Query: 1 KKTAGAVINMRKLDEGTEP---DTPR-----QIQRARLGKKMSQPDLANQINQRPQVVSE 52
K TA VIN +KL+E TEP D + IQ+ARL KKMSQ DLA QIN+R QVV E
Sbjct: 59 KSTAVPVINTKKLEEETEPAAMDRVKAEVRLMIQKARLEKKMSQADLAKQINERTQVVQE 118
Query: 53 YENGKAVPNQTVLAKMEKAIGVKLRVKIRK 82
YENGKAVPNQ VLAKMEK +GVKLR KI K
Sbjct: 119 YENGKAVPNQAVLAKMEKVLGVKLRGKIGK 148
|
|
| SGD|S000007253 MBF1 "Transcriptional coactivator" [Saccharomyces cerevisiae (taxid:4932)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2098994 MBF1B "multiprotein bridging factor 1B" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2041509 MBF1A "multiprotein bridging factor 1A" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| WB|WBGene00003148 mbf-1 [Caenorhabditis elegans (taxid:6239)] | Back alignment and assigned GO terms |
|---|
| DICTYBASE|DDB_G0273775 cinD-2 "putative helix-turn-helix transcription factor" [Dictyostelium discoideum (taxid:44689)] | Back alignment and assigned GO terms |
|---|
| DICTYBASE|DDB_G0273061 cinD-1 "putative helix-turn-helix transcription factor" [Dictyostelium discoideum (taxid:44689)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1891227 Edf1 "endothelial differentiation-related factor 1" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| RGD|1308073 Edf1 "endothelial differentiation-related factor 1" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| CGD|CAL0003442 MBF1 [Candida albicans (taxid:5476)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 82 | |||
| COG1813 | 165 | COG1813, COG1813, Predicted transcription factor, | 5e-10 | |
| smart00530 | 56 | smart00530, HTH_XRE, Helix-turn-helix XRE-family l | 2e-09 | |
| cd00093 | 58 | cd00093, HTH_XRE, Helix-turn-helix XRE-family like | 4e-09 | |
| pfam01381 | 55 | pfam01381, HTH_3, Helix-turn-helix | 8e-09 | |
| PHA01976 | 67 | PHA01976, PHA01976, helix-turn-helix protein | 2e-05 | |
| PRK06424 | 144 | PRK06424, PRK06424, transcription factor; Provisio | 1e-04 | |
| pfam12844 | 64 | pfam12844, HTH_19, Helix-turn-helix domain | 2e-04 | |
| TIGR00270 | 154 | TIGR00270, TIGR00270, TIGR00270 family protein | 0.001 | |
| COG1396 | 120 | COG1396, HipB, Predicted transcriptional regulator | 0.004 |
| >gnl|CDD|224726 COG1813, COG1813, Predicted transcription factor, homolog of eukaryotic MBF1 [Transcription] | Back alignment and domain information |
|---|
Score = 52.1 bits (125), Expect = 5e-10
Identities = 23/63 (36%), Positives = 37/63 (58%)
Query: 19 PDTPRQIQRARLGKKMSQPDLANQINQRPQVVSEYENGKAVPNQTVLAKMEKAIGVKLRV 78
D +I+ AR + +SQ DLA ++ ++ V+ E G+A PN V K+EK +G+KL
Sbjct: 78 EDYGERIREAREKRGLSQEDLAAKLKEKVSVIRRIERGEATPNIKVAKKLEKLLGIKLVE 137
Query: 79 KIR 81
K+
Sbjct: 138 KVD 140
|
Length = 165 |
| >gnl|CDD|197775 smart00530, HTH_XRE, Helix-turn-helix XRE-family like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|238045 cd00093, HTH_XRE, Helix-turn-helix XRE-family like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|201759 pfam01381, HTH_3, Helix-turn-helix | Back alignment and domain information |
|---|
| >gnl|CDD|177330 PHA01976, PHA01976, helix-turn-helix protein | Back alignment and domain information |
|---|
| >gnl|CDD|102369 PRK06424, PRK06424, transcription factor; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|205103 pfam12844, HTH_19, Helix-turn-helix domain | Back alignment and domain information |
|---|
| >gnl|CDD|129371 TIGR00270, TIGR00270, TIGR00270 family protein | Back alignment and domain information |
|---|
| >gnl|CDD|224314 COG1396, HipB, Predicted transcriptional regulators [Transcription] | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 82 | |||
| PHA01976 | 67 | helix-turn-helix protein | 99.76 | |
| PF12844 | 64 | HTH_19: Helix-turn-helix domain; PDB: 3LIS_B 3LFP_ | 99.75 | |
| PF01381 | 55 | HTH_3: Helix-turn-helix; InterPro: IPR001387 This | 99.73 | |
| COG1476 | 68 | Predicted transcriptional regulators [Transcriptio | 99.72 | |
| TIGR03070 | 58 | couple_hipB transcriptional regulator, y4mF family | 99.71 | |
| PRK06424 | 144 | transcription factor; Provisional | 99.68 | |
| PRK08359 | 176 | transcription factor; Validated | 99.67 | |
| PF13560 | 64 | HTH_31: Helix-turn-helix domain; PDB: 3F51_C 3F52_ | 99.65 | |
| PRK09726 | 88 | antitoxin HipB; Provisional | 99.65 | |
| TIGR00270 | 154 | conserved hypothetical protein TIGR00270. | 99.64 | |
| PRK09706 | 135 | transcriptional repressor DicA; Reviewed | 99.64 | |
| TIGR02607 | 78 | antidote_HigA addiction module antidote protein, H | 99.59 | |
| PRK13890 | 120 | conjugal transfer protein TrbA; Provisional | 99.57 | |
| PRK09943 | 185 | DNA-binding transcriptional repressor PuuR; Provis | 99.57 | |
| PRK08154 | 309 | anaerobic benzoate catabolism transcriptional regu | 99.56 | |
| TIGR02684 | 89 | dnstrm_HI1420 probable addiction module antidote p | 99.56 | |
| PF13443 | 63 | HTH_26: Cro/C1-type HTH DNA-binding domain; PDB: 3 | 99.55 | |
| PRK10072 | 96 | putative transcriptional regulator; Provisional | 99.54 | |
| TIGR02612 | 150 | mob_myst_A mobile mystery protein A. Members of th | 99.49 | |
| PRK04140 | 317 | hypothetical protein; Provisional | 99.48 | |
| smart00530 | 56 | HTH_XRE Helix-turn-helix XRE-family like proteins. | 99.43 | |
| KOG3398 | 135 | consensus Transcription factor MBF1 [Transcription | 99.41 | |
| cd00093 | 58 | HTH_XRE Helix-turn-helix XRE-family like proteins. | 99.4 | |
| TIGR03830 | 127 | CxxCG_CxxCG_HTH putative zinc finger/helix-turn-he | 99.38 | |
| COG1813 | 165 | Predicted transcription factor, homolog of eukaryo | 99.38 | |
| PHA00542 | 82 | putative Cro-like protein | 99.28 | |
| COG2944 | 104 | Predicted transcriptional regulator [Transcription | 99.26 | |
| PRK10856 | 331 | cytoskeletal protein RodZ; Provisional | 99.25 | |
| PF13744 | 80 | HTH_37: Helix-turn-helix domain; PDB: 2A6C_B 2O38_ | 99.21 | |
| COG3620 | 187 | Predicted transcriptional regulator with C-termina | 99.2 | |
| COG3093 | 104 | VapI Plasmid maintenance system antidote protein [ | 99.11 | |
| PRK13355 | 517 | bifunctional HTH-domain containing protein/aminotr | 99.08 | |
| PRK02866 | 147 | cyanate hydratase; Validated | 99.02 | |
| smart00352 | 75 | POU Found in Pit-Oct-Unc transcription factors. | 98.98 | |
| PF07022 | 66 | Phage_CI_repr: Bacteriophage CI repressor helix-tu | 98.93 | |
| TIGR00673 | 150 | cynS cyanate hydratase. Alternate names include cy | 98.92 | |
| COG3655 | 73 | Predicted transcriptional regulator [Transcription | 98.91 | |
| COG1709 | 241 | Predicted transcriptional regulator [Transcription | 98.89 | |
| PF13413 | 62 | HTH_25: Helix-turn-helix domain; PDB: 2WUS_R 3FYM_ | 98.86 | |
| COG1395 | 313 | Predicted transcriptional regulator [Transcription | 98.83 | |
| COG1396 | 120 | HipB Predicted transcriptional regulators [Transcr | 98.76 | |
| PF08667 | 147 | BetR: BetR domain; InterPro: IPR013975 CheY-like p | 98.65 | |
| PHA01083 | 149 | hypothetical protein | 98.58 | |
| cd01392 | 52 | HTH_LacI Helix-turn-helix (HTH) DNA binding domain | 98.54 | |
| COG5499 | 120 | Predicted transcription regulator containing HTH d | 98.49 | |
| PF00356 | 46 | LacI: Bacterial regulatory proteins, lacI family; | 98.47 | |
| COG1426 | 284 | Predicted transcriptional regulator contains Xre-l | 98.45 | |
| PF08965 | 118 | DUF1870: Domain of unknown function (DUF1870); Int | 98.29 | |
| COG3636 | 100 | Predicted transcriptional regulator [Transcription | 98.28 | |
| smart00354 | 70 | HTH_LACI helix_turn _helix lactose operon represso | 98.24 | |
| TIGR01321 | 94 | TrpR trp operon repressor, proteobacterial. This m | 98.19 | |
| COG4800 | 170 | Predicted transcriptional regulator with an HTH do | 98.18 | |
| COG2522 | 119 | Predicted transcriptional regulator [General funct | 98.08 | |
| PF13693 | 78 | HTH_35: Winged helix-turn-helix DNA-binding; PDB: | 98.0 | |
| COG3423 | 82 | Nlp Predicted transcriptional regulator [Transcrip | 97.98 | |
| PRK08099 | 399 | bifunctional DNA-binding transcriptional repressor | 97.97 | |
| TIGR02147 | 271 | Fsuc_second hypothetical protein, TIGR02147. This | 97.87 | |
| PF13384 | 50 | HTH_23: Homeodomain-like domain; PDB: 2X48_C. | 97.74 | |
| PRK10344 | 92 | DNA-binding transcriptional regulator Nlp; Provisi | 97.7 | |
| PRK09526 | 342 | lacI lac repressor; Reviewed | 97.66 | |
| TIGR01481 | 329 | ccpA catabolite control protein A. Catabolite cont | 97.65 | |
| PRK10014 | 342 | DNA-binding transcriptional repressor MalI; Provis | 97.65 | |
| PRK09492 | 315 | treR trehalose repressor; Provisional | 97.62 | |
| PHA00675 | 78 | hypothetical protein | 97.62 | |
| PF02796 | 45 | HTH_7: Helix-turn-helix domain of resolvase; Inter | 97.62 | |
| PRK10703 | 341 | DNA-binding transcriptional repressor PurR; Provis | 97.62 | |
| PRK11303 | 328 | DNA-binding transcriptional regulator FruR; Provis | 97.62 | |
| TIGR02405 | 311 | trehalos_R_Ecol trehalose operon repressor, proteo | 97.61 | |
| PRK10727 | 343 | DNA-binding transcriptional regulator GalR; Provis | 97.61 | |
| TIGR02844 | 80 | spore_III_D sporulation transcriptional regulator | 97.61 | |
| PF14549 | 60 | P22_Cro: DNA-binding transcriptional regulator Cro | 97.57 | |
| PRK14987 | 331 | gluconate operon transcriptional regulator; Provis | 97.57 | |
| TIGR03879 | 73 | near_KaiC_dom probable regulatory domain. This mod | 97.56 | |
| TIGR02293 | 133 | TAS_TIGR02293 putative toxin-antitoxin system anti | 97.56 | |
| PF04814 | 180 | HNF-1_N: Hepatocyte nuclear factor 1 (HNF-1), N te | 97.53 | |
| PRK10401 | 346 | DNA-binding transcriptional regulator GalS; Provis | 97.51 | |
| PF00157 | 75 | Pou: Pou domain - N-terminal to homeobox domain; I | 97.5 | |
| TIGR02417 | 327 | fruct_sucro_rep D-fructose-responsive transcriptio | 97.42 | |
| PHA02591 | 83 | hypothetical protein; Provisional | 97.39 | |
| PF13936 | 44 | HTH_38: Helix-turn-helix domain; PDB: 2W48_A. | 97.39 | |
| PF13412 | 48 | HTH_24: Winged helix-turn-helix DNA-binding; PDB: | 97.38 | |
| COG1609 | 333 | PurR Transcriptional regulators [Transcription] | 97.36 | |
| PRK03975 | 141 | tfx putative transcriptional regulator; Provisiona | 97.36 | |
| COG5606 | 91 | Uncharacterized conserved small protein [Function | 97.31 | |
| COG4197 | 96 | Uncharacterized protein conserved in bacteria, pro | 97.27 | |
| PRK10339 | 327 | DNA-binding transcriptional repressor EbgR; Provis | 97.23 | |
| PRK10423 | 327 | transcriptional repressor RbsR; Provisional | 97.2 | |
| cd04762 | 49 | HTH_MerR-trunc Helix-Turn-Helix DNA binding domain | 97.15 | |
| PF08535 | 93 | KorB: KorB domain; InterPro: IPR013741 This entry | 97.11 | |
| PF06056 | 58 | Terminase_5: Putative ATPase subunit of terminase | 97.07 | |
| PF05269 | 91 | Phage_CII: Bacteriophage CII protein; InterPro: IP | 97.04 | |
| PF02954 | 42 | HTH_8: Bacterial regulatory protein, Fis family; I | 97.01 | |
| TIGR00721 | 137 | tfx DNA-binding protein, Tfx family. Tfx from Meth | 97.0 | |
| PF12728 | 51 | HTH_17: Helix-turn-helix domain | 96.99 | |
| TIGR01764 | 49 | excise DNA binding domain, excisionase family. An | 96.87 | |
| PF07037 | 122 | DUF1323: Putative transcription regulator (DUF1323 | 96.85 | |
| PF13518 | 52 | HTH_28: Helix-turn-helix domain | 96.82 | |
| PF00325 | 32 | Crp: Bacterial regulatory proteins, crp family; In | 96.79 | |
| cd04761 | 49 | HTH_MerR-SF Helix-Turn-Helix DNA binding domain of | 96.77 | |
| PF10668 | 60 | Phage_terminase: Phage terminase small subunit; In | 96.76 | |
| cd04764 | 67 | HTH_MlrA-like_sg1 Helix-Turn-Helix DNA binding dom | 96.75 | |
| PF00376 | 38 | MerR: MerR family regulatory protein; InterPro: IP | 96.75 | |
| PF04545 | 50 | Sigma70_r4: Sigma-70, region 4; InterPro: IPR00763 | 96.73 | |
| TIGR02531 | 88 | yecD_yerC TrpR-related protein YerC/YecD. This mod | 96.71 | |
| PF08279 | 55 | HTH_11: HTH domain; InterPro: IPR013196 Winged hel | 96.7 | |
| PF02001 | 106 | DUF134: Protein of unknown function DUF134; InterP | 96.63 | |
| COG1356 | 143 | tfx Transcriptional regulator [DNA replication, re | 96.57 | |
| cd01104 | 68 | HTH_MlrA-CarA Helix-Turn-Helix DNA binding domain | 96.52 | |
| PRK08558 | 238 | adenine phosphoribosyltransferase; Provisional | 96.5 | |
| PF04218 | 53 | CENP-B_N: CENP-B N-terminal DNA-binding domain; In | 96.49 | |
| PF02376 | 87 | CUT: CUT domain; InterPro: IPR003350 A class, also | 96.4 | |
| PF04967 | 53 | HTH_10: HTH DNA binding domain; InterPro: IPR00705 | 96.37 | |
| PRK01381 | 99 | Trp operon repressor; Provisional | 96.37 | |
| cd04763 | 68 | HTH_MlrA-like Helix-Turn-Helix DNA binding domain | 96.36 | |
| PF13411 | 69 | MerR_1: MerR HTH family regulatory protein; PDB: 2 | 96.31 | |
| PF05225 | 45 | HTH_psq: helix-turn-helix, Psq domain; InterPro: I | 96.31 | |
| cd00569 | 42 | HTH_Hin_like Helix-turn-helix domain of Hin and re | 96.2 | |
| PRK15418 | 318 | transcriptional regulator LsrR; Provisional | 96.2 | |
| PRK13698 | 323 | plasmid-partitioning protein; Provisional | 96.18 | |
| PF13404 | 42 | HTH_AsnC-type: AsnC-type helix-turn-helix domain; | 96.17 | |
| smart00422 | 70 | HTH_MERR helix_turn_helix, mercury resistance. | 96.16 | |
| TIGR02044 | 127 | CueR Cu(I)-responsive transcriptional regulator. T | 96.16 | |
| cd01109 | 113 | HTH_YyaN Helix-Turn-Helix DNA binding domain of th | 96.15 | |
| COG1342 | 99 | Predicted DNA-binding proteins [General function p | 96.13 | |
| COG2390 | 321 | DeoR Transcriptional regulator, contains sigma fac | 96.09 | |
| PF01527 | 76 | HTH_Tnp_1: Transposase; InterPro: IPR002514 Transp | 96.08 | |
| PF01047 | 59 | MarR: MarR family; InterPro: IPR000835 The MarR-ty | 96.07 | |
| cd04781 | 120 | HTH_MerR-like_sg6 Helix-Turn-Helix DNA binding dom | 96.01 | |
| PF04552 | 160 | Sigma54_DBD: Sigma-54, DNA binding domain; InterPr | 96.0 | |
| PRK09744 | 75 | DNA-binding transcriptional regulator DicC; Provis | 95.98 | |
| COG2842 | 297 | Uncharacterized ATPase, putative transposase [Gene | 95.95 | |
| smart00550 | 68 | Zalpha Z-DNA-binding domain in adenosine deaminase | 95.9 | |
| cd06171 | 55 | Sigma70_r4 Sigma70, region (SR) 4 refers to the mo | 95.9 | |
| PF13022 | 142 | HTH_Tnp_1_2: Helix-turn-helix of insertion element | 95.89 | |
| TIGR00180 | 187 | parB_part ParB-like partition proteins. This model | 95.88 | |
| COG1513 | 151 | CynS Cyanate lyase [Inorganic ion transport and me | 95.88 | |
| smart00421 | 58 | HTH_LUXR helix_turn_helix, Lux Regulon. lux regulo | 95.84 | |
| PF01418 | 77 | HTH_6: Helix-turn-helix domain, rpiR family; Inter | 95.84 | |
| COG1318 | 182 | Predicted transcriptional regulators [Transcriptio | 95.82 | |
| cd01105 | 88 | HTH_GlnR-like Helix-Turn-Helix DNA binding domain | 95.81 | |
| TIGR02054 | 120 | MerD mercuric resistence transcriptional repressor | 95.8 | |
| cd04773 | 108 | HTH_TioE_rpt2 Second Helix-Turn-Helix DNA binding | 95.79 | |
| cd04784 | 127 | HTH_CadR-PbrR Helix-Turn-Helix DNA binding domain | 95.77 | |
| PRK04217 | 110 | hypothetical protein; Provisional | 95.71 | |
| PRK10227 | 135 | DNA-binding transcriptional regulator CueR; Provis | 95.69 | |
| cd01108 | 127 | HTH_CueR Helix-Turn-Helix DNA binding domain of Cu | 95.69 | |
| PF13545 | 76 | HTH_Crp_2: Crp-like helix-turn-helix domain; PDB: | 95.68 | |
| smart00420 | 53 | HTH_DEOR helix_turn_helix, Deoxyribose operon repr | 95.67 | |
| PF13551 | 112 | HTH_29: Winged helix-turn helix | 95.66 | |
| PF05930 | 51 | Phage_AlpA: Prophage CP4-57 regulatory protein (Al | 95.65 | |
| cd04777 | 107 | HTH_MerR-like_sg1 Helix-Turn-Helix DNA binding dom | 95.64 | |
| KOG3802 | 398 | consensus Transcription factor OCT-1, contains POU | 95.63 | |
| PF08281 | 54 | Sigma70_r4_2: Sigma-70, region 4; InterPro: IPR013 | 95.62 | |
| TIGR03764 | 258 | ICE_PFGI_1_parB integrating conjugative element, P | 95.62 | |
| PF08220 | 57 | HTH_DeoR: DeoR-like helix-turn-helix domain; Inter | 95.61 | |
| PF00165 | 42 | HTH_AraC: Bacterial regulatory helix-turn-helix pr | 95.6 | |
| TIGR02047 | 127 | CadR-PbrR Cd(II)/Pb(II)-responsive transcriptional | 95.6 | |
| PRK13749 | 121 | transcriptional regulator MerD; Provisional | 95.55 | |
| PRK09413 | 121 | IS2 repressor TnpA; Reviewed | 95.54 | |
| PRK15002 | 154 | redox-sensitivie transcriptional activator SoxR; P | 95.51 | |
| PF01371 | 87 | Trp_repressor: Trp repressor protein; InterPro: IP | 95.51 | |
| PF12802 | 62 | MarR_2: MarR family; PDB: 3ECO_B 2QWW_B 3KP6_B 3KP | 95.51 | |
| cd00092 | 67 | HTH_CRP helix_turn_helix, cAMP Regulatory protein | 95.48 | |
| cd04789 | 102 | HTH_Cfa Helix-Turn-Helix DNA binding domain of the | 95.47 | |
| PF11427 | 50 | HTH_Tnp_Tc3_1: Tc3 transposase; PDB: 1U78_A 1TC3_C | 95.47 | |
| cd01107 | 108 | HTH_BmrR Helix-Turn-Helix DNA binding domain of th | 95.47 | |
| PRK00118 | 104 | putative DNA-binding protein; Validated | 95.45 | |
| PF13011 | 85 | LZ_Tnp_IS481: leucine-zipper of insertion element | 95.43 | |
| PF13613 | 53 | HTH_Tnp_4: Helix-turn-helix of DDE superfamily end | 95.43 | |
| cd01106 | 103 | HTH_TipAL-Mta Helix-Turn-Helix DNA binding domain | 95.43 | |
| smart00419 | 48 | HTH_CRP helix_turn_helix, cAMP Regulatory protein. | 95.41 | |
| PF02042 | 52 | RWP-RK: RWP-RK domain; InterPro: IPR003035 This do | 95.41 | |
| PRK09514 | 140 | zntR zinc-responsive transcriptional regulator; Pr | 95.39 | |
| TIGR02043 | 131 | ZntR Zn(II)-responsive transcriptional regulator. | 95.38 | |
| cd04765 | 99 | HTH_MlrA-like_sg2 Helix-Turn-Helix DNA binding dom | 95.37 | |
| cd04768 | 96 | HTH_BmrR-like Helix-Turn-Helix DNA binding domain | 95.36 | |
| cd04772 | 99 | HTH_TioE_rpt1 First Helix-Turn-Helix DNA binding d | 95.34 | |
| PRK15043 | 243 | transcriptional regulator MirA; Provisional | 95.33 | |
| TIGR01610 | 95 | phage_O_Nterm phage replication protein O, N-termi | 95.33 | |
| cd04774 | 96 | HTH_YfmP Helix-Turn-Helix DNA binding domain of th | 95.3 | |
| smart00351 | 125 | PAX Paired Box domain. | 95.29 | |
| PF09339 | 52 | HTH_IclR: IclR helix-turn-helix domain; InterPro: | 95.26 | |
| cd04788 | 96 | HTH_NolA-AlbR Helix-Turn-Helix DNA binding domain | 95.26 | |
| PRK04132 | 846 | replication factor C small subunit; Provisional | 95.22 | |
| cd04775 | 102 | HTH_Cfa-like Helix-Turn-Helix DNA binding domain o | 95.21 | |
| cd04786 | 131 | HTH_MerR-like_sg7 Helix-Turn-Helix DNA binding dom | 95.17 | |
| PF14590 | 166 | DUF4447: Domain of unknown function (DUF4447); PDB | 95.14 | |
| PRK10840 | 216 | transcriptional regulator RcsB; Provisional | 95.13 | |
| PRK11891 | 429 | aspartate carbamoyltransferase; Provisional | 95.12 | |
| cd04782 | 97 | HTH_BltR Helix-Turn-Helix DNA binding domain of th | 95.11 | |
| cd00592 | 100 | HTH_MerR-like Helix-Turn-Helix DNA binding domain | 95.09 | |
| COG3415 | 138 | Transposase and inactivated derivatives [DNA repli | 95.08 | |
| COG3311 | 70 | AlpA Predicted transcriptional regulator [Transcri | 95.07 | |
| COG1191 | 247 | FliA DNA-directed RNA polymerase specialized sigma | 95.03 | |
| cd04766 | 91 | HTH_HspR Helix-Turn-Helix DNA binding domain of th | 94.99 | |
| COG1522 | 154 | Lrp Transcriptional regulators [Transcription] | 94.98 | |
| PF07638 | 185 | Sigma70_ECF: ECF sigma factor | 94.97 | |
| cd00131 | 128 | PAX Paired Box domain | 94.94 | |
| cd01111 | 107 | HTH_MerD Helix-Turn-Helix DNA binding domain of th | 94.92 | |
| cd01279 | 98 | HTH_HspR-like Helix-Turn-Helix DNA binding domain | 94.88 | |
| PRK10458 | 467 | DNA cytosine methylase; Provisional | 94.84 | |
| PF12840 | 61 | HTH_20: Helix-turn-helix domain; PDB: 1ULY_A 2CWE_ | 94.83 | |
| COG0789 | 124 | SoxR Predicted transcriptional regulators [Transcr | 94.8 | |
| cd04780 | 95 | HTH_MerR-like_sg5 Helix-Turn-Helix DNA binding dom | 94.78 | |
| PF13309 | 64 | HTH_22: HTH domain | 94.74 | |
| PRK13752 | 144 | putative transcriptional regulator MerR; Provision | 94.71 | |
| cd01282 | 112 | HTH_MerR-like_sg3 Helix-Turn-Helix DNA binding dom | 94.64 | |
| PF01978 | 68 | TrmB: Sugar-specific transcriptional regulator Trm | 94.63 | |
| PF13542 | 52 | HTH_Tnp_ISL3: Helix-turn-helix domain of transposa | 94.62 | |
| cd06170 | 57 | LuxR_C_like C-terminal DNA-binding domain of LuxR- | 94.62 | |
| PF13730 | 55 | HTH_36: Helix-turn-helix domain | 94.54 | |
| cd04769 | 116 | HTH_MerR2 Helix-Turn-Helix DNA binding domain of M | 94.53 | |
| cd04783 | 126 | HTH_MerR1 Helix-Turn-Helix DNA binding domain of t | 94.52 | |
| smart00497 | 53 | IENR1 Intron encoded nuclease repeat motif. Repeat | 94.52 | |
| cd04770 | 123 | HTH_HMRTR Helix-Turn-Helix DNA binding domain of H | 94.51 | |
| cd04767 | 120 | HTH_HspR-like_MBC Helix-Turn-Helix DNA binding dom | 94.46 | |
| PRK13182 | 175 | racA polar chromosome segregation protein; Reviewe | 94.46 | |
| PRK11169 | 164 | leucine-responsive transcriptional regulator; Prov | 94.44 | |
| TIGR03697 | 193 | NtcA_cyano global nitrogen regulator NtcA, cyanoba | 94.43 | |
| PF01022 | 47 | HTH_5: Bacterial regulatory protein, arsR family; | 94.37 | |
| TIGR01950 | 142 | SoxR redox-sensitive transcriptional activator Sox | 94.37 | |
| smart00346 | 91 | HTH_ICLR helix_turn_helix isocitrate lyase regulat | 94.32 | |
| PF09048 | 59 | Cro: Cro; InterPro: IPR000655 Bacteriophage lambda | 94.28 | |
| cd04787 | 133 | HTH_HMRTR_unk Helix-Turn-Helix DNA binding domain | 94.26 | |
| PRK00430 | 95 | fis global DNA-binding transcriptional dual regula | 94.23 | |
| PF00196 | 58 | GerE: Bacterial regulatory proteins, luxR family; | 94.22 | |
| cd01110 | 139 | HTH_SoxR Helix-Turn-Helix DNA binding domain of th | 94.22 | |
| PF13556 | 59 | HTH_30: PucR C-terminal helix-turn-helix domain; P | 94.2 | |
| PRK01905 | 77 | DNA-binding protein Fis; Provisional | 94.12 | |
| cd04776 | 118 | HTH_GnyR Helix-Turn-Helix DNA binding domain of th | 94.07 | |
| PF00440 | 47 | TetR_N: Bacterial regulatory proteins, tetR family | 94.02 | |
| PRK12469 | 481 | RNA polymerase factor sigma-54; Provisional | 94.01 | |
| TIGR02885 | 231 | spore_sigF RNA polymerase sigma-F factor. Members | 94.01 | |
| TIGR01636 | 134 | phage_rinA phage transcriptional activator, RinA f | 93.98 | |
| cd04779 | 134 | HTH_MerR-like_sg4 Helix-Turn-Helix DNA binding dom | 93.91 | |
| PRK11512 | 144 | DNA-binding transcriptional repressor MarR; Provis | 93.91 | |
| cd04785 | 126 | HTH_CadR-PbrR-like Helix-Turn-Helix DNA binding do | 93.89 | |
| PF00126 | 60 | HTH_1: Bacterial regulatory helix-turn-helix prote | 93.88 | |
| PRK11179 | 153 | DNA-binding transcriptional regulator AsnC; Provis | 93.86 | |
| TIGR00122 | 69 | birA_repr_reg BirA biotin operon repressor domain. | 93.83 | |
| PRK13918 | 202 | CRP/FNR family transcriptional regulator; Provisio | 93.83 | |
| TIGR02395 | 429 | rpoN_sigma RNA polymerase sigma-54 factor. A sigma | 93.79 | |
| smart00344 | 108 | HTH_ASNC helix_turn_helix ASNC type. AsnC: an auto | 93.75 | |
| TIGR02051 | 124 | MerR Hg(II)-responsive transcriptional regulator. | 93.73 | |
| PF10078 | 89 | DUF2316: Uncharacterized protein conserved in bact | 93.66 | |
| PRK13413 | 200 | mpi multiple promoter invertase; Provisional | 93.61 | |
| PRK11753 | 211 | DNA-binding transcriptional dual regulator Crp; Pr | 93.58 | |
| PF07453 | 37 | NUMOD1: NUMOD1 domain; InterPro: IPR010896 This he | 93.54 | |
| PRK05932 | 455 | RNA polymerase factor sigma-54; Reviewed | 93.52 | |
| smart00345 | 60 | HTH_GNTR helix_turn_helix gluconate operon transcr | 93.49 | |
| PRK09954 | 362 | putative kinase; Provisional | 93.48 | |
| PF06322 | 64 | Phage_NinH: Phage NinH protein; InterPro: IPR01045 | 93.47 | |
| COG2512 | 258 | Predicted membrane-associated trancriptional regul | 93.45 | |
| PF04297 | 101 | UPF0122: Putative helix-turn-helix protein, YlxM / | 93.4 | |
| COG3413 | 215 | Predicted DNA binding protein [General function pr | 93.29 | |
| TIGR02392 | 270 | rpoH_proteo alternative sigma factor RpoH. A sigma | 93.29 | |
| PRK05572 | 252 | sporulation sigma factor SigF; Validated | 93.27 | |
| PF01325 | 60 | Fe_dep_repress: Iron dependent repressor, N-termin | 93.22 | |
| PF08280 | 59 | HTH_Mga: M protein trans-acting positive regulator | 93.19 | |
| smart00342 | 84 | HTH_ARAC helix_turn_helix, arabinose operon contro | 93.17 | |
| TIGR03209 | 142 | P21_Cbot clostridium toxin-associated regulator Bo | 93.14 | |
| cd04790 | 172 | HTH_Cfa-like_unk Helix-Turn-Helix DNA binding doma | 93.06 | |
| PF04703 | 62 | FaeA: FaeA-like protein; PDB: 2JT1_A 2HTJ_A. | 93.06 | |
| COG1974 | 201 | LexA SOS-response transcriptional repressors (RecA | 93.06 | |
| PRK11608 | 326 | pspF phage shock protein operon transcriptional ac | 93.05 | |
| TIGR02985 | 161 | Sig70_bacteroi1 RNA polymerase sigma-70 factor, Ba | 93.05 | |
| PRK09480 | 194 | slmA division inhibitor protein; Provisional | 93.02 | |
| PRK11161 | 235 | fumarate/nitrate reduction transcriptional regulat | 93.0 | |
| TIGR02394 | 285 | rpoS_proteo RNA polymerase sigma factor RpoS. A si | 92.97 | |
| TIGR02937 | 158 | sigma70-ECF RNA polymerase sigma factor, sigma-70 | 92.97 | |
| PRK13509 | 251 | transcriptional repressor UlaR; Provisional | 92.92 | |
| TIGR02702 | 203 | SufR_cyano iron-sulfur cluster biosynthesis transc | 92.81 | |
| PRK06759 | 154 | RNA polymerase factor sigma-70; Validated | 92.8 | |
| PRK08215 | 258 | sporulation sigma factor SigG; Reviewed | 92.79 | |
| PF07471 | 164 | Phage_Nu1: Phage DNA packaging protein Nu1; InterP | 92.74 | |
| PRK09391 | 230 | fixK transcriptional regulator FixK; Provisional | 92.71 | |
| PRK06596 | 284 | RNA polymerase factor sigma-32; Reviewed | 92.68 | |
| PF01710 | 119 | HTH_Tnp_IS630: Transposase; InterPro: IPR002622 Tr | 92.68 | |
| PRK11924 | 179 | RNA polymerase sigma factor; Provisional | 92.68 | |
| PRK00215 | 205 | LexA repressor; Validated | 92.65 | |
| PRK10411 | 240 | DNA-binding transcriptional activator FucR; Provis | 92.64 | |
| PRK15320 | 251 | transcriptional activator SprB; Provisional | 92.6 | |
| TIGR02974 | 329 | phageshock_pspF psp operon transcriptional activat | 92.47 | |
| TIGR02337 | 118 | HpaR homoprotocatechuate degradation operon regula | 92.46 | |
| PRK12427 | 231 | flagellar biosynthesis sigma factor; Provisional | 92.44 | |
| TIGR02999 | 183 | Sig-70_X6 RNA polymerase sigma factor, TIGR02999 f | 92.36 | |
| PRK12519 | 194 | RNA polymerase sigma factor; Provisional | 92.34 | |
| COG2973 | 103 | TrpR Trp operon repressor [Transcription] | 92.33 | |
| TIGR02980 | 227 | SigBFG RNA polymerase sigma-70 factor, sigma-B/F/G | 92.31 | |
| PRK15411 | 207 | rcsA colanic acid capsular biosynthesis activation | 92.3 | |
| PRK07037 | 163 | extracytoplasmic-function sigma-70 factor; Validat | 92.27 | |
| PHA01082 | 133 | putative transcription regulator | 92.24 | |
| PRK11361 | 457 | acetoacetate metabolism regulatory protein AtoC; P | 92.17 | |
| smart00418 | 66 | HTH_ARSR helix_turn_helix, Arsenical Resistance Op | 92.16 | |
| PRK09652 | 182 | RNA polymerase sigma factor RpoE; Provisional | 92.15 | |
| PF06892 | 162 | Phage_CP76: Phage regulatory protein CII (CP76); I | 92.07 | |
| PF09012 | 69 | FeoC: FeoC like transcriptional regulator; InterPr | 91.97 | |
| TIGR01818 | 463 | ntrC nitrogen regulation protein NR(I). This model | 91.97 | |
| TIGR02947 | 193 | SigH_actino RNA polymerase sigma-70 factor, TIGR02 | 91.96 | |
| TIGR02850 | 254 | spore_sigG RNA polymerase sigma-G factor. Members | 91.94 | |
| PRK13869 | 405 | plasmid-partitioning protein RepA; Provisional | 91.9 | |
| PRK11511 | 127 | DNA-binding transcriptional activator MarA; Provis | 91.87 | |
| TIGR02393 | 238 | RpoD_Cterm RNA polymerase sigma factor RpoD, C-ter | 91.8 | |
| TIGR03453 | 387 | partition_RepA plasmid partitioning protein RepA. | 91.76 | |
| PRK09639 | 166 | RNA polymerase sigma factor SigX; Provisional | 91.73 | |
| PRK09047 | 161 | RNA polymerase factor sigma-70; Validated | 91.72 | |
| PRK15090 | 257 | DNA-binding transcriptional regulator KdgR; Provis | 91.71 | |
| COG1309 | 201 | AcrR Transcriptional regulator [Transcription] | 91.7 | |
| PRK15115 | 444 | response regulator GlrR; Provisional | 91.69 | |
| PRK14165 | 217 | winged helix-turn-helix domain-containing protein/ | 91.69 | |
| COG5484 | 279 | Uncharacterized conserved protein [Function unknow | 91.62 | |
| smart00347 | 101 | HTH_MARR helix_turn_helix multiple antibiotic resi | 91.59 | |
| PRK08583 | 257 | RNA polymerase sigma factor SigB; Validated | 91.54 | |
| PRK10365 | 441 | transcriptional regulatory protein ZraR; Provision | 91.54 | |
| PF01710 | 119 | HTH_Tnp_IS630: Transposase; InterPro: IPR002622 Tr | 91.53 | |
| TIGR02989 | 159 | Sig-70_gvs1 RNA polymerase sigma-70 factor, Rhodop | 91.53 | |
| PRK08301 | 234 | sporulation sigma factor SigE; Reviewed | 91.44 | |
| PRK10219 | 107 | DNA-binding transcriptional regulator SoxS; Provis | 91.4 | |
| PRK15201 | 198 | fimbriae regulatory protein FimW; Provisional | 91.36 | |
| PRK10046 | 225 | dpiA two-component response regulator DpiA; Provis | 91.33 | |
| TIGR02329 | 526 | propionate_PrpR propionate catabolism operon regul | 91.33 | |
| PRK13919 | 186 | putative RNA polymerase sigma E protein; Provision | 91.33 | |
| PRK09642 | 160 | RNA polymerase sigma factor SigW; Reviewed | 91.32 | |
| PRK07408 | 256 | RNA polymerase sigma factor SigF; Reviewed | 91.25 | |
| TIGR03613 | 202 | RutR pyrimidine utilization regulatory protein R. | 91.22 | |
| PRK12529 | 178 | RNA polymerase sigma factor; Provisional | 91.22 | |
| PRK06986 | 236 | fliA flagellar biosynthesis sigma factor; Validate | 91.21 | |
| PRK12537 | 182 | RNA polymerase sigma factor; Provisional | 91.17 | |
| COG1508 | 444 | RpoN DNA-directed RNA polymerase specialized sigma | 91.16 | |
| cd07377 | 66 | WHTH_GntR Winged helix-turn-helix (WHTH) DNA-bindi | 91.12 | |
| PF11268 | 170 | DUF3071: Protein of unknown function (DUF3071); In | 91.1 | |
| PF07750 | 162 | GcrA: GcrA cell cycle regulator; InterPro: IPR0116 | 91.05 | |
| COG2197 | 211 | CitB Response regulator containing a CheY-like rec | 91.05 | |
| PRK12423 | 202 | LexA repressor; Provisional | 90.96 | |
| TIGR01884 | 203 | cas_HTH CRISPR locus-related DNA-binding protein. | 90.96 | |
| cd00090 | 78 | HTH_ARSR Arsenical Resistance Operon Repressor and | 90.95 | |
| PRK13832 | 520 | plasmid partitioning protein; Provisional | 90.94 | |
| PRK12534 | 187 | RNA polymerase sigma factor; Provisional | 90.93 | |
| COG1595 | 182 | RpoE DNA-directed RNA polymerase specialized sigma | 90.92 | |
| TIGR02366 | 176 | DHAK_reg probable dihydroxyacetone kinase regulato | 90.92 | |
| cd08316 | 97 | Death_FAS_TNFRSF6 Death domain of FAS or TNF recep | 90.88 | |
| PRK12547 | 164 | RNA polymerase sigma factor; Provisional | 90.85 | |
| PRK07122 | 264 | RNA polymerase sigma factor SigF; Reviewed | 90.83 | |
| COG4565 | 224 | CitB Response regulator of citrate/malate metaboli | 90.83 | |
| PRK09649 | 185 | RNA polymerase sigma factor SigC; Reviewed | 90.82 | |
| PRK09645 | 173 | RNA polymerase sigma factor SigL; Provisional | 90.81 | |
| PRK07500 | 289 | rpoH2 RNA polymerase factor sigma-32; Reviewed | 90.8 | |
| TIGR02959 | 170 | SigZ RNA polymerase sigma factor, SigZ family. Thi | 90.76 | |
| PF13463 | 68 | HTH_27: Winged helix DNA-binding domain; PDB: 3GFL | 90.74 | |
| COG3355 | 126 | Predicted transcriptional regulator [Transcription | 90.71 | |
| TIGR01889 | 109 | Staph_reg_Sar staphylococcal accessory regulator f | 90.7 | |
| TIGR02915 | 445 | PEP_resp_reg putative PEP-CTERM system response re | 90.67 | |
| PRK12523 | 172 | RNA polymerase sigma factor; Reviewed | 90.67 | |
| PRK11302 | 284 | DNA-binding transcriptional regulator HexR; Provis | 90.65 | |
| PRK10923 | 469 | glnG nitrogen regulation protein NR(I); Provisiona | 90.64 | |
| PRK15008 | 212 | HTH-type transcriptional regulator RutR; Provision | 90.61 | |
| PRK09975 | 213 | DNA-binding transcriptional regulator EnvR; Provis | 90.61 | |
| COG1654 | 79 | BirA Biotin operon repressor [Transcription] | 90.59 | |
| PRK03573 | 144 | transcriptional regulator SlyA; Provisional | 90.53 | |
| PRK12511 | 182 | RNA polymerase sigma factor; Provisional | 90.52 | |
| PRK10402 | 226 | DNA-binding transcriptional activator YeiL; Provis | 90.5 | |
| smart00342 | 84 | HTH_ARAC helix_turn_helix, arabinose operon contro | 90.47 | |
| cd04778 | 219 | HTH_MerR-like_sg2 Helix-Turn-Helix DNA binding dom | 90.43 | |
| PRK12530 | 189 | RNA polymerase sigma factor; Provisional | 90.4 | |
| PRK13719 | 217 | conjugal transfer transcriptional regulator TraJ; | 90.4 | |
| TIGR00637 | 99 | ModE_repress ModE molybdate transport repressor do | 90.39 | |
| PRK12532 | 195 | RNA polymerase sigma factor; Provisional | 90.36 | |
| PRK05803 | 233 | sporulation sigma factor SigK; Reviewed | 90.36 | |
| COG2771 | 65 | CsgD DNA-binding HTH domain-containing proteins [T | 90.31 | |
| PRK10141 | 117 | DNA-binding transcriptional repressor ArsR; Provis | 90.29 | |
| PRK13777 | 185 | transcriptional regulator Hpr; Provisional | 90.28 | |
| TIGR02479 | 224 | FliA_WhiG RNA polymerase sigma factor, FliA/WhiG f | 90.28 | |
| PRK12513 | 194 | RNA polymerase sigma factor; Provisional | 90.27 | |
| PRK10668 | 215 | DNA-binding transcriptional repressor AcrR; Provis | 90.27 | |
| PRK11050 | 152 | manganese transport regulator MntR; Provisional | 90.27 | |
| PRK12524 | 196 | RNA polymerase sigma factor; Provisional | 90.24 | |
| PRK15424 | 538 | propionate catabolism operon regulatory protein Pr | 90.23 | |
| TIGR02846 | 227 | spore_sigmaK RNA polymerase sigma-K factor. The sp | 90.2 | |
| TIGR02954 | 169 | Sig70_famx3 RNA polymerase sigma-70 factor, TIGR02 | 90.18 | |
| PRK11475 | 207 | DNA-binding transcriptional activator BglJ; Provis | 90.08 | |
| PRK12516 | 187 | RNA polymerase sigma factor; Provisional | 90.08 | |
| PRK09647 | 203 | RNA polymerase sigma factor SigE; Reviewed | 90.08 | |
| PF09862 | 113 | DUF2089: Protein of unknown function (DUF2089); In | 90.07 | |
| PRK10430 | 239 | DNA-binding transcriptional activator DcuR; Provis | 89.96 | |
| COG1349 | 253 | GlpR Transcriptional regulators of sugar metabolis | 89.95 | |
| TIGR03384 | 189 | betaine_BetI transcriptional repressor BetI. BetI | 89.93 | |
| TIGR02983 | 162 | SigE-fam_strep RNA polymerase sigma-70 factor, sig | 89.92 | |
| KOG1168 | 385 | consensus Transcription factor ACJ6/BRN-3, contain | 89.91 | |
| PF04760 | 54 | IF2_N: Translation initiation factor IF-2, N-termi | 89.86 | |
| TIGR02950 | 154 | SigM_subfam RNA polymerase sigma factor, SigM fami | 89.85 | |
| PRK05911 | 257 | RNA polymerase sigma factor sigma-28; Reviewed | 89.85 | |
| TIGR02941 | 255 | Sigma_B RNA polymerase sigma-B factor. This sigma | 89.85 | |
| PRK09641 | 187 | RNA polymerase sigma factor SigW; Provisional | 89.82 | |
| PF08822 | 165 | DUF1804: Protein of unknown function (DUF1804); In | 89.82 | |
| PRK09508 | 314 | leuO leucine transcriptional activator; Reviewed | 89.8 | |
| TIGR02952 | 170 | Sig70_famx2 RNA polymerase sigma-70 factor, TIGR02 | 89.72 | |
| TIGR02997 | 298 | Sig70-cyanoRpoD RNA polymerase sigma factor, cyano | 89.7 | |
| PRK05602 | 186 | RNA polymerase sigma factor; Reviewed | 89.69 | |
| PRK10434 | 256 | srlR DNA-bindng transcriptional repressor SrlR; Pr | 89.67 | |
| PRK12514 | 179 | RNA polymerase sigma factor; Provisional | 89.66 | |
| PF05043 | 87 | Mga: Mga helix-turn-helix domain; InterPro: IPR007 | 89.64 | |
| PRK06930 | 170 | positive control sigma-like factor; Validated | 89.61 | |
| TIGR02835 | 234 | spore_sigmaE RNA polymerase sigma-E factor. Member | 89.5 | |
| PRK12528 | 161 | RNA polymerase sigma factor; Provisional | 89.49 | |
| PRK09392 | 236 | ftrB transcriptional activator FtrB; Provisional | 89.46 | |
| PRK12536 | 181 | RNA polymerase sigma factor; Provisional | 89.42 | |
| PRK12682 | 309 | transcriptional regulator CysB-like protein; Revie | 89.4 | |
| PRK12525 | 168 | RNA polymerase sigma factor; Provisional | 89.4 | |
| PRK10906 | 252 | DNA-binding transcriptional repressor GlpR; Provis | 89.38 | |
| PRK05022 | 509 | anaerobic nitric oxide reductase transcription reg | 89.37 | |
| TIGR02984 | 189 | Sig-70_plancto1 RNA polymerase sigma-70 factor, Pl | 89.34 | |
| PRK09483 | 217 | response regulator; Provisional | 89.3 | |
| PRK12542 | 185 | RNA polymerase sigma factor; Provisional | 89.3 | |
| PRK10681 | 252 | DNA-binding transcriptional repressor DeoR; Provis | 89.27 | |
| PRK11202 | 203 | DNA-binding transcriptional repressor FabR; Provis | 89.26 | |
| PRK09640 | 188 | RNA polymerase sigma factor SigX; Reviewed | 89.18 | |
| PRK12527 | 159 | RNA polymerase sigma factor; Reviewed | 89.12 | |
| TIGR02431 | 248 | pcaR_pcaU beta-ketoadipate pathway transcriptional | 89.11 | |
| COG2963 | 116 | Transposase and inactivated derivatives [DNA repli | 89.07 | |
| PRK11923 | 193 | algU RNA polymerase sigma factor AlgU; Provisional | 89.05 | |
| PF05732 | 165 | RepL: Firmicute plasmid replication protein (RepL) | 88.99 | |
| PRK12526 | 206 | RNA polymerase sigma factor; Provisional | 88.97 | |
| PRK12545 | 201 | RNA polymerase sigma factor; Provisional | 88.96 | |
| PRK10100 | 216 | DNA-binding transcriptional regulator CsgD; Provis | 88.93 | |
| PRK14996 | 192 | TetR family transcriptional regulator; Provisional | 88.91 | |
| COG2826 | 318 | Tra8 Transposase and inactivated derivatives, IS30 | 88.9 | |
| PRK10188 | 240 | DNA-binding transcriptional activator SdiA; Provis | 88.89 | |
| PRK12518 | 175 | RNA polymerase sigma factor; Provisional | 88.88 | |
| PRK09834 | 263 | DNA-binding transcriptional activator MhpR; Provis | 88.86 | |
| PHA02535 | 581 | P terminase ATPase subunit; Provisional | 88.81 | |
| PRK00767 | 197 | transcriptional regulator BetI; Validated | 88.79 | |
| TIGR02948 | 187 | SigW_bacill RNA polymerase sigma-W factor. This si | 88.78 | |
| PF06971 | 50 | Put_DNA-bind_N: Putative DNA-binding protein N-ter | 88.75 | |
| PRK09648 | 189 | RNA polymerase sigma factor SigD; Reviewed | 88.74 | |
| PRK09802 | 269 | DNA-binding transcriptional regulator AgaR; Provis | 88.71 | |
| PHA00738 | 108 | putative HTH transcription regulator | 88.71 | |
| PRK12533 | 216 | RNA polymerase sigma factor; Provisional | 88.7 | |
| TIGR03826 | 137 | YvyF flagellar operon protein TIGR03826. This gene | 88.63 | |
| PRK11557 | 278 | putative DNA-binding transcriptional regulator; Pr | 88.58 | |
| PRK14845 | 1049 | translation initiation factor IF-2; Provisional | 88.52 | |
| PF01726 | 65 | LexA_DNA_bind: LexA DNA binding domain; InterPro: | 88.48 | |
| PRK06288 | 268 | RNA polymerase sigma factor WhiG; Reviewed | 88.43 | |
| PRK12515 | 189 | RNA polymerase sigma factor; Provisional | 88.4 | |
| PRK09638 | 176 | RNA polymerase sigma factor SigY; Reviewed | 88.39 | |
| cd08804 | 84 | Death_ank2 Death domain of Ankyrin-2. Death Domain | 88.35 | |
| PRK12517 | 188 | RNA polymerase sigma factor; Provisional | 88.34 | |
| PF12116 | 82 | SpoIIID: Stage III sporulation protein D; InterPro | 88.33 | |
| PRK04424 | 185 | fatty acid biosynthesis transcriptional regulator; | 88.32 | |
| PRK09646 | 194 | RNA polymerase sigma factor SigK; Reviewed | 88.3 | |
| PRK11388 | 638 | DNA-binding transcriptional regulator DhaR; Provis | 88.3 | |
| PRK09637 | 181 | RNA polymerase sigma factor SigZ; Provisional | 88.29 | |
| cd06571 | 90 | Bac_DnaA_C C-terminal domain of bacterial DnaA pro | 88.29 | |
| PRK12546 | 188 | RNA polymerase sigma factor; Provisional | 88.24 | |
| PRK12522 | 173 | RNA polymerase sigma factor; Provisional | 88.2 | |
| PRK12520 | 191 | RNA polymerase sigma factor; Provisional | 88.16 | |
| PRK15482 | 285 | transcriptional regulator MurR; Provisional | 88.11 | |
| PRK06811 | 189 | RNA polymerase factor sigma-70; Validated | 88.07 | |
| PRK07921 | 324 | RNA polymerase sigma factor SigB; Reviewed | 87.94 | |
| TIGR01565 | 58 | homeo_ZF_HD homeobox domain, ZF-HD class. This mod | 87.93 | |
| PRK09210 | 367 | RNA polymerase sigma factor RpoD; Validated | 87.93 | |
| PRK12540 | 182 | RNA polymerase sigma factor; Provisional | 87.91 | |
| PF00046 | 57 | Homeobox: Homeobox domain not present here.; Inter | 87.82 | |
| PRK12541 | 161 | RNA polymerase sigma factor; Provisional | 87.81 | |
| PRK11337 | 292 | DNA-binding transcriptional repressor RpiR; Provis | 87.75 | |
| TIGR03454 | 325 | partition_RepB plasmid partitioning protein RepB. | 87.75 | |
| PRK11569 | 274 | transcriptional repressor IclR; Provisional | 87.74 | |
| PRK08295 | 208 | RNA polymerase factor sigma-70; Validated | 87.7 | |
| PRK05657 | 325 | RNA polymerase sigma factor RpoS; Validated | 87.67 | |
| TIGR02939 | 190 | RpoE_Sigma70 RNA polymerase sigma factor RpoE. A s | 87.66 | |
| COG1737 | 281 | RpiR Transcriptional regulators [Transcription] | 87.6 | |
| PRK10086 | 311 | DNA-binding transcriptional regulator DsdC; Provis | 87.59 | |
| PRK10163 | 271 | DNA-binding transcriptional repressor AllR; Provis | 87.57 | |
| PRK03601 | 275 | transcriptional regulator HdfR; Provisional | 87.47 | |
| PRK12543 | 179 | RNA polymerase sigma factor; Provisional | 87.42 | |
| COG1321 | 154 | TroR Mn-dependent transcriptional regulator [Trans | 87.41 | |
| PRK09415 | 179 | RNA polymerase factor sigma C; Reviewed | 87.41 | |
| PRK10870 | 176 | transcriptional repressor MprA; Provisional | 87.41 | |
| PRK07405 | 317 | RNA polymerase sigma factor SigD; Validated | 87.37 | |
| PRK07670 | 251 | RNA polymerase sigma factor SigD; Validated | 87.37 | |
| PF14174 | 53 | YycC: YycC-like protein | 87.35 | |
| COG2207 | 127 | AraC AraC-type DNA-binding domain-containing prote | 87.33 | |
| PRK09644 | 165 | RNA polymerase sigma factor SigM; Provisional | 87.26 | |
| PRK12531 | 194 | RNA polymerase sigma factor; Provisional | 87.21 | |
| PRK06704 | 228 | RNA polymerase factor sigma-70; Validated | 87.2 | |
| PRK10820 | 520 | DNA-binding transcriptional regulator TyrR; Provis | 87.09 | |
| PF10743 | 87 | Phage_Cox: Regulatory phage protein cox; InterPro: | 87.03 | |
| PF02082 | 83 | Rrf2: Transcriptional regulator; InterPro: IPR0009 | 87.02 | |
| TIGR02943 | 188 | Sig70_famx1 RNA polymerase sigma-70 factor, TIGR02 | 87.01 | |
| PRK09651 | 172 | RNA polymerase sigma factor FecI; Provisional | 87.0 | |
| PRK12539 | 184 | RNA polymerase sigma factor; Provisional | 86.82 | |
| PRK12512 | 184 | RNA polymerase sigma factor; Provisional | 86.79 | |
| PRK05901 | 509 | RNA polymerase sigma factor; Provisional | 86.74 | |
| PRK09643 | 192 | RNA polymerase sigma factor SigM; Reviewed | 86.68 | |
| PRK13756 | 205 | tetracycline repressor protein TetR; Provisional | 86.57 | |
| PRK11922 | 231 | RNA polymerase sigma factor; Provisional | 86.5 | |
| PRK12538 | 233 | RNA polymerase sigma factor; Provisional | 86.45 | |
| PRK11886 | 319 | bifunctional biotin--[acetyl-CoA-carboxylase] synt | 86.43 | |
| PRK10216 | 319 | DNA-binding transcriptional regulator YidZ; Provis | 86.42 | |
| PRK12535 | 196 | RNA polymerase sigma factor; Provisional | 86.41 | |
| PRK15369 | 211 | two component system sensor kinase SsrB; Provision | 86.4 |
| >PHA01976 helix-turn-helix protein | Back alignment and domain information |
|---|
Probab=99.76 E-value=4.7e-18 Score=90.89 Aligned_cols=58 Identities=28% Similarity=0.476 Sum_probs=55.8
Q ss_pred CHHHHHHHHHhCCCCHHHHHHHhCCCHHHHHHHHcCCCCCCHHHHHHHHHHhCCCCcc
Q 038591 21 TPRQIQRARLGKKMSQPDLANQINQRPQVVSEYENGKAVPNQTVLAKMEKAIGVKLRV 78 (82)
Q Consensus 21 ~~~~lk~~r~~~g~s~~elA~~~gis~~~i~~~e~g~~~p~~~~~~~la~~lgv~~~e 78 (82)
.+.+|+.+|+..|+||.+||+.+|+++++|++||+|...|+.+.+.+||++|||++++
T Consensus 3 ~~~rl~~~R~~~glt~~~lA~~~gvs~~~v~~~e~g~~~p~~~~l~~ia~~l~v~~~~ 60 (67)
T PHA01976 3 FAIQLIKARNARAWSAPELSRRAGVRHSLIYDFEADKRLPNLKTLLRLADALGVTLDW 60 (67)
T ss_pred HHHHHHHHHHHcCCCHHHHHHHhCCCHHHHHHHHcCCCCCCHHHHHHHHHHHCcCHHH
Confidence 4789999999999999999999999999999999999999999999999999999875
|
|
| >PF12844 HTH_19: Helix-turn-helix domain; PDB: 3LIS_B 3LFP_A 2XIU_B 2GZU_B 2XJ3_A 1UTX_A 2XI8_B 3F6W_C 3EUS_B | Back alignment and domain information |
|---|
| >PF01381 HTH_3: Helix-turn-helix; InterPro: IPR001387 This is large family of DNA binding helix-turn helix proteins that include a bacterial plasmid copy control protein, bacterial methylases, various bacteriophage transcription control proteins and a vegetative specific protein from Dictyostelium discoideum (Slime mould) | Back alignment and domain information |
|---|
| >COG1476 Predicted transcriptional regulators [Transcription] | Back alignment and domain information |
|---|
| >TIGR03070 couple_hipB transcriptional regulator, y4mF family | Back alignment and domain information |
|---|
| >PRK06424 transcription factor; Provisional | Back alignment and domain information |
|---|
| >PRK08359 transcription factor; Validated | Back alignment and domain information |
|---|
| >PF13560 HTH_31: Helix-turn-helix domain; PDB: 3F51_C 3F52_A 3PXP_A 2OFY_A | Back alignment and domain information |
|---|
| >PRK09726 antitoxin HipB; Provisional | Back alignment and domain information |
|---|
| >TIGR00270 conserved hypothetical protein TIGR00270 | Back alignment and domain information |
|---|
| >PRK09706 transcriptional repressor DicA; Reviewed | Back alignment and domain information |
|---|
| >TIGR02607 antidote_HigA addiction module antidote protein, HigA family | Back alignment and domain information |
|---|
| >PRK13890 conjugal transfer protein TrbA; Provisional | Back alignment and domain information |
|---|
| >PRK09943 DNA-binding transcriptional repressor PuuR; Provisional | Back alignment and domain information |
|---|
| >PRK08154 anaerobic benzoate catabolism transcriptional regulator; Reviewed | Back alignment and domain information |
|---|
| >TIGR02684 dnstrm_HI1420 probable addiction module antidote protein | Back alignment and domain information |
|---|
| >PF13443 HTH_26: Cro/C1-type HTH DNA-binding domain; PDB: 3TYR_A 3TYS_A 3B7H_A | Back alignment and domain information |
|---|
| >PRK10072 putative transcriptional regulator; Provisional | Back alignment and domain information |
|---|
| >TIGR02612 mob_myst_A mobile mystery protein A | Back alignment and domain information |
|---|
| >PRK04140 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >smart00530 HTH_XRE Helix-turn-helix XRE-family like proteins | Back alignment and domain information |
|---|
| >KOG3398 consensus Transcription factor MBF1 [Transcription] | Back alignment and domain information |
|---|
| >cd00093 HTH_XRE Helix-turn-helix XRE-family like proteins | Back alignment and domain information |
|---|
| >TIGR03830 CxxCG_CxxCG_HTH putative zinc finger/helix-turn-helix protein, YgiT family | Back alignment and domain information |
|---|
| >COG1813 Predicted transcription factor, homolog of eukaryotic MBF1 [Transcription] | Back alignment and domain information |
|---|
| >PHA00542 putative Cro-like protein | Back alignment and domain information |
|---|
| >COG2944 Predicted transcriptional regulator [Transcription] | Back alignment and domain information |
|---|
| >PRK10856 cytoskeletal protein RodZ; Provisional | Back alignment and domain information |
|---|
| >PF13744 HTH_37: Helix-turn-helix domain; PDB: 2A6C_B 2O38_A | Back alignment and domain information |
|---|
| >COG3620 Predicted transcriptional regulator with C-terminal CBS domains [Transcription] | Back alignment and domain information |
|---|
| >COG3093 VapI Plasmid maintenance system antidote protein [General function prediction only] | Back alignment and domain information |
|---|
| >PRK13355 bifunctional HTH-domain containing protein/aminotransferase; Provisional | Back alignment and domain information |
|---|
| >PRK02866 cyanate hydratase; Validated | Back alignment and domain information |
|---|
| >smart00352 POU Found in Pit-Oct-Unc transcription factors | Back alignment and domain information |
|---|
| >PF07022 Phage_CI_repr: Bacteriophage CI repressor helix-turn-helix domain; InterPro: IPR010744 This family consists of several phage CI repressor proteins and related bacterial sequences | Back alignment and domain information |
|---|
| >TIGR00673 cynS cyanate hydratase | Back alignment and domain information |
|---|
| >COG3655 Predicted transcriptional regulator [Transcription] | Back alignment and domain information |
|---|
| >COG1709 Predicted transcriptional regulator [Transcription] | Back alignment and domain information |
|---|
| >PF13413 HTH_25: Helix-turn-helix domain; PDB: 2WUS_R 3FYM_A | Back alignment and domain information |
|---|
| >COG1395 Predicted transcriptional regulator [Transcription] | Back alignment and domain information |
|---|
| >COG1396 HipB Predicted transcriptional regulators [Transcription] | Back alignment and domain information |
|---|
| >PF08667 BetR: BetR domain; InterPro: IPR013975 CheY-like phosphoacceptor (or receiver [REC]) domain is a common module in a variety of response regulators of the bacterial signal transduction systems | Back alignment and domain information |
|---|
| >PHA01083 hypothetical protein | Back alignment and domain information |
|---|
| >cd01392 HTH_LacI Helix-turn-helix (HTH) DNA binding domain of the LacI family of transcriptional regulators | Back alignment and domain information |
|---|
| >COG5499 Predicted transcription regulator containing HTH domain [Transcription] | Back alignment and domain information |
|---|
| >PF00356 LacI: Bacterial regulatory proteins, lacI family; InterPro: IPR000843 Numerous bacterial transcription regulatory proteins bind DNA via a helix-turn-helix (HTH) motif | Back alignment and domain information |
|---|
| >COG1426 Predicted transcriptional regulator contains Xre-like HTH domain [Function unknown] | Back alignment and domain information |
|---|
| >PF08965 DUF1870: Domain of unknown function (DUF1870); InterPro: IPR015060 This family consist of hypothetical bacterial proteins | Back alignment and domain information |
|---|
| >COG3636 Predicted transcriptional regulator [Transcription] | Back alignment and domain information |
|---|
| >smart00354 HTH_LACI helix_turn _helix lactose operon repressor | Back alignment and domain information |
|---|
| >TIGR01321 TrpR trp operon repressor, proteobacterial | Back alignment and domain information |
|---|
| >COG4800 Predicted transcriptional regulator with an HTH domain [Transcription] | Back alignment and domain information |
|---|
| >COG2522 Predicted transcriptional regulator [General function prediction only] | Back alignment and domain information |
|---|
| >PF13693 HTH_35: Winged helix-turn-helix DNA-binding; PDB: 1NEQ_A 1NER_A | Back alignment and domain information |
|---|
| >COG3423 Nlp Predicted transcriptional regulator [Transcription] | Back alignment and domain information |
|---|
| >PRK08099 bifunctional DNA-binding transcriptional repressor/ NMN adenylyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR02147 Fsuc_second hypothetical protein, TIGR02147 | Back alignment and domain information |
|---|
| >PF13384 HTH_23: Homeodomain-like domain; PDB: 2X48_C | Back alignment and domain information |
|---|
| >PRK10344 DNA-binding transcriptional regulator Nlp; Provisional | Back alignment and domain information |
|---|
| >PRK09526 lacI lac repressor; Reviewed | Back alignment and domain information |
|---|
| >TIGR01481 ccpA catabolite control protein A | Back alignment and domain information |
|---|
| >PRK10014 DNA-binding transcriptional repressor MalI; Provisional | Back alignment and domain information |
|---|
| >PRK09492 treR trehalose repressor; Provisional | Back alignment and domain information |
|---|
| >PHA00675 hypothetical protein | Back alignment and domain information |
|---|
| >PF02796 HTH_7: Helix-turn-helix domain of resolvase; InterPro: IPR006120 Site-specific recombination plays an important role in DNA rearrangement in prokaryotic organisms | Back alignment and domain information |
|---|
| >PRK10703 DNA-binding transcriptional repressor PurR; Provisional | Back alignment and domain information |
|---|
| >PRK11303 DNA-binding transcriptional regulator FruR; Provisional | Back alignment and domain information |
|---|
| >TIGR02405 trehalos_R_Ecol trehalose operon repressor, proteobacterial | Back alignment and domain information |
|---|
| >PRK10727 DNA-binding transcriptional regulator GalR; Provisional | Back alignment and domain information |
|---|
| >TIGR02844 spore_III_D sporulation transcriptional regulator SpoIIID | Back alignment and domain information |
|---|
| >PF14549 P22_Cro: DNA-binding transcriptional regulator Cro; PDB: 1RZS_A 3BD1_A 3QWS_A 2HIN_B | Back alignment and domain information |
|---|
| >PRK14987 gluconate operon transcriptional regulator; Provisional | Back alignment and domain information |
|---|
| >TIGR03879 near_KaiC_dom probable regulatory domain | Back alignment and domain information |
|---|
| >TIGR02293 TAS_TIGR02293 putative toxin-antitoxin system antitoxin component, TIGR02293 family | Back alignment and domain information |
|---|
| >PF04814 HNF-1_N: Hepatocyte nuclear factor 1 (HNF-1), N terminus; InterPro: IPR006899 This domain consists of the N terminus of homeobox-containing transcription factor HNF-1 | Back alignment and domain information |
|---|
| >PRK10401 DNA-binding transcriptional regulator GalS; Provisional | Back alignment and domain information |
|---|
| >PF00157 Pou: Pou domain - N-terminal to homeobox domain; InterPro: IPR000327 POU proteins are eukaryotic transcription factors containing a bipartite DNA binding domain referred to as the POU domain | Back alignment and domain information |
|---|
| >TIGR02417 fruct_sucro_rep D-fructose-responsive transcription factor | Back alignment and domain information |
|---|
| >PHA02591 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF13936 HTH_38: Helix-turn-helix domain; PDB: 2W48_A | Back alignment and domain information |
|---|
| >PF13412 HTH_24: Winged helix-turn-helix DNA-binding; PDB: 1I1G_B 2IA0_B 3I4P_A 2GQQ_A 2L4A_A 2CFX_B 2DBB_B 2EFO_A 2EFQ_A 2PN6_A | Back alignment and domain information |
|---|
| >COG1609 PurR Transcriptional regulators [Transcription] | Back alignment and domain information |
|---|
| >PRK03975 tfx putative transcriptional regulator; Provisional | Back alignment and domain information |
|---|
| >COG5606 Uncharacterized conserved small protein [Function unknown] | Back alignment and domain information |
|---|
| >COG4197 Uncharacterized protein conserved in bacteria, prophage-related [Function unknown] | Back alignment and domain information |
|---|
| >PRK10339 DNA-binding transcriptional repressor EbgR; Provisional | Back alignment and domain information |
|---|
| >PRK10423 transcriptional repressor RbsR; Provisional | Back alignment and domain information |
|---|
| >cd04762 HTH_MerR-trunc Helix-Turn-Helix DNA binding domain of truncated MerR-like proteins | Back alignment and domain information |
|---|
| >PF08535 KorB: KorB domain; InterPro: IPR013741 This entry contains several KorB transcriptional repressor proteins | Back alignment and domain information |
|---|
| >PF06056 Terminase_5: Putative ATPase subunit of terminase (gpP-like); InterPro: IPR010332 This family of proteins are annotated as ATPase subunits of phage terminase after [] | Back alignment and domain information |
|---|
| >PF05269 Phage_CII: Bacteriophage CII protein; InterPro: IPR007933 The CII protein is a transcription activator, conserved in bacteriophage lambda and related phages, that plays a key role in the decision between lytic or lysogenic phage development | Back alignment and domain information |
|---|
| >PF02954 HTH_8: Bacterial regulatory protein, Fis family; InterPro: IPR002197 The Factor for Inversion Stimulation (FIS) protein is a regulator of bacterial functions, and binds specifically to weakly related DNA sequences [,] | Back alignment and domain information |
|---|
| >TIGR00721 tfx DNA-binding protein, Tfx family | Back alignment and domain information |
|---|
| >PF12728 HTH_17: Helix-turn-helix domain | Back alignment and domain information |
|---|
| >TIGR01764 excise DNA binding domain, excisionase family | Back alignment and domain information |
|---|
| >PF07037 DUF1323: Putative transcription regulator (DUF1323); InterPro: IPR010749 This family consists of several hypothetical Enterobacterial proteins of around 120 residues in length | Back alignment and domain information |
|---|
| >PF13518 HTH_28: Helix-turn-helix domain | Back alignment and domain information |
|---|
| >PF00325 Crp: Bacterial regulatory proteins, crp family; InterPro: IPR001808 Numerous bacterial transcription regulatory proteins bind DNA via a helix-turn-helix (HTH) motif | Back alignment and domain information |
|---|
| >cd04761 HTH_MerR-SF Helix-Turn-Helix DNA binding domain of transcription regulators from the MerR superfamily | Back alignment and domain information |
|---|
| >PF10668 Phage_terminase: Phage terminase small subunit; InterPro: IPR018925 This entry describes the terminase small subunit from Enterococcus phage phiFL1A, related proteins in other bacteriophage, and prophage regions of bacterial genomes | Back alignment and domain information |
|---|
| >cd04764 HTH_MlrA-like_sg1 Helix-Turn-Helix DNA binding domain of putative MlrA-like transcription regulators | Back alignment and domain information |
|---|
| >PF00376 MerR: MerR family regulatory protein; InterPro: IPR000551 The many bacterial transcription regulation proteins which bind DNA through a 'helix-turn-helix' motif can be classified into subfamilies on the basis of sequence similarities | Back alignment and domain information |
|---|
| >PF04545 Sigma70_r4: Sigma-70, region 4; InterPro: IPR007630 The bacterial core RNA polymerase complex, which consists of five subunits, is sufficient for transcription elongation and termination but is unable to initiate transcription | Back alignment and domain information |
|---|
| >TIGR02531 yecD_yerC TrpR-related protein YerC/YecD | Back alignment and domain information |
|---|
| >PF08279 HTH_11: HTH domain; InterPro: IPR013196 Winged helix DNA-binding proteins share a related winged helix-turn-helix DNA-binding motif, where the "wings", or loops, are small beta-sheets | Back alignment and domain information |
|---|
| >PF02001 DUF134: Protein of unknown function DUF134; InterPro: IPR002852 The bacterial and archaeal proteins in this family have no known function | Back alignment and domain information |
|---|
| >COG1356 tfx Transcriptional regulator [DNA replication, recombination and repair] | Back alignment and domain information |
|---|
| >cd01104 HTH_MlrA-CarA Helix-Turn-Helix DNA binding domain of the transcription regulators MlrA and CarA | Back alignment and domain information |
|---|
| >PRK08558 adenine phosphoribosyltransferase; Provisional | Back alignment and domain information |
|---|
| >PF04218 CENP-B_N: CENP-B N-terminal DNA-binding domain; InterPro: IPR006695 Centromere Protein B (CENP-B) is a DNA-binding protein localized to the centromere | Back alignment and domain information |
|---|
| >PF02376 CUT: CUT domain; InterPro: IPR003350 A class, also called ONECUT, of homeodomain proteins | Back alignment and domain information |
|---|
| >PF04967 HTH_10: HTH DNA binding domain; InterPro: IPR007050 Numerous bacterial transcription regulatory proteins bind DNA via a helix-turn-helix (HTH) motif | Back alignment and domain information |
|---|
| >PRK01381 Trp operon repressor; Provisional | Back alignment and domain information |
|---|
| >cd04763 HTH_MlrA-like Helix-Turn-Helix DNA binding domain of MlrA-like transcription regulators | Back alignment and domain information |
|---|
| >PF13411 MerR_1: MerR HTH family regulatory protein; PDB: 2JML_A 3GP4_A 3GPV_B | Back alignment and domain information |
|---|
| >PF05225 HTH_psq: helix-turn-helix, Psq domain; InterPro: IPR007889 This DNA-binding motif is found in four copies in the pipsqueak protein of Drosophila melanogaster [] | Back alignment and domain information |
|---|
| >cd00569 HTH_Hin_like Helix-turn-helix domain of Hin and related proteins, a family of DNA-binding domains unique to bacteria and represented by the Hin protein of Salmonella | Back alignment and domain information |
|---|
| >PRK15418 transcriptional regulator LsrR; Provisional | Back alignment and domain information |
|---|
| >PRK13698 plasmid-partitioning protein; Provisional | Back alignment and domain information |
|---|
| >PF13404 HTH_AsnC-type: AsnC-type helix-turn-helix domain; PDB: 2ZNY_E 2ZNZ_G 1RI7_A 2CYY_A 2E1C_A 2VC1_B 2QZ8_A 2W29_C 2IVM_B 2VBX_B | Back alignment and domain information |
|---|
| >smart00422 HTH_MERR helix_turn_helix, mercury resistance | Back alignment and domain information |
|---|
| >TIGR02044 CueR Cu(I)-responsive transcriptional regulator | Back alignment and domain information |
|---|
| >cd01109 HTH_YyaN Helix-Turn-Helix DNA binding domain of the MerR-like transcription regulators YyaN and YraB | Back alignment and domain information |
|---|
| >COG1342 Predicted DNA-binding proteins [General function prediction only] | Back alignment and domain information |
|---|
| >COG2390 DeoR Transcriptional regulator, contains sigma factor-related N-terminal domain [Transcription] | Back alignment and domain information |
|---|
| >PF01527 HTH_Tnp_1: Transposase; InterPro: IPR002514 Transposase proteins are necessary for efficient DNA transposition | Back alignment and domain information |
|---|
| >PF01047 MarR: MarR family; InterPro: IPR000835 The MarR-type HTH domain is a DNA-binding, winged helix-turn-helix (wHTH) domain of about 135 amino acids present in transcription regulators of the MarR/SlyA family, involved in the development of antibiotic resistance | Back alignment and domain information |
|---|
| >cd04781 HTH_MerR-like_sg6 Helix-Turn-Helix DNA binding domain of putative transcription regulators from the MerR superfamily | Back alignment and domain information |
|---|
| >PF04552 Sigma54_DBD: Sigma-54, DNA binding domain; InterPro: IPR007634 This DNA-binding domain is based on peptide fragmentation data | Back alignment and domain information |
|---|
| >PRK09744 DNA-binding transcriptional regulator DicC; Provisional | Back alignment and domain information |
|---|
| >COG2842 Uncharacterized ATPase, putative transposase [General function prediction only] | Back alignment and domain information |
|---|
| >smart00550 Zalpha Z-DNA-binding domain in adenosine deaminases | Back alignment and domain information |
|---|
| >cd06171 Sigma70_r4 Sigma70, region (SR) 4 refers to the most C-terminal of four conserved domains found in Escherichia coli (Ec) sigma70, the main housekeeping sigma, and related sigma-factors (SFs) | Back alignment and domain information |
|---|
| >PF13022 HTH_Tnp_1_2: Helix-turn-helix of insertion element transposase; PDB: 2AO9_I | Back alignment and domain information |
|---|
| >TIGR00180 parB_part ParB-like partition proteins | Back alignment and domain information |
|---|
| >COG1513 CynS Cyanate lyase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >smart00421 HTH_LUXR helix_turn_helix, Lux Regulon | Back alignment and domain information |
|---|
| >PF01418 HTH_6: Helix-turn-helix domain, rpiR family; InterPro: IPR000281 This domain contains a helix-turn-helix motif [] | Back alignment and domain information |
|---|
| >COG1318 Predicted transcriptional regulators [Transcription] | Back alignment and domain information |
|---|
| >cd01105 HTH_GlnR-like Helix-Turn-Helix DNA binding domain of GlnR-like transcription regulators | Back alignment and domain information |
|---|
| >TIGR02054 MerD mercuric resistence transcriptional repressor protein MerD | Back alignment and domain information |
|---|
| >cd04773 HTH_TioE_rpt2 Second Helix-Turn-Helix DNA binding domain of the regulatory protein TioE | Back alignment and domain information |
|---|
| >cd04784 HTH_CadR-PbrR Helix-Turn-Helix DNA binding domain of the CadR and PbrR transcription regulators | Back alignment and domain information |
|---|
| >PRK04217 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK10227 DNA-binding transcriptional regulator CueR; Provisional | Back alignment and domain information |
|---|
| >cd01108 HTH_CueR Helix-Turn-Helix DNA binding domain of CueR-like transcription regulators | Back alignment and domain information |
|---|
| >PF13545 HTH_Crp_2: Crp-like helix-turn-helix domain; PDB: 3LA2_A 3LA3_B 3LA7_A 3B02_A 3E97_A 2H6C_B 1OMI_A 2BGC_H 2BEO_A 2GAU_A | Back alignment and domain information |
|---|
| >smart00420 HTH_DEOR helix_turn_helix, Deoxyribose operon repressor | Back alignment and domain information |
|---|
| >PF13551 HTH_29: Winged helix-turn helix | Back alignment and domain information |
|---|
| >PF05930 Phage_AlpA: Prophage CP4-57 regulatory protein (AlpA); InterPro: IPR010260 This entry is represents phage P4, Orf88 | Back alignment and domain information |
|---|
| >cd04777 HTH_MerR-like_sg1 Helix-Turn-Helix DNA binding domain of putative transcription regulators from the MerR superfamily | Back alignment and domain information |
|---|
| >KOG3802 consensus Transcription factor OCT-1, contains POU and HOX domains [Transcription] | Back alignment and domain information |
|---|
| >PF08281 Sigma70_r4_2: Sigma-70, region 4; InterPro: IPR013249 The bacterial core RNA polymerase complex, which consists of five subunits, is sufficient for transcription elongation and termination but is unable to initiate transcription | Back alignment and domain information |
|---|
| >TIGR03764 ICE_PFGI_1_parB integrating conjugative element, PFGI_1 class, ParB family protein | Back alignment and domain information |
|---|
| >PF08220 HTH_DeoR: DeoR-like helix-turn-helix domain; InterPro: IPR001034 The deoR-type HTH domain is a DNA-binding, helix-turn-helix (HTH) domain of about 50-60 amino acids present in transcription regulators of the deoR family, involved in sugar catabolism | Back alignment and domain information |
|---|
| >PF00165 HTH_AraC: Bacterial regulatory helix-turn-helix proteins, AraC family; PDB: 1WPK_A 1ZGW_A 1U8B_A | Back alignment and domain information |
|---|
| >TIGR02047 CadR-PbrR Cd(II)/Pb(II)-responsive transcriptional regulator | Back alignment and domain information |
|---|
| >PRK13749 transcriptional regulator MerD; Provisional | Back alignment and domain information |
|---|
| >PRK09413 IS2 repressor TnpA; Reviewed | Back alignment and domain information |
|---|
| >PRK15002 redox-sensitivie transcriptional activator SoxR; Provisional | Back alignment and domain information |
|---|
| >PF01371 Trp_repressor: Trp repressor protein; InterPro: IPR000831 The Trp repressor (TrpR) binds to at least five operators in the Escherichia coli genome, repressing gene expression | Back alignment and domain information |
|---|
| >PF12802 MarR_2: MarR family; PDB: 3ECO_B 2QWW_B 3KP6_B 3KP4_B 3KP2_A 3KP5_A 3KP3_B 3KP7_A 3NQO_B 3K0L_B | Back alignment and domain information |
|---|
| >cd00092 HTH_CRP helix_turn_helix, cAMP Regulatory protein C-terminus; DNA binding domain of prokaryotic regulatory proteins belonging to the catabolite activator protein family | Back alignment and domain information |
|---|
| >cd04789 HTH_Cfa Helix-Turn-Helix DNA binding domain of the Cfa transcription regulator | Back alignment and domain information |
|---|
| >PF11427 HTH_Tnp_Tc3_1: Tc3 transposase; PDB: 1U78_A 1TC3_C | Back alignment and domain information |
|---|
| >cd01107 HTH_BmrR Helix-Turn-Helix DNA binding domain of the BmrR transcription regulator | Back alignment and domain information |
|---|
| >PRK00118 putative DNA-binding protein; Validated | Back alignment and domain information |
|---|
| >PF13011 LZ_Tnp_IS481: leucine-zipper of insertion element IS481 | Back alignment and domain information |
|---|
| >PF13613 HTH_Tnp_4: Helix-turn-helix of DDE superfamily endonuclease | Back alignment and domain information |
|---|
| >cd01106 HTH_TipAL-Mta Helix-Turn-Helix DNA binding domain of the transcription regulators TipAL, Mta, and SkgA | Back alignment and domain information |
|---|
| >smart00419 HTH_CRP helix_turn_helix, cAMP Regulatory protein | Back alignment and domain information |
|---|
| >PF02042 RWP-RK: RWP-RK domain; InterPro: IPR003035 This domain is named RWP-RK after a conserved motif at the C terminus of the domain | Back alignment and domain information |
|---|
| >PRK09514 zntR zinc-responsive transcriptional regulator; Provisional | Back alignment and domain information |
|---|
| >TIGR02043 ZntR Zn(II)-responsive transcriptional regulator | Back alignment and domain information |
|---|
| >cd04765 HTH_MlrA-like_sg2 Helix-Turn-Helix DNA binding domain of putative MlrA-like transcription regulators | Back alignment and domain information |
|---|
| >cd04768 HTH_BmrR-like Helix-Turn-Helix DNA binding domain of BmrR-like transcription regulators | Back alignment and domain information |
|---|
| >cd04772 HTH_TioE_rpt1 First Helix-Turn-Helix DNA binding domain of the regulatory protein TioE | Back alignment and domain information |
|---|
| >PRK15043 transcriptional regulator MirA; Provisional | Back alignment and domain information |
|---|
| >TIGR01610 phage_O_Nterm phage replication protein O, N-terminal domain | Back alignment and domain information |
|---|
| >cd04774 HTH_YfmP Helix-Turn-Helix DNA binding domain of the YfmP transcription regulator | Back alignment and domain information |
|---|
| >smart00351 PAX Paired Box domain | Back alignment and domain information |
|---|
| >PF09339 HTH_IclR: IclR helix-turn-helix domain; InterPro: IPR005471 The many bacterial transcription regulation proteins which bind DNA through a 'helix-turn-helix' motif can be classified into subfamilies on the basis of sequence similarities | Back alignment and domain information |
|---|
| >cd04788 HTH_NolA-AlbR Helix-Turn-Helix DNA binding domain of the transcription regulators NolA and AlbR | Back alignment and domain information |
|---|
| >PRK04132 replication factor C small subunit; Provisional | Back alignment and domain information |
|---|
| >cd04775 HTH_Cfa-like Helix-Turn-Helix DNA binding domain of Cfa-like transcription regulators | Back alignment and domain information |
|---|
| >cd04786 HTH_MerR-like_sg7 Helix-Turn-Helix DNA binding domain of putative transcription regulators from the MerR superfamily | Back alignment and domain information |
|---|
| >PF14590 DUF4447: Domain of unknown function (DUF4447); PDB: 2OX6_B | Back alignment and domain information |
|---|
| >PRK10840 transcriptional regulator RcsB; Provisional | Back alignment and domain information |
|---|
| >PRK11891 aspartate carbamoyltransferase; Provisional | Back alignment and domain information |
|---|
| >cd04782 HTH_BltR Helix-Turn-Helix DNA binding domain of the BltR transcription regulator | Back alignment and domain information |
|---|
| >cd00592 HTH_MerR-like Helix-Turn-Helix DNA binding domain of MerR-like transcription regulators | Back alignment and domain information |
|---|
| >COG3415 Transposase and inactivated derivatives [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >COG3311 AlpA Predicted transcriptional regulator [Transcription] | Back alignment and domain information |
|---|
| >COG1191 FliA DNA-directed RNA polymerase specialized sigma subunit [Transcription] | Back alignment and domain information |
|---|
| >cd04766 HTH_HspR Helix-Turn-Helix DNA binding domain of the HspR transcription regulator | Back alignment and domain information |
|---|
| >COG1522 Lrp Transcriptional regulators [Transcription] | Back alignment and domain information |
|---|
| >PF07638 Sigma70_ECF: ECF sigma factor | Back alignment and domain information |
|---|
| >cd00131 PAX Paired Box domain | Back alignment and domain information |
|---|
| >cd01111 HTH_MerD Helix-Turn-Helix DNA binding domain of the MerD transcription regulator | Back alignment and domain information |
|---|
| >cd01279 HTH_HspR-like Helix-Turn-Helix DNA binding domain of HspR-like transcription regulators | Back alignment and domain information |
|---|
| >PRK10458 DNA cytosine methylase; Provisional | Back alignment and domain information |
|---|
| >PF12840 HTH_20: Helix-turn-helix domain; PDB: 1ULY_A 2CWE_A 1Y0U_B 2QUF_B 2QLZ_C 2OQG_B 2ZKZ_C 3PQK_A 3PQJ_D 3F6O_B | Back alignment and domain information |
|---|
| >COG0789 SoxR Predicted transcriptional regulators [Transcription] | Back alignment and domain information |
|---|
| >cd04780 HTH_MerR-like_sg5 Helix-Turn-Helix DNA binding domain of putative transcription regulators from the MerR superfamily | Back alignment and domain information |
|---|
| >PF13309 HTH_22: HTH domain | Back alignment and domain information |
|---|
| >PRK13752 putative transcriptional regulator MerR; Provisional | Back alignment and domain information |
|---|
| >cd01282 HTH_MerR-like_sg3 Helix-Turn-Helix DNA binding domain of putative transcription regulators from the MerR superfamily | Back alignment and domain information |
|---|
| >PF01978 TrmB: Sugar-specific transcriptional regulator TrmB; InterPro: IPR002831 TrmB, is a protein of 38,800 apparent molecular weight, that is involved in the maltose-specific regulation of the trehalose/maltose ABC transport operon in Thermococcus litoralis | Back alignment and domain information |
|---|
| >PF13542 HTH_Tnp_ISL3: Helix-turn-helix domain of transposase family ISL3 | Back alignment and domain information |
|---|
| >cd06170 LuxR_C_like C-terminal DNA-binding domain of LuxR-like proteins | Back alignment and domain information |
|---|
| >PF13730 HTH_36: Helix-turn-helix domain | Back alignment and domain information |
|---|
| >cd04769 HTH_MerR2 Helix-Turn-Helix DNA binding domain of MerR2-like transcription regulators | Back alignment and domain information |
|---|
| >cd04783 HTH_MerR1 Helix-Turn-Helix DNA binding domain of the MerR1 transcription regulator | Back alignment and domain information |
|---|
| >smart00497 IENR1 Intron encoded nuclease repeat motif | Back alignment and domain information |
|---|
| >cd04770 HTH_HMRTR Helix-Turn-Helix DNA binding domain of Heavy Metal Resistance transcription regulators | Back alignment and domain information |
|---|
| >cd04767 HTH_HspR-like_MBC Helix-Turn-Helix DNA binding domain of putative HspR-like transcription regulators | Back alignment and domain information |
|---|
| >PRK13182 racA polar chromosome segregation protein; Reviewed | Back alignment and domain information |
|---|
| >PRK11169 leucine-responsive transcriptional regulator; Provisional | Back alignment and domain information |
|---|
| >TIGR03697 NtcA_cyano global nitrogen regulator NtcA, cyanobacterial | Back alignment and domain information |
|---|
| >PF01022 HTH_5: Bacterial regulatory protein, arsR family; InterPro: IPR001845 Bacterial transcription regulatory proteins that bind DNA via a helix-turn-helix (HTH) motif can be grouped into families on the basis of sequence similarities | Back alignment and domain information |
|---|
| >TIGR01950 SoxR redox-sensitive transcriptional activator SoxR | Back alignment and domain information |
|---|
| >smart00346 HTH_ICLR helix_turn_helix isocitrate lyase regulation | Back alignment and domain information |
|---|
| >PF09048 Cro: Cro; InterPro: IPR000655 Bacteriophage lambda encodes two repressors: the Cro repressor that acts to turn off early gene transcription during the lytic cycle, and the lambda or cI repressor that is required to maintain lysogenic growth | Back alignment and domain information |
|---|
| >cd04787 HTH_HMRTR_unk Helix-Turn-Helix DNA binding domain of putative Heavy Metal Resistance transcription regulators | Back alignment and domain information |
|---|
| >PRK00430 fis global DNA-binding transcriptional dual regulator Fis; Provisional | Back alignment and domain information |
|---|
| >PF00196 GerE: Bacterial regulatory proteins, luxR family; InterPro: IPR000792 This domain is a DNA-binding, helix-turn-helix (HTH) domain of about 65 amino acids, present in transcription regulators of the LuxR/FixJ family of response regulators | Back alignment and domain information |
|---|
| >cd01110 HTH_SoxR Helix-Turn-Helix DNA binding domain of the SoxR transcription regulator | Back alignment and domain information |
|---|
| >PF13556 HTH_30: PucR C-terminal helix-turn-helix domain; PDB: 3ONQ_B | Back alignment and domain information |
|---|
| >PRK01905 DNA-binding protein Fis; Provisional | Back alignment and domain information |
|---|
| >cd04776 HTH_GnyR Helix-Turn-Helix DNA binding domain of the regulatory protein GnyR | Back alignment and domain information |
|---|
| >PF00440 TetR_N: Bacterial regulatory proteins, tetR family; InterPro: IPR001647 This entry represents a DNA-binding domain with a helix-turn-helix (HTH) structure that is found in several bacterial and archaeal transcriptional regulators, such as TetR, the tetracycline resistance repressor | Back alignment and domain information |
|---|
| >PRK12469 RNA polymerase factor sigma-54; Provisional | Back alignment and domain information |
|---|
| >TIGR02885 spore_sigF RNA polymerase sigma-F factor | Back alignment and domain information |
|---|
| >TIGR01636 phage_rinA phage transcriptional activator, RinA family | Back alignment and domain information |
|---|
| >cd04779 HTH_MerR-like_sg4 Helix-Turn-Helix DNA binding domain of putative transcription regulators from the MerR superfamily | Back alignment and domain information |
|---|
| >PRK11512 DNA-binding transcriptional repressor MarR; Provisional | Back alignment and domain information |
|---|
| >cd04785 HTH_CadR-PbrR-like Helix-Turn-Helix DNA binding domain of the CadR- and PbrR-like transcription regulators | Back alignment and domain information |
|---|
| >PF00126 HTH_1: Bacterial regulatory helix-turn-helix protein, lysR family; InterPro: IPR000847 Numerous bacterial transcription regulatory proteins bind DNA via a helix-turn-helix (HTH) motif | Back alignment and domain information |
|---|
| >PRK11179 DNA-binding transcriptional regulator AsnC; Provisional | Back alignment and domain information |
|---|
| >TIGR00122 birA_repr_reg BirA biotin operon repressor domain | Back alignment and domain information |
|---|
| >PRK13918 CRP/FNR family transcriptional regulator; Provisional | Back alignment and domain information |
|---|
| >TIGR02395 rpoN_sigma RNA polymerase sigma-54 factor | Back alignment and domain information |
|---|
| >smart00344 HTH_ASNC helix_turn_helix ASNC type | Back alignment and domain information |
|---|
| >TIGR02051 MerR Hg(II)-responsive transcriptional regulator | Back alignment and domain information |
|---|
| >PF10078 DUF2316: Uncharacterized protein conserved in bacteria (DUF2316); InterPro: IPR018757 Members of this family of hypothetical bacterial proteins have no known function | Back alignment and domain information |
|---|
| >PRK13413 mpi multiple promoter invertase; Provisional | Back alignment and domain information |
|---|
| >PRK11753 DNA-binding transcriptional dual regulator Crp; Provisional | Back alignment and domain information |
|---|
| >PF07453 NUMOD1: NUMOD1 domain; InterPro: IPR010896 This helix-turn-helix-containing DNA-binding domain is found associated in homing nucleases [] | Back alignment and domain information |
|---|
| >PRK05932 RNA polymerase factor sigma-54; Reviewed | Back alignment and domain information |
|---|
| >smart00345 HTH_GNTR helix_turn_helix gluconate operon transcriptional repressor | Back alignment and domain information |
|---|
| >PRK09954 putative kinase; Provisional | Back alignment and domain information |
|---|
| >PF06322 Phage_NinH: Phage NinH protein; InterPro: IPR010454 This entry is represented by Bacteriophage 933W, NinH | Back alignment and domain information |
|---|
| >COG2512 Predicted membrane-associated trancriptional regulator [Transcription] | Back alignment and domain information |
|---|
| >PF04297 UPF0122: Putative helix-turn-helix protein, YlxM / p13 like; InterPro: IPR007394 Members of this family are predicted to contain a helix-turn-helix motif, for example residues 37-55 in Mycoplasma mycoides p13 (O05290 from SWISSPROT) | Back alignment and domain information |
|---|
| >COG3413 Predicted DNA binding protein [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR02392 rpoH_proteo alternative sigma factor RpoH | Back alignment and domain information |
|---|
| >PRK05572 sporulation sigma factor SigF; Validated | Back alignment and domain information |
|---|
| >PF01325 Fe_dep_repress: Iron dependent repressor, N-terminal DNA binding domain; InterPro: IPR022687 The DtxR-type HTH domain is a DNA-binding, winged helix-turn-helix (wHTH) domain of about 65 residues present in metalloregulators of the DtxR/MntR family | Back alignment and domain information |
|---|
| >PF08280 HTH_Mga: M protein trans-acting positive regulator (MGA) HTH domain; InterPro: IPR013199 Mga is a DNA-binding protein that activates the expression of several important virulence genes in group A streptococcus in response to changing environmental conditions [] | Back alignment and domain information |
|---|
| >smart00342 HTH_ARAC helix_turn_helix, arabinose operon control protein | Back alignment and domain information |
|---|
| >TIGR03209 P21_Cbot clostridium toxin-associated regulator BotR | Back alignment and domain information |
|---|
| >cd04790 HTH_Cfa-like_unk Helix-Turn-Helix DNA binding domain of putative Cfa-like transcription regulators | Back alignment and domain information |
|---|
| >PF04703 FaeA: FaeA-like protein; PDB: 2JT1_A 2HTJ_A | Back alignment and domain information |
|---|
| >COG1974 LexA SOS-response transcriptional repressors (RecA-mediated autopeptidases) [Transcription / Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK11608 pspF phage shock protein operon transcriptional activator; Provisional | Back alignment and domain information |
|---|
| >TIGR02985 Sig70_bacteroi1 RNA polymerase sigma-70 factor, Bacteroides expansion family 1 | Back alignment and domain information |
|---|
| >PRK09480 slmA division inhibitor protein; Provisional | Back alignment and domain information |
|---|
| >PRK11161 fumarate/nitrate reduction transcriptional regulator; Provisional | Back alignment and domain information |
|---|
| >TIGR02394 rpoS_proteo RNA polymerase sigma factor RpoS | Back alignment and domain information |
|---|
| >TIGR02937 sigma70-ECF RNA polymerase sigma factor, sigma-70 family | Back alignment and domain information |
|---|
| >PRK13509 transcriptional repressor UlaR; Provisional | Back alignment and domain information |
|---|
| >TIGR02702 SufR_cyano iron-sulfur cluster biosynthesis transcriptional regulator SufR | Back alignment and domain information |
|---|
| >PRK06759 RNA polymerase factor sigma-70; Validated | Back alignment and domain information |
|---|
| >PRK08215 sporulation sigma factor SigG; Reviewed | Back alignment and domain information |
|---|
| >PF07471 Phage_Nu1: Phage DNA packaging protein Nu1; InterPro: IPR010906 This entry is represented by the Bacteriophage lambda, Nu1, terminase small subunit | Back alignment and domain information |
|---|
| >PRK09391 fixK transcriptional regulator FixK; Provisional | Back alignment and domain information |
|---|
| >PRK06596 RNA polymerase factor sigma-32; Reviewed | Back alignment and domain information |
|---|
| >PF01710 HTH_Tnp_IS630: Transposase; InterPro: IPR002622 Transposase proteins are necessary for efficient DNA transposition | Back alignment and domain information |
|---|
| >PRK11924 RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >PRK00215 LexA repressor; Validated | Back alignment and domain information |
|---|
| >PRK10411 DNA-binding transcriptional activator FucR; Provisional | Back alignment and domain information |
|---|
| >PRK15320 transcriptional activator SprB; Provisional | Back alignment and domain information |
|---|
| >TIGR02974 phageshock_pspF psp operon transcriptional activator PspF | Back alignment and domain information |
|---|
| >TIGR02337 HpaR homoprotocatechuate degradation operon regulator, HpaR | Back alignment and domain information |
|---|
| >PRK12427 flagellar biosynthesis sigma factor; Provisional | Back alignment and domain information |
|---|
| >TIGR02999 Sig-70_X6 RNA polymerase sigma factor, TIGR02999 family | Back alignment and domain information |
|---|
| >PRK12519 RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >COG2973 TrpR Trp operon repressor [Transcription] | Back alignment and domain information |
|---|
| >TIGR02980 SigBFG RNA polymerase sigma-70 factor, sigma-B/F/G subfamily | Back alignment and domain information |
|---|
| >PRK15411 rcsA colanic acid capsular biosynthesis activation protein A; Provisional | Back alignment and domain information |
|---|
| >PRK07037 extracytoplasmic-function sigma-70 factor; Validated | Back alignment and domain information |
|---|
| >PHA01082 putative transcription regulator | Back alignment and domain information |
|---|
| >PRK11361 acetoacetate metabolism regulatory protein AtoC; Provisional | Back alignment and domain information |
|---|
| >smart00418 HTH_ARSR helix_turn_helix, Arsenical Resistance Operon Repressor | Back alignment and domain information |
|---|
| >PRK09652 RNA polymerase sigma factor RpoE; Provisional | Back alignment and domain information |
|---|
| >PF06892 Phage_CP76: Phage regulatory protein CII (CP76); InterPro: IPR009679 This entry is represented by Bacteriophage 186, CII | Back alignment and domain information |
|---|
| >PF09012 FeoC: FeoC like transcriptional regulator; InterPro: IPR015102 This entry contains several transcriptional regulators, including FeoC, which contain a HTH motif | Back alignment and domain information |
|---|
| >TIGR01818 ntrC nitrogen regulation protein NR(I) | Back alignment and domain information |
|---|
| >TIGR02947 SigH_actino RNA polymerase sigma-70 factor, TIGR02947 family | Back alignment and domain information |
|---|
| >TIGR02850 spore_sigG RNA polymerase sigma-G factor | Back alignment and domain information |
|---|
| >PRK13869 plasmid-partitioning protein RepA; Provisional | Back alignment and domain information |
|---|
| >PRK11511 DNA-binding transcriptional activator MarA; Provisional | Back alignment and domain information |
|---|
| >TIGR02393 RpoD_Cterm RNA polymerase sigma factor RpoD, C-terminal domain | Back alignment and domain information |
|---|
| >TIGR03453 partition_RepA plasmid partitioning protein RepA | Back alignment and domain information |
|---|
| >PRK09639 RNA polymerase sigma factor SigX; Provisional | Back alignment and domain information |
|---|
| >PRK09047 RNA polymerase factor sigma-70; Validated | Back alignment and domain information |
|---|
| >PRK15090 DNA-binding transcriptional regulator KdgR; Provisional | Back alignment and domain information |
|---|
| >COG1309 AcrR Transcriptional regulator [Transcription] | Back alignment and domain information |
|---|
| >PRK15115 response regulator GlrR; Provisional | Back alignment and domain information |
|---|
| >PRK14165 winged helix-turn-helix domain-containing protein/riboflavin kinase; Provisional | Back alignment and domain information |
|---|
| >COG5484 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >smart00347 HTH_MARR helix_turn_helix multiple antibiotic resistance protein | Back alignment and domain information |
|---|
| >PRK08583 RNA polymerase sigma factor SigB; Validated | Back alignment and domain information |
|---|
| >PRK10365 transcriptional regulatory protein ZraR; Provisional | Back alignment and domain information |
|---|
| >PF01710 HTH_Tnp_IS630: Transposase; InterPro: IPR002622 Transposase proteins are necessary for efficient DNA transposition | Back alignment and domain information |
|---|
| >TIGR02989 Sig-70_gvs1 RNA polymerase sigma-70 factor, Rhodopirellula/Verrucomicrobium family | Back alignment and domain information |
|---|
| >PRK08301 sporulation sigma factor SigE; Reviewed | Back alignment and domain information |
|---|
| >PRK10219 DNA-binding transcriptional regulator SoxS; Provisional | Back alignment and domain information |
|---|
| >PRK15201 fimbriae regulatory protein FimW; Provisional | Back alignment and domain information |
|---|
| >PRK10046 dpiA two-component response regulator DpiA; Provisional | Back alignment and domain information |
|---|
| >TIGR02329 propionate_PrpR propionate catabolism operon regulatory protein PrpR | Back alignment and domain information |
|---|
| >PRK13919 putative RNA polymerase sigma E protein; Provisional | Back alignment and domain information |
|---|
| >PRK09642 RNA polymerase sigma factor SigW; Reviewed | Back alignment and domain information |
|---|
| >PRK07408 RNA polymerase sigma factor SigF; Reviewed | Back alignment and domain information |
|---|
| >TIGR03613 RutR pyrimidine utilization regulatory protein R | Back alignment and domain information |
|---|
| >PRK12529 RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >PRK06986 fliA flagellar biosynthesis sigma factor; Validated | Back alignment and domain information |
|---|
| >PRK12537 RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >COG1508 RpoN DNA-directed RNA polymerase specialized sigma subunit, sigma54 homolog [Transcription] | Back alignment and domain information |
|---|
| >cd07377 WHTH_GntR Winged helix-turn-helix (WHTH) DNA-binding domain of the GntR family of transcriptional regulators | Back alignment and domain information |
|---|
| >PF11268 DUF3071: Protein of unknown function (DUF3071); InterPro: IPR021421 Some members in this family of proteins are annotated as DNA-binding proteins however this cannot be confirmed | Back alignment and domain information |
|---|
| >PF07750 GcrA: GcrA cell cycle regulator; InterPro: IPR011681 GcrA, together with CtrA (see IPR001789 from INTERPRO and IPR001867 from INTERPRO), form a master cell cycle regulator | Back alignment and domain information |
|---|
| >COG2197 CitB Response regulator containing a CheY-like receiver domain and an HTH DNA-binding domain [Signal transduction mechanisms / Transcription] | Back alignment and domain information |
|---|
| >PRK12423 LexA repressor; Provisional | Back alignment and domain information |
|---|
| >TIGR01884 cas_HTH CRISPR locus-related DNA-binding protein | Back alignment and domain information |
|---|
| >cd00090 HTH_ARSR Arsenical Resistance Operon Repressor and similar prokaryotic, metal regulated homodimeric repressors | Back alignment and domain information |
|---|
| >PRK13832 plasmid partitioning protein; Provisional | Back alignment and domain information |
|---|
| >PRK12534 RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >COG1595 RpoE DNA-directed RNA polymerase specialized sigma subunit, sigma24 homolog [Transcription] | Back alignment and domain information |
|---|
| >TIGR02366 DHAK_reg probable dihydroxyacetone kinase regulator | Back alignment and domain information |
|---|
| >cd08316 Death_FAS_TNFRSF6 Death domain of FAS or TNF receptor superfamily member 6 | Back alignment and domain information |
|---|
| >PRK12547 RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >PRK07122 RNA polymerase sigma factor SigF; Reviewed | Back alignment and domain information |
|---|
| >COG4565 CitB Response regulator of citrate/malate metabolism [Transcription / Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK09649 RNA polymerase sigma factor SigC; Reviewed | Back alignment and domain information |
|---|
| >PRK09645 RNA polymerase sigma factor SigL; Provisional | Back alignment and domain information |
|---|
| >PRK07500 rpoH2 RNA polymerase factor sigma-32; Reviewed | Back alignment and domain information |
|---|
| >TIGR02959 SigZ RNA polymerase sigma factor, SigZ family | Back alignment and domain information |
|---|
| >PF13463 HTH_27: Winged helix DNA-binding domain; PDB: 3GFL_A 2YR2_B 3GFM_A 3GFJ_A 3GF2_A 3GEZ_A 2GXG_A 3GFI_A 2EB7_A | Back alignment and domain information |
|---|
| >COG3355 Predicted transcriptional regulator [Transcription] | Back alignment and domain information |
|---|
| >TIGR01889 Staph_reg_Sar staphylococcal accessory regulator family | Back alignment and domain information |
|---|
| >TIGR02915 PEP_resp_reg putative PEP-CTERM system response regulator | Back alignment and domain information |
|---|
| >PRK12523 RNA polymerase sigma factor; Reviewed | Back alignment and domain information |
|---|
| >PRK11302 DNA-binding transcriptional regulator HexR; Provisional | Back alignment and domain information |
|---|
| >PRK10923 glnG nitrogen regulation protein NR(I); Provisional | Back alignment and domain information |
|---|
| >PRK15008 HTH-type transcriptional regulator RutR; Provisional | Back alignment and domain information |
|---|
| >PRK09975 DNA-binding transcriptional regulator EnvR; Provisional | Back alignment and domain information |
|---|
| >COG1654 BirA Biotin operon repressor [Transcription] | Back alignment and domain information |
|---|
| >PRK03573 transcriptional regulator SlyA; Provisional | Back alignment and domain information |
|---|
| >PRK12511 RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >PRK10402 DNA-binding transcriptional activator YeiL; Provisional | Back alignment and domain information |
|---|
| >smart00342 HTH_ARAC helix_turn_helix, arabinose operon control protein | Back alignment and domain information |
|---|
| >cd04778 HTH_MerR-like_sg2 Helix-Turn-Helix DNA binding domain of putative transcription regulators from the MerR superfamily | Back alignment and domain information |
|---|
| >PRK12530 RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >PRK13719 conjugal transfer transcriptional regulator TraJ; Provisional | Back alignment and domain information |
|---|
| >TIGR00637 ModE_repress ModE molybdate transport repressor domain | Back alignment and domain information |
|---|
| >PRK12532 RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >PRK05803 sporulation sigma factor SigK; Reviewed | Back alignment and domain information |
|---|
| >COG2771 CsgD DNA-binding HTH domain-containing proteins [Transcription] | Back alignment and domain information |
|---|
| >PRK10141 DNA-binding transcriptional repressor ArsR; Provisional | Back alignment and domain information |
|---|
| >PRK13777 transcriptional regulator Hpr; Provisional | Back alignment and domain information |
|---|
| >TIGR02479 FliA_WhiG RNA polymerase sigma factor, FliA/WhiG family | Back alignment and domain information |
|---|
| >PRK12513 RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >PRK10668 DNA-binding transcriptional repressor AcrR; Provisional | Back alignment and domain information |
|---|
| >PRK11050 manganese transport regulator MntR; Provisional | Back alignment and domain information |
|---|
| >PRK12524 RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >PRK15424 propionate catabolism operon regulatory protein PrpR; Provisional | Back alignment and domain information |
|---|
| >TIGR02846 spore_sigmaK RNA polymerase sigma-K factor | Back alignment and domain information |
|---|
| >TIGR02954 Sig70_famx3 RNA polymerase sigma-70 factor, TIGR02954 family | Back alignment and domain information |
|---|
| >PRK11475 DNA-binding transcriptional activator BglJ; Provisional | Back alignment and domain information |
|---|
| >PRK12516 RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >PRK09647 RNA polymerase sigma factor SigE; Reviewed | Back alignment and domain information |
|---|
| >PF09862 DUF2089: Protein of unknown function (DUF2089); InterPro: IPR018658 This family consists of various hypothetical prokaryotic proteins | Back alignment and domain information |
|---|
| >PRK10430 DNA-binding transcriptional activator DcuR; Provisional | Back alignment and domain information |
|---|
| >COG1349 GlpR Transcriptional regulators of sugar metabolism [Transcription / Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR03384 betaine_BetI transcriptional repressor BetI | Back alignment and domain information |
|---|
| >TIGR02983 SigE-fam_strep RNA polymerase sigma-70 factor, sigma-E family | Back alignment and domain information |
|---|
| >KOG1168 consensus Transcription factor ACJ6/BRN-3, contains POU and HOX domains [Transcription] | Back alignment and domain information |
|---|
| >PF04760 IF2_N: Translation initiation factor IF-2, N-terminal region; InterPro: IPR006847 This region is found in the N-terminal half of translation initiation factor IF-2 | Back alignment and domain information |
|---|
| >TIGR02950 SigM_subfam RNA polymerase sigma factor, SigM family | Back alignment and domain information |
|---|
| >PRK05911 RNA polymerase sigma factor sigma-28; Reviewed | Back alignment and domain information |
|---|
| >TIGR02941 Sigma_B RNA polymerase sigma-B factor | Back alignment and domain information |
|---|
| >PRK09641 RNA polymerase sigma factor SigW; Provisional | Back alignment and domain information |
|---|
| >PF08822 DUF1804: Protein of unknown function (DUF1804); InterPro: IPR014926 This entry is represented by Bacteriophage D3112, Orf24 | Back alignment and domain information |
|---|
| >PRK09508 leuO leucine transcriptional activator; Reviewed | Back alignment and domain information |
|---|
| >TIGR02952 Sig70_famx2 RNA polymerase sigma-70 factor, TIGR02952 family | Back alignment and domain information |
|---|
| >TIGR02997 Sig70-cyanoRpoD RNA polymerase sigma factor, cyanobacterial RpoD-like family | Back alignment and domain information |
|---|
| >PRK05602 RNA polymerase sigma factor; Reviewed | Back alignment and domain information |
|---|
| >PRK10434 srlR DNA-bindng transcriptional repressor SrlR; Provisional | Back alignment and domain information |
|---|
| >PRK12514 RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >PF05043 Mga: Mga helix-turn-helix domain; InterPro: IPR007737 Mga is a DNA-binding protein that activates the expression of several important virulence genes in group A streptococcus in response to changing environmental conditions [] | Back alignment and domain information |
|---|
| >PRK06930 positive control sigma-like factor; Validated | Back alignment and domain information |
|---|
| >TIGR02835 spore_sigmaE RNA polymerase sigma-E factor | Back alignment and domain information |
|---|
| >PRK12528 RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >PRK09392 ftrB transcriptional activator FtrB; Provisional | Back alignment and domain information |
|---|
| >PRK12536 RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >PRK12682 transcriptional regulator CysB-like protein; Reviewed | Back alignment and domain information |
|---|
| >PRK12525 RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >PRK10906 DNA-binding transcriptional repressor GlpR; Provisional | Back alignment and domain information |
|---|
| >PRK05022 anaerobic nitric oxide reductase transcription regulator; Provisional | Back alignment and domain information |
|---|
| >TIGR02984 Sig-70_plancto1 RNA polymerase sigma-70 factor, Planctomycetaceae-specific subfamily 1 | Back alignment and domain information |
|---|
| >PRK09483 response regulator; Provisional | Back alignment and domain information |
|---|
| >PRK12542 RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >PRK10681 DNA-binding transcriptional repressor DeoR; Provisional | Back alignment and domain information |
|---|
| >PRK11202 DNA-binding transcriptional repressor FabR; Provisional | Back alignment and domain information |
|---|
| >PRK09640 RNA polymerase sigma factor SigX; Reviewed | Back alignment and domain information |
|---|
| >PRK12527 RNA polymerase sigma factor; Reviewed | Back alignment and domain information |
|---|
| >TIGR02431 pcaR_pcaU beta-ketoadipate pathway transcriptional regulators, PcaR/PcaU/PobR family | Back alignment and domain information |
|---|
| >COG2963 Transposase and inactivated derivatives [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK11923 algU RNA polymerase sigma factor AlgU; Provisional | Back alignment and domain information |
|---|
| >PF05732 RepL: Firmicute plasmid replication protein (RepL); InterPro: IPR008813 This entry consists of proteins thought to be involved in plasmid replication | Back alignment and domain information |
|---|
| >PRK12526 RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >PRK12545 RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >PRK10100 DNA-binding transcriptional regulator CsgD; Provisional | Back alignment and domain information |
|---|
| >PRK14996 TetR family transcriptional regulator; Provisional | Back alignment and domain information |
|---|
| >COG2826 Tra8 Transposase and inactivated derivatives, IS30 family [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK10188 DNA-binding transcriptional activator SdiA; Provisional | Back alignment and domain information |
|---|
| >PRK12518 RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >PRK09834 DNA-binding transcriptional activator MhpR; Provisional | Back alignment and domain information |
|---|
| >PHA02535 P terminase ATPase subunit; Provisional | Back alignment and domain information |
|---|
| >PRK00767 transcriptional regulator BetI; Validated | Back alignment and domain information |
|---|
| >TIGR02948 SigW_bacill RNA polymerase sigma-W factor | Back alignment and domain information |
|---|
| >PF06971 Put_DNA-bind_N: Putative DNA-binding protein N-terminus; InterPro: IPR009718 This entry represents the C terminus (approximately 30 residues) of a number of Rex proteins | Back alignment and domain information |
|---|
| >PRK09648 RNA polymerase sigma factor SigD; Reviewed | Back alignment and domain information |
|---|
| >PRK09802 DNA-binding transcriptional regulator AgaR; Provisional | Back alignment and domain information |
|---|
| >PHA00738 putative HTH transcription regulator | Back alignment and domain information |
|---|
| >PRK12533 RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >TIGR03826 YvyF flagellar operon protein TIGR03826 | Back alignment and domain information |
|---|
| >PRK11557 putative DNA-binding transcriptional regulator; Provisional | Back alignment and domain information |
|---|
| >PRK14845 translation initiation factor IF-2; Provisional | Back alignment and domain information |
|---|
| >PF01726 LexA_DNA_bind: LexA DNA binding domain; InterPro: IPR006199 This is the DNA binding domain of the LexA SOS regulon repressor which prevents expression of DNA repair proteins in bacteria | Back alignment and domain information |
|---|
| >PRK06288 RNA polymerase sigma factor WhiG; Reviewed | Back alignment and domain information |
|---|
| >PRK12515 RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >PRK09638 RNA polymerase sigma factor SigY; Reviewed | Back alignment and domain information |
|---|
| >cd08804 Death_ank2 Death domain of Ankyrin-2 | Back alignment and domain information |
|---|
| >PRK12517 RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >PF12116 SpoIIID: Stage III sporulation protein D; InterPro: IPR014208 Members of this entry represent the transcriptional regulator SpoIIID, or stage III sporulation protein D | Back alignment and domain information |
|---|
| >PRK04424 fatty acid biosynthesis transcriptional regulator; Provisional | Back alignment and domain information |
|---|
| >PRK09646 RNA polymerase sigma factor SigK; Reviewed | Back alignment and domain information |
|---|
| >PRK11388 DNA-binding transcriptional regulator DhaR; Provisional | Back alignment and domain information |
|---|
| >PRK09637 RNA polymerase sigma factor SigZ; Provisional | Back alignment and domain information |
|---|
| >cd06571 Bac_DnaA_C C-terminal domain of bacterial DnaA proteins | Back alignment and domain information |
|---|
| >PRK12546 RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >PRK12522 RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >PRK12520 RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >PRK15482 transcriptional regulator MurR; Provisional | Back alignment and domain information |
|---|
| >PRK06811 RNA polymerase factor sigma-70; Validated | Back alignment and domain information |
|---|
| >PRK07921 RNA polymerase sigma factor SigB; Reviewed | Back alignment and domain information |
|---|
| >TIGR01565 homeo_ZF_HD homeobox domain, ZF-HD class | Back alignment and domain information |
|---|
| >PRK09210 RNA polymerase sigma factor RpoD; Validated | Back alignment and domain information |
|---|
| >PRK12540 RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >PF00046 Homeobox: Homeobox domain not present here | Back alignment and domain information |
|---|
| >PRK12541 RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >PRK11337 DNA-binding transcriptional repressor RpiR; Provisional | Back alignment and domain information |
|---|
| >TIGR03454 partition_RepB plasmid partitioning protein RepB | Back alignment and domain information |
|---|
| >PRK11569 transcriptional repressor IclR; Provisional | Back alignment and domain information |
|---|
| >PRK08295 RNA polymerase factor sigma-70; Validated | Back alignment and domain information |
|---|
| >PRK05657 RNA polymerase sigma factor RpoS; Validated | Back alignment and domain information |
|---|
| >TIGR02939 RpoE_Sigma70 RNA polymerase sigma factor RpoE | Back alignment and domain information |
|---|
| >COG1737 RpiR Transcriptional regulators [Transcription] | Back alignment and domain information |
|---|
| >PRK10086 DNA-binding transcriptional regulator DsdC; Provisional | Back alignment and domain information |
|---|
| >PRK10163 DNA-binding transcriptional repressor AllR; Provisional | Back alignment and domain information |
|---|
| >PRK03601 transcriptional regulator HdfR; Provisional | Back alignment and domain information |
|---|
| >PRK12543 RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >COG1321 TroR Mn-dependent transcriptional regulator [Transcription] | Back alignment and domain information |
|---|
| >PRK09415 RNA polymerase factor sigma C; Reviewed | Back alignment and domain information |
|---|
| >PRK10870 transcriptional repressor MprA; Provisional | Back alignment and domain information |
|---|
| >PRK07405 RNA polymerase sigma factor SigD; Validated | Back alignment and domain information |
|---|
| >PRK07670 RNA polymerase sigma factor SigD; Validated | Back alignment and domain information |
|---|
| >PF14174 YycC: YycC-like protein | Back alignment and domain information |
|---|
| >COG2207 AraC AraC-type DNA-binding domain-containing proteins [Transcription] | Back alignment and domain information |
|---|
| >PRK09644 RNA polymerase sigma factor SigM; Provisional | Back alignment and domain information |
|---|
| >PRK12531 RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >PRK06704 RNA polymerase factor sigma-70; Validated | Back alignment and domain information |
|---|
| >PRK10820 DNA-binding transcriptional regulator TyrR; Provisional | Back alignment and domain information |
|---|
| >PF10743 Phage_Cox: Regulatory phage protein cox; InterPro: IPR019679 Phage Cox proteins are expressed by Enterobacteria phages | Back alignment and domain information |
|---|
| >PF02082 Rrf2: Transcriptional regulator; InterPro: IPR000944 The following uncharacterised bacterial proteins have been shown to be evolutionary related, Desulfovibrio vulgaris protein Rrf2; Escherichia coli hypothetical proteins yfhP and yjeB; Bacillus subtilis hypothetical proteins yhdE, yrzC and ywgB; Mycobacterium tuberculosis hypothetical protein Rv1287; and Synechocystis sp | Back alignment and domain information |
|---|
| >TIGR02943 Sig70_famx1 RNA polymerase sigma-70 factor, TIGR02943 family | Back alignment and domain information |
|---|
| >PRK09651 RNA polymerase sigma factor FecI; Provisional | Back alignment and domain information |
|---|
| >PRK12539 RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >PRK12512 RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >PRK05901 RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >PRK09643 RNA polymerase sigma factor SigM; Reviewed | Back alignment and domain information |
|---|
| >PRK13756 tetracycline repressor protein TetR; Provisional | Back alignment and domain information |
|---|
| >PRK11922 RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >PRK12538 RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >PRK11886 bifunctional biotin--[acetyl-CoA-carboxylase] synthetase/biotin operon repressor; Provisional | Back alignment and domain information |
|---|
| >PRK10216 DNA-binding transcriptional regulator YidZ; Provisional | Back alignment and domain information |
|---|
| >PRK12535 RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >PRK15369 two component system sensor kinase SsrB; Provisional | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 82 | ||||
| 1x57_A | 91 | Solution Structures Of The Hth Domain Of Human Edf- | 7e-13 | ||
| 2jvl_A | 107 | Nmr Structure Of The C-Terminal Domain Of Mbf1 Of T | 6e-06 |
| >pdb|1X57|A Chain A, Solution Structures Of The Hth Domain Of Human Edf-1 Protein Length = 91 | Back alignment and structure |
|
| >pdb|2JVL|A Chain A, Nmr Structure Of The C-Terminal Domain Of Mbf1 Of Trichoderm Length = 107 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 82 | |||
| 1x57_A | 91 | Endothelial differentiation-related factor 1; HMBF | 4e-16 | |
| 2jvl_A | 107 | TRMBF1; coactivator, helix-turn-helix, Pro binding | 2e-15 | |
| 1adr_A | 76 | P22 C2 repressor; transcription regulation; NMR {E | 1e-08 | |
| 2r1j_L | 68 | Repressor protein C2; protein-DNA complex, helix-t | 2e-08 | |
| 2kpj_A | 94 | SOS-response transcriptional repressor, LEXA; NESG | 7e-08 | |
| 3omt_A | 73 | Uncharacterized protein; structural genomics, PSI- | 2e-07 | |
| 2p5t_A | 158 | Putative transcriptional regulator PEZA; postsegre | 3e-07 | |
| 3bs3_A | 76 | Putative DNA-binding protein; XRE-family, structur | 4e-07 | |
| 2wiu_B | 88 | HTH-type transcriptional regulator HIPB; transfera | 7e-07 | |
| 3op9_A | 114 | PLI0006 protein; structural genomics, PSI-2, prote | 8e-07 | |
| 1r69_A | 69 | Repressor protein CI; gene regulating protein; 2.0 | 2e-06 | |
| 3kxa_A | 141 | NGO0477 protein, putative uncharacterized protein; | 4e-06 | |
| 3ivp_A | 126 | Putative transposon-related DNA-binding protein; A | 5e-06 | |
| 2qfc_A | 293 | PLCR protein; TPR, HTH, transcription regulation; | 5e-06 | |
| 1zug_A | 71 | Phage 434 CRO protein; gene regulating protein, tr | 6e-06 | |
| 3o9x_A | 133 | Uncharacterized HTH-type transcriptional regulato; | 3e-05 | |
| 3mlf_A | 111 | Transcriptional regulator; structural genomics, he | 4e-05 | |
| 3lfp_A | 98 | CSP231I C protein; transcriptional regulator, DNA | 4e-05 | |
| 2bnm_A | 198 | Epoxidase; oxidoreductase, cupin, HTH, cation-depe | 5e-05 | |
| 3f6w_A | 83 | XRE-family like protein; helix-turn-helix, DNA bin | 5e-05 | |
| 1y7y_A | 74 | C.AHDI; helix-turn-helix, DNA-binding protein, tra | 6e-05 | |
| 3bdn_A | 236 | Lambda repressor; repressor, allostery; HET: DNA; | 7e-05 | |
| 2ef8_A | 84 | C.ECOT38IS, putative transcription factor; helix-t | 8e-05 | |
| 3f52_A | 117 | CLP gene regulator (CLGR); helix-turn-helix motif, | 3e-04 | |
| 2ppx_A | 99 | AGR_C_3184P, uncharacterized protein ATU1735; HTH- | 5e-04 | |
| 2b5a_A | 77 | C.BCLI; helix-turn-helix motif, gene regulation; 1 | 7e-04 | |
| 2ewt_A | 71 | BLDD, putative DNA-binding protein; the DNA-bindin | 7e-04 | |
| 3s8q_A | 82 | R-M controller protein; protein-DNA complex, helix | 7e-04 | |
| 3g5g_A | 99 | Regulatory protein; transcriptional regulator, hel | 8e-04 |
| >1x57_A Endothelial differentiation-related factor 1; HMBF1alpha, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.35.1.12 Length = 91 | Back alignment and structure |
|---|
Score = 65.6 bits (160), Expect = 4e-16
Identities = 29/59 (49%), Positives = 46/59 (77%)
Query: 19 PDTPRQIQRARLGKKMSQPDLANQINQRPQVVSEYENGKAVPNQTVLAKMEKAIGVKLR 77
+ + IQ+ R K ++Q DLA +IN++PQV+++YE+G+A+PN VL K+E+AIG+KLR
Sbjct: 12 LEVGKVIQQGRQSKGLTQKDLATKINEKPQVIADYESGRAIPNNQVLGKIERAIGLKLR 70
|
| >2jvl_A TRMBF1; coactivator, helix-turn-helix, Pro binding, transcription; NMR {Trichoderma reesei} Length = 107 | Back alignment and structure |
|---|
| >1adr_A P22 C2 repressor; transcription regulation; NMR {Enterobacteria phage P22} SCOP: a.35.1.2 Length = 76 | Back alignment and structure |
|---|
| >2r1j_L Repressor protein C2; protein-DNA complex, helix-turn-helix, DNA-binding, transcription, transcription regulation; 1.53A {Enterobacteria phage P22} SCOP: a.35.1.2 PDB: 3jxb_C 3jxc_L 3jxd_L Length = 68 | Back alignment and structure |
|---|
| >2kpj_A SOS-response transcriptional repressor, LEXA; NESG, GFT, structural genomics, PSI-2, protein structure initiative; NMR {Eubacterium rectale atcc 33656} Length = 94 | Back alignment and structure |
|---|
| >3omt_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; 1.65A {Cytophaga hutchinsonii} Length = 73 | Back alignment and structure |
|---|
| >2p5t_A Putative transcriptional regulator PEZA; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae} Length = 158 | Back alignment and structure |
|---|
| >3bs3_A Putative DNA-binding protein; XRE-family, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.65A {Bacteroides fragilis} Length = 76 | Back alignment and structure |
|---|
| >2wiu_B HTH-type transcriptional regulator HIPB; transferase transcription complex, serine kinase, DNA-bindin mercury derivative, repressor; 2.35A {Escherichia coli} PDB: 3dnv_B* 3dnw_B* 3hzi_B* Length = 88 | Back alignment and structure |
|---|
| >3op9_A PLI0006 protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG, transcription regulat; HET: MSE; 1.90A {Listeria innocua} Length = 114 | Back alignment and structure |
|---|
| >1r69_A Repressor protein CI; gene regulating protein; 2.00A {Phage 434} SCOP: a.35.1.2 PDB: 1pra_A 1per_L 1rpe_L* 2or1_L* 1r63_A 2r63_A 1sq8_A Length = 69 | Back alignment and structure |
|---|
| >3kxa_A NGO0477 protein, putative uncharacterized protein; NEW protein fold, OPPF, STRU genomics, oxford protein production facility; 2.80A {Neisseria gonorrhoeae} Length = 141 | Back alignment and structure |
|---|
| >3ivp_A Putative transposon-related DNA-binding protein; APC62618, clostridium diffic structural genomics, PSI-2, protein structure initiative; HET: PG4; 2.02A {Clostridium difficile} Length = 126 | Back alignment and structure |
|---|
| >2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Length = 293 | Back alignment and structure |
|---|
| >1zug_A Phage 434 CRO protein; gene regulating protein, transcription regulation; NMR {Phage 434} SCOP: a.35.1.2 PDB: 2cro_A 3cro_L* Length = 71 | Back alignment and structure |
|---|
| >3o9x_A Uncharacterized HTH-type transcriptional regulato; HTH-XRE DNA binding motif, transcriptional regulator, bacter antitoxin, Zn binding protein, transcription regulator-DNA; HET: DNA; 2.10A {Escherichia coli} PDB: 3gn5_A* 3gn5_B* 2kz8_A Length = 133 | Back alignment and structure |
|---|
| >3mlf_A Transcriptional regulator; structural genomics, helix-turn-helix XRE-family like protei transcription regulator, PSI-2; 2.60A {Staphylococcus aureus subsp} Length = 111 | Back alignment and structure |
|---|
| >3lfp_A CSP231I C protein; transcriptional regulator, DNA binding protein, helix-turn-H restriction-modification, transcription; 2.00A {Citrobacter SP} PDB: 3lis_A Length = 98 | Back alignment and structure |
|---|
| >2bnm_A Epoxidase; oxidoreductase, cupin, HTH, cation-dependant, zinc, fosfomycin; 1.7A {Streptomyces wedmorensis} SCOP: a.35.1.3 b.82.1.10 PDB: 1zz7_A 1zz8_A 1zz9_A 1zzb_A 1zz6_A 1zzc_A 2bnn_A 2bno_A 3scf_A 3scg_A 3sch_A Length = 198 | Back alignment and structure |
|---|
| >3f6w_A XRE-family like protein; helix-turn-helix, DNA binding protein, xenobiotic response E family of transcriptional regulators; HET: MSE BTB; 1.85A {Pseudomonas syringae PV} Length = 83 | Back alignment and structure |
|---|
| >1y7y_A C.AHDI; helix-turn-helix, DNA-binding protein, transcriptional regulator, transcription regulator; 1.69A {Aeromonas hydrophila} SCOP: a.35.1.3 Length = 74 | Back alignment and structure |
|---|
| >3bdn_A Lambda repressor; repressor, allostery; HET: DNA; 3.91A {Enterobacteria phage lambda} Length = 236 | Back alignment and structure |
|---|
| >2ef8_A C.ECOT38IS, putative transcription factor; helix-turn-helix, DNA binding protein, transcription regulator; HET: CME; 1.95A {Enterobacteria phage P2} Length = 84 | Back alignment and structure |
|---|
| >3f52_A CLP gene regulator (CLGR); helix-turn-helix motif, transcriptional ACTI human pathogen, transcription activator; 1.75A {Corynebacterium glutamicum} PDB: 3f51_A Length = 117 | Back alignment and structure |
|---|
| >2ppx_A AGR_C_3184P, uncharacterized protein ATU1735; HTH-motif, XRE-family, structural genomics, PSI-2, protein structure initiative; 2.00A {Agrobacterium tumefaciens str} SCOP: a.35.1.3 Length = 99 | Back alignment and structure |
|---|
| >2b5a_A C.BCLI; helix-turn-helix motif, gene regulation; 1.54A {Bacillus caldolyticus} SCOP: a.35.1.3 Length = 77 | Back alignment and structure |
|---|
| >2ewt_A BLDD, putative DNA-binding protein; the DNA-binding domain of BLDD; 1.81A {Streptomyces coelicolor} Length = 71 | Back alignment and structure |
|---|
| >3s8q_A R-M controller protein; protein-DNA complex, helix-turn-helix; HET: DNA; 2.10A {Enterobacter SP} PDB: 3clc_A* Length = 82 | Back alignment and structure |
|---|
| >3g5g_A Regulatory protein; transcriptional regulator, helix-turn-helix, restriction- modification, transcription regulator; 2.80A {Enterobacter SP} PDB: 3fya_A Length = 99 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 82 | |||
| 2jvl_A | 107 | TRMBF1; coactivator, helix-turn-helix, Pro binding | 99.75 | |
| 2ewt_A | 71 | BLDD, putative DNA-binding protein; the DNA-bindin | 99.75 | |
| 3qq6_A | 78 | HTH-type transcriptional regulator SINR; helix-tur | 99.73 | |
| 3s8q_A | 82 | R-M controller protein; protein-DNA complex, helix | 99.73 | |
| 3omt_A | 73 | Uncharacterized protein; structural genomics, PSI- | 99.73 | |
| 3kz3_A | 80 | Repressor protein CI; five helix bundle, DNA-bindi | 99.73 | |
| 3g5g_A | 99 | Regulatory protein; transcriptional regulator, hel | 99.73 | |
| 1y7y_A | 74 | C.AHDI; helix-turn-helix, DNA-binding protein, tra | 99.73 | |
| 3t76_A | 88 | VANU, transcriptional regulator vanug; structural | 99.73 | |
| 3f6w_A | 83 | XRE-family like protein; helix-turn-helix, DNA bin | 99.72 | |
| 3lfp_A | 98 | CSP231I C protein; transcriptional regulator, DNA | 99.71 | |
| 2r1j_L | 68 | Repressor protein C2; protein-DNA complex, helix-t | 99.71 | |
| 2k9q_A | 77 | Uncharacterized protein; all helix, helix-turn-hel | 99.71 | |
| 3b7h_A | 78 | Prophage LP1 protein 11; structural genomics, PSI2 | 99.71 | |
| 2b5a_A | 77 | C.BCLI; helix-turn-helix motif, gene regulation; 1 | 99.71 | |
| 3op9_A | 114 | PLI0006 protein; structural genomics, PSI-2, prote | 99.7 | |
| 3ivp_A | 126 | Putative transposon-related DNA-binding protein; A | 99.7 | |
| 1x57_A | 91 | Endothelial differentiation-related factor 1; HMBF | 99.7 | |
| 1adr_A | 76 | P22 C2 repressor; transcription regulation; NMR {E | 99.7 | |
| 2kpj_A | 94 | SOS-response transcriptional repressor, LEXA; NESG | 99.7 | |
| 3vk0_A | 114 | NHTF, transcriptional regulator; HTH motif, XRE tr | 99.69 | |
| 3eus_A | 86 | DNA-binding protein; structural genomics, PSI2,MCS | 99.69 | |
| 3trb_A | 104 | Virulence-associated protein I; mobIle and extrach | 99.69 | |
| 2xi8_A | 66 | Putative transcription regulator; HTH DNA-binding | 99.69 | |
| 3bs3_A | 76 | Putative DNA-binding protein; XRE-family, structur | 99.69 | |
| 3mlf_A | 111 | Transcriptional regulator; structural genomics, he | 99.69 | |
| 1lmb_3 | 92 | Protein (lambda repressor); protein-DNA complex, d | 99.68 | |
| 2wiu_B | 88 | HTH-type transcriptional regulator HIPB; transfera | 99.68 | |
| 3fmy_A | 73 | HTH-type transcriptional regulator MQSA (YGIT/B302 | 99.68 | |
| 3f52_A | 117 | CLP gene regulator (CLGR); helix-turn-helix motif, | 99.68 | |
| 2a6c_A | 83 | Helix-turn-helix motif; putative transcriptional r | 99.68 | |
| 1r69_A | 69 | Repressor protein CI; gene regulating protein; 2.0 | 99.67 | |
| 3cec_A | 104 | Putative antidote protein of plasmid maintenance; | 99.66 | |
| 1b0n_A | 111 | Protein (SINR protein); transcription regulator, a | 99.65 | |
| 4ghj_A | 101 | Probable transcriptional regulator; structural gen | 99.64 | |
| 2ict_A | 94 | Antitoxin HIGA; helix-turn-helix, structural genom | 99.64 | |
| 1zug_A | 71 | Phage 434 CRO protein; gene regulating protein, tr | 99.64 | |
| 3fym_A | 130 | Putative uncharacterized protein; HTH DNA binding, | 99.63 | |
| 2ef8_A | 84 | C.ECOT38IS, putative transcription factor; helix-t | 99.63 | |
| 2wus_R | 112 | RODZ, putative uncharacterized protein; structural | 99.63 | |
| 2l49_A | 99 | C protein; P2 bacteriophage, P2 C, direct repeats, | 99.63 | |
| 2o38_A | 120 | Hypothetical protein; alpha-beta, helix-turn-helix | 99.62 | |
| 2ppx_A | 99 | AGR_C_3184P, uncharacterized protein ATU1735; HTH- | 99.62 | |
| 2eby_A | 113 | Putative HTH-type transcriptional regulator YBAQ; | 99.61 | |
| 1y9q_A | 192 | Transcriptional regulator, HTH_3 family; transcrip | 99.61 | |
| 3kxa_A | 141 | NGO0477 protein, putative uncharacterized protein; | 99.61 | |
| 2bnm_A | 198 | Epoxidase; oxidoreductase, cupin, HTH, cation-depe | 99.59 | |
| 2ofy_A | 86 | Putative XRE-family transcriptional regulator; tra | 99.59 | |
| 3bd1_A | 79 | CRO protein; transcription factor, helix-turn-heli | 99.56 | |
| 3r1f_A | 135 | ESX-1 secretion-associated regulator ESPR; helix-t | 99.56 | |
| 3u3w_A | 293 | Transcriptional activator PLCR protein; ternary co | 99.54 | |
| 3qwg_A | 123 | ESX-1 secretion-associated regulator ESPR; N-termi | 99.54 | |
| 3pxp_A | 292 | Helix-turn-helix domain protein; DNA-binding, basi | 99.51 | |
| 3o9x_A | 133 | Uncharacterized HTH-type transcriptional regulato; | 99.48 | |
| 2awi_A | 317 | PRGX; repressor, pheromone, DNA binding, regulator | 99.47 | |
| 4ich_A | 311 | Transcriptional regulator; structural genomics, PS | 99.45 | |
| 1neq_A | 74 | DNA-binding protein NER; NMR {Enterobacteria phage | 99.45 | |
| 2p5t_A | 158 | Putative transcriptional regulator PEZA; postsegre | 99.42 | |
| 3bdn_A | 236 | Lambda repressor; repressor, allostery; HET: DNA; | 99.4 | |
| 2qfc_A | 293 | PLCR protein; TPR, HTH, transcription regulation; | 99.4 | |
| 2l1p_A | 83 | DNA-binding protein SATB1; PSI-biology, NESG, stru | 99.4 | |
| 2fjr_A | 189 | Repressor protein CI; genetic switch, regulation, | 99.28 | |
| 2auw_A | 170 | Hypothetical protein NE0471; alpha-beta structure, | 99.19 | |
| 1dw9_A | 156 | Cyanate lyase; cyanate degradation, structural gen | 99.02 | |
| 1nr3_A | 122 | MTH0916, DNA-binding protein TFX; northeast struct | 99.01 | |
| 1rzs_A | 61 | Antirepressor, regulatory protein CRO; helix-turn- | 98.92 | |
| 1uxc_A | 65 | FRUR (1-57), fructose repressor; DNA-binding prote | 98.82 | |
| 2l8n_A | 67 | Transcriptional repressor CYTR; bacterial gene rep | 98.74 | |
| 1zx4_A | 192 | P1 PARB, plasmid partition PAR B protein, PARB; tr | 98.68 | |
| 3g7d_A | 443 | PHPD; non heme Fe(II) dioxygenase, cupin, biosynth | 98.66 | |
| 1s4k_A | 120 | Putative cytoplasmic protein YDIL; structural geno | 98.64 | |
| 2h8r_A | 221 | Hepatocyte nuclear factor 1-beta; trasncription fa | 98.61 | |
| 2pij_A | 67 | Prophage PFL 6 CRO; transcription factor, helix-tu | 98.54 | |
| 1ic8_A | 194 | Hepatocyte nuclear factor 1-alpha; transcription r | 98.5 | |
| 2hin_A | 71 | GP39, repressor protein; transcription factor, dim | 98.3 | |
| 2l0k_A | 93 | Stage III sporulation protein D; SPOIIID, solution | 98.21 | |
| 2cw1_A | 65 | SN4M; lambda CRO fold, de novo protein; NMR {Synth | 98.08 | |
| 1zs4_A | 83 | Regulatory protein CII; helix-turn-helix, transcri | 97.96 | |
| 1jhf_A | 202 | LEXA repressor; LEXA SOS repressor, hydrolase; 1.8 | 97.96 | |
| 1xwr_A | 97 | Regulatory protein CII; all-alpha fold, DNA bindin | 97.94 | |
| 2ao9_A | 155 | Phage protein; structural genomics, nine-fold NCS. | 97.66 | |
| 2x48_A | 55 | CAG38821; archeal virus, viral protein; 2.60A {Sul | 97.57 | |
| 2hsg_A | 332 | Glucose-resistance amylase regulator; CCPA, transc | 97.55 | |
| 1qpz_A | 340 | PURA, protein (purine nucleotide synthesis repress | 97.52 | |
| 3kjx_A | 344 | Transcriptional regulator, LACI family; LACL famil | 97.48 | |
| 1tc3_C | 51 | Protein (TC3 transposase); DNA binding, helix-turn | 97.36 | |
| 1jhg_A | 101 | Trp operon repressor; complex (regulatory protein- | 97.32 | |
| 3h5t_A | 366 | Transcriptional regulator, LACI family; DNA-depend | 97.26 | |
| 1jko_C | 52 | HIN recombinase, DNA-invertase HIN; water-mediated | 97.25 | |
| 2w7n_A | 101 | TRFB transcriptional repressor protein; INCP, plas | 97.03 | |
| 2ovg_A | 66 | Phage lambda CRO; transcription factor, helix-turn | 97.02 | |
| 2o20_A | 332 | Catabolite control protein A; CCPA, transcriptiona | 96.97 | |
| 1j9i_A | 68 | GPNU1 DBD;, terminase small subunit; DNA binding d | 96.87 | |
| 3dbi_A | 338 | Sugar-binding transcriptional regulator, LACI FAM; | 96.77 | |
| 2csf_A | 101 | DNA-binding protein SATB2; CUT domain, special AT- | 96.76 | |
| 3h5o_A | 339 | Transcriptional regulator GNTR; transcription regu | 96.73 | |
| 1x3u_A | 79 | Transcriptional regulatory protein FIXJ; helix-tur | 96.59 | |
| 3e3m_A | 355 | Transcriptional regulator, LACI family; structural | 96.57 | |
| 3jvd_A | 333 | Transcriptional regulators; structural genomics, P | 96.57 | |
| 3me5_A | 482 | Cytosine-specific methyltransferase; structural ge | 96.52 | |
| 3ctp_A | 330 | Periplasmic binding protein/LACI transcriptional; | 96.49 | |
| 3e7l_A | 63 | Transcriptional regulator (NTRC family); sigma43 a | 96.48 | |
| 2jn6_A | 97 | Protein CGL2762, transposase; GFT PSI-2, protein s | 96.48 | |
| 1jye_A | 349 | Lactose operon repressor; gene regulation, protein | 96.47 | |
| 1qgp_A | 77 | Protein (double stranded RNA adenosine deaminase); | 96.44 | |
| 2elh_A | 87 | CG11849-PA, LD40883P; structural genomics, NPPSFA, | 96.4 | |
| 2htj_A | 81 | P fimbrial regulatory protein KS71A; winged helix- | 96.36 | |
| 1qbj_A | 81 | Protein (double-stranded RNA specific adenosine D | 96.27 | |
| 1umq_A | 81 | Photosynthetic apparatus regulatory protein; DNA-b | 96.22 | |
| 2glo_A | 59 | Brinker CG9653-PA; protein-DNA complex, helix-turn | 96.21 | |
| 3bil_A | 348 | Probable LACI-family transcriptional regulator; st | 96.14 | |
| 1z4h_A | 66 | TORI, TOR inhibition protein; winged helix, revers | 96.11 | |
| 1g2h_A | 61 | Transcriptional regulatory protein TYRR homolog; p | 96.1 | |
| 1hlv_A | 131 | CENP-B, major centromere autoantigen B; helix-turn | 96.09 | |
| 2p7v_B | 68 | Sigma-70, RNA polymerase sigma factor RPOD; RSD, r | 96.08 | |
| 1e3o_C | 160 | Octamer-binding transcription factor 1; transcript | 96.05 | |
| 1pdn_C | 128 | Protein (PRD paired); protein-DNA complex, double | 96.04 | |
| 2jml_A | 81 | DNA binding domain/transcriptional regulator; anti | 96.0 | |
| 1u78_A | 141 | TC3 transposase, transposable element TC3 transpos | 95.99 | |
| 2heo_A | 67 | Z-DNA binding protein 1; protein DLM1-Z-DNA comple | 95.97 | |
| 2o8x_A | 70 | Probable RNA polymerase sigma-C factor; promoter r | 95.91 | |
| 2jpc_A | 61 | SSRB; DNA binding protein, structural genomics, PS | 95.88 | |
| 2xsd_C | 164 | POU domain, class 3, transcription factor 1; trans | 95.86 | |
| 1au7_A | 146 | Protein PIT-1, GHF-1; complex (DNA-binding protein | 95.86 | |
| 1r71_A | 178 | Transcriptional repressor protein KORB; INCP, plas | 95.86 | |
| 1je8_A | 82 | Nitrate/nitrite response regulator protein NARL; p | 95.85 | |
| 3hug_A | 92 | RNA polymerase sigma factor; ECF sigma factor, zin | 95.83 | |
| 1ntc_A | 91 | Protein (nitrogen regulation protein (NTRC)); heli | 95.81 | |
| 2vz4_A | 108 | Tipal, HTH-type transcriptional activator TIPA; tr | 95.81 | |
| 1k78_A | 149 | Paired box protein PAX5; paired domain, ETS domain | 95.8 | |
| 2dk5_A | 91 | DNA-directed RNA polymerase III 39 kDa polypeptide | 95.78 | |
| 1ku3_A | 73 | Sigma factor SIGA; helix-turn-helix, transcription | 95.78 | |
| 1xn7_A | 78 | Hypothetical protein YHGG; alpha+beta, GFT structu | 95.71 | |
| 2w48_A | 315 | Sorbitol operon regulator; SORC, activator, repres | 95.71 | |
| 3ulq_B | 90 | Transcriptional regulatory protein COMA; tetratric | 95.67 | |
| 2ox6_A | 166 | Hypothetical protein SO3848; structural genomics, | 95.66 | |
| 1vz0_A | 230 | PARB, chromosome partitioning protein PARB; nuclea | 95.65 | |
| 1x2l_A | 101 | CUT-like 2, homeobox protein CUX-2; CUT domain, hu | 95.64 | |
| 1wh6_A | 101 | CUT-like 2, homeobox protein CUX-2; CUT domain, st | 95.59 | |
| 1fse_A | 74 | GERE; helix-turn-helix DNA-binding protein transcr | 95.53 | |
| 3kor_A | 119 | Possible Trp repressor; putative DNA-binding Trp r | 95.49 | |
| 2o4a_A | 93 | DNA-binding protein SATB1; protein-DNA complex, tr | 95.46 | |
| 1eto_A | 98 | FIS, factor for inversion stimulation; transcripti | 95.44 | |
| 1tty_A | 87 | Sigma-A, RNA polymerase sigma factor RPOD; helix-t | 95.39 | |
| 1sfx_A | 109 | Conserved hypothetical protein AF2008; structural | 95.37 | |
| 1r8d_A | 109 | Transcription activator MTAN; protein-DNA complex, | 95.37 | |
| 2d1h_A | 109 | ST1889, 109AA long hypothetical transcriptional re | 95.33 | |
| 2k27_A | 159 | Paired box protein PAX-8; paired domain, solution | 95.3 | |
| 2rn7_A | 108 | IS629 ORFA; helix, all alpha, unknown function, st | 95.3 | |
| 3r0a_A | 123 | Putative transcriptional regulator; structural gen | 95.29 | |
| 1oyi_A | 82 | Double-stranded RNA-binding protein; (alpha+beta) | 95.25 | |
| 3c57_A | 95 | Two component transcriptional regulatory protein; | 95.17 | |
| 1s7o_A | 113 | Hypothetical UPF0122 protein SPY1201/SPYM3_0842/SP | 95.16 | |
| 2k02_A | 87 | Ferrous iron transport protein C; FEOC, iron-sulfu | 95.15 | |
| 3cuo_A | 99 | Uncharacterized HTH-type transcriptional regulato; | 95.04 | |
| 2o3f_A | 111 | Putative HTH-type transcriptional regulator YBBH; | 94.99 | |
| 2cfx_A | 144 | HTH-type transcriptional regulator LRPC; transcrip | 94.98 | |
| 3d1n_I | 151 | POU domain, class 6, transcription factor 1; prote | 94.97 | |
| 2rnj_A | 91 | Response regulator protein VRAR; HTH LUXR-type dom | 94.93 | |
| 1wiz_A | 101 | DNA-binding protein SATB2; helix bundle, KIAA1034 | 94.92 | |
| 3l1p_A | 155 | POU domain, class 5, transcription factor 1; POU, | 94.92 | |
| 1p4w_A | 99 | RCSB; solution structure, DNA binding domain, DNA | 94.92 | |
| 2jt1_A | 77 | PEFI protein; solution structure, winged helix-tur | 94.89 | |
| 2w25_A | 150 | Probable transcriptional regulatory protein; trans | 94.84 | |
| 3frw_A | 107 | Putative Trp repressor protein; structural genomic | 94.8 | |
| 2p5k_A | 64 | Arginine repressor; DNA-binding domain, winged hel | 94.79 | |
| 2cg4_A | 152 | Regulatory protein ASNC; DNA binding, FFRP, LRP fa | 94.78 | |
| 2pg4_A | 95 | Uncharacterized protein; structural genomics, join | 94.71 | |
| 2p5v_A | 162 | Transcriptional regulator, LRP/ASNC family; NMB057 | 94.71 | |
| 1ub9_A | 100 | Hypothetical protein PH1061; helix-turn-helix moti | 94.71 | |
| 2dbb_A | 151 | Putative HTH-type transcriptional regulator PH006; | 94.7 | |
| 1q06_A | 135 | Transcriptional regulator CUER; MERR family transc | 94.69 | |
| 1xsv_A | 113 | Hypothetical UPF0122 protein SAV1236; helix-turn-h | 94.66 | |
| 1y0u_A | 96 | Arsenical resistance operon repressor, putative; s | 94.6 | |
| 3bpv_A | 138 | Transcriptional regulator; MARR, DNA binding, tran | 94.56 | |
| 3hh0_A | 146 | Transcriptional regulator, MERR family; protein st | 94.52 | |
| 3bdd_A | 142 | Regulatory protein MARR; putative multiple antibio | 94.52 | |
| 3nrv_A | 148 | Putative transcriptional regulator (MARR/EMRR FAM; | 94.51 | |
| 3iwf_A | 107 | Transcription regulator RPIR family; transcription | 94.5 | |
| 3ech_A | 142 | MEXR, multidrug resistance operon repressor; winge | 94.47 | |
| 3g3z_A | 145 | NMB1585, transcriptional regulator, MARR family; t | 94.47 | |
| 2cyy_A | 151 | Putative HTH-type transcriptional regulator PH151; | 94.44 | |
| 2pn6_A | 150 | ST1022, 150AA long hypothetical transcriptional re | 94.38 | |
| 1r1u_A | 106 | CZRA, repressor protein; zinc, DNA binding, transc | 94.38 | |
| 2e1c_A | 171 | Putative HTH-type transcriptional regulator PH151; | 94.38 | |
| 3t72_q | 99 | RNA polymerase sigma factor RPOD, DNA-directed RN | 94.37 | |
| 2ia0_A | 171 | Putative HTH-type transcriptional regulator PF086; | 94.36 | |
| 2nnn_A | 140 | Probable transcriptional regulator; structural gen | 94.34 | |
| 1u2w_A | 122 | CADC repressor, cadmium efflux system accessory pr | 94.33 | |
| 3mzy_A | 164 | RNA polymerase sigma-H factor; PSI, MCSG, structur | 94.29 | |
| 1i1g_A | 141 | Transcriptional regulator LRPA; helix-turn-helix, | 94.28 | |
| 2hr3_A | 147 | Probable transcriptional regulator; MCSG, structur | 94.26 | |
| 3oop_A | 143 | LIN2960 protein; protein structure initiative, PSI | 94.25 | |
| 3gp4_A | 142 | Transcriptional regulator, MERR family; structural | 94.25 | |
| 2wte_A | 244 | CSA3; antiviral protein, viral resistance, winged | 94.23 | |
| 2oz6_A | 207 | Virulence factor regulator; winged helix, helix-tu | 94.22 | |
| 2oqg_A | 114 | Possible transcriptional regulator, ARSR family P; | 94.22 | |
| 2a61_A | 145 | Transcriptional regulator TM0710; APC4350, MCSG, m | 94.14 | |
| 2rdp_A | 150 | Putative transcriptional regulator MARR; PFAM PF01 | 94.13 | |
| 2lkp_A | 119 | Transcriptional regulator, ARSR family; symmetric | 94.1 | |
| 2fa5_A | 162 | Transcriptional regulator MARR/EMRR family; multip | 94.05 | |
| 3ryp_A | 210 | Catabolite gene activator; CAMP receptor protein ( | 94.04 | |
| 1on2_A | 142 | Transcriptional regulator MNTR; helix-turn-helix, | 94.03 | |
| 2zkz_A | 99 | Transcriptional repressor PAGR; protein-DNA, HTH m | 94.03 | |
| 3mky_B | 189 | Protein SOPB; partition, F plasmid, centromere, DN | 94.02 | |
| 3bro_A | 141 | Transcriptional regulator; helix_TURN_helix, multi | 94.0 | |
| 2zcw_A | 202 | TTHA1359, transcriptional regulator, FNR/CRP famil | 93.97 | |
| 4hbl_A | 149 | Transcriptional regulator, MARR family; HTH, trans | 93.95 | |
| 2fbi_A | 142 | Probable transcriptional regulator; MARR, APC5816, | 93.92 | |
| 2fbh_A | 146 | Transcriptional regulator PA3341; MARR, transcript | 93.91 | |
| 2eth_A | 154 | Transcriptional regulator, putative, MAR family; M | 93.88 | |
| 2f07_A | 197 | YVDT; helix-turn-helix, transcription; HET: BTB; 2 | 93.83 | |
| 1jgs_A | 138 | Multiple antibiotic resistance protein MARR; trans | 93.83 | |
| 1j5y_A | 187 | Transcriptional regulator, biotin repressor famil; | 93.82 | |
| 3s2w_A | 159 | Transcriptional regulator, MARR family; structural | 93.82 | |
| 3eco_A | 139 | MEPR; mutlidrug efflux pump regulator winged helix | 93.81 | |
| 3dv8_A | 220 | Transcriptional regulator, CRP/FNR family; cyclic | 93.8 | |
| 3iwz_A | 230 | CAP-like, catabolite activation-like protein; XCC, | 93.75 | |
| 3b02_A | 195 | Transcriptional regulator, CRP family; structural | 93.71 | |
| 3e97_A | 231 | Transcriptional regulator, CRP/FNR family; YP_6044 | 93.71 | |
| 3i4p_A | 162 | Transcriptional regulator, ASNC family; PSI, struc | 93.7 | |
| 3kkc_A | 177 | TETR family transcriptional regulator; APC20805, s | 93.68 | |
| 2qww_A | 154 | Transcriptional regulator, MARR family; YP_013417. | 93.68 | |
| 3mn2_A | 108 | Probable ARAC family transcriptional regulator; st | 93.66 | |
| 2fmy_A | 220 | COOA, carbon monoxide oxidation system transcripti | 93.65 | |
| 4ev0_A | 216 | Transcription regulator, CRP family; CAMP binding, | 93.6 | |
| 1lj9_A | 144 | Transcriptional regulator SLYA; HTH DNA binding pr | 93.6 | |
| 3d0s_A | 227 | Transcriptional regulatory protein; CAMP receptor | 93.58 | |
| 1ft9_A | 222 | Carbon monoxide oxidation system transcription reg | 93.58 | |
| 1wh8_A | 111 | CUT-like 2, homeobox protein CUX-2; CUT domain, st | 93.55 | |
| 3kp7_A | 151 | Transcriptional regulator TCAR; multiple drug resi | 93.51 | |
| 2qvo_A | 95 | Uncharacterized protein AF_1382; PSI, structural g | 93.5 | |
| 1z05_A | 429 | Transcriptional regulator, ROK family; structural | 93.49 | |
| 3k0l_A | 162 | Repressor protein; helix-turn-helix, structural ge | 93.46 | |
| 3qkx_A | 188 | Uncharacterized HTH-type transcriptional regulato; | 93.45 | |
| 2zhg_A | 154 | Redox-sensitive transcriptional activator SOXR; ox | 93.45 | |
| 1z6r_A | 406 | MLC protein; transcriptional repressor, ROK family | 93.42 | |
| 1q1h_A | 110 | TFE, transcription factor E, TFE; TFIIE, transcrip | 93.42 | |
| 2r0q_C | 209 | Putative transposon TN552 DNA-invertase BIN3; site | 93.4 | |
| 3bqz_B | 194 | HTH-type transcriptional regulator QACR; multidrug | 93.39 | |
| 3gpv_A | 148 | Transcriptional regulator, MERR family; protein st | 93.37 | |
| 2pex_A | 153 | Transcriptional regulator OHRR; transcription regu | 93.36 | |
| 1zyb_A | 232 | Transcription regulator, CRP family; NP_813211.1, | 93.35 | |
| 3bj6_A | 152 | Transcriptional regulator, MARR family; helix-turn | 93.35 | |
| 3lsg_A | 103 | Two-component response regulator YESN; structural | 93.33 | |
| 2nyx_A | 168 | Probable transcriptional regulatory protein, RV14; | 93.32 | |
| 1u8b_A | 133 | ADA polyprotein; protein-DNA complex, methylation, | 93.31 | |
| 2hoe_A | 380 | N-acetylglucosamine kinase; TM1224, structural gen | 93.27 | |
| 3oio_A | 113 | Transcriptional regulator (ARAC-type DNA-binding c | 93.27 | |
| 2gxg_A | 146 | 146AA long hypothetical transcriptional regulator; | 93.27 | |
| 2k9s_A | 107 | Arabinose operon regulatory protein; activator, ar | 93.27 | |
| 1or7_A | 194 | Sigma-24, RNA polymerase sigma-E factor; regulatio | 93.26 | |
| 3la7_A | 243 | Global nitrogen regulator; activator, DNA-binding, | 93.23 | |
| 3cjn_A | 162 | Transcriptional regulator, MARR family; silicibact | 93.23 | |
| 1gdt_A | 183 | GD resolvase, protein (gamma delta resolvase); pro | 93.21 | |
| 1rp3_A | 239 | RNA polymerase sigma factor sigma-28 (FLIA); trans | 93.2 | |
| 3dkw_A | 227 | DNR protein; CRP-FNR, HTH, beta barrel, dimerizati | 93.18 | |
| 3tgn_A | 146 | ADC operon repressor ADCR; helix-turn-helix, trans | 93.17 | |
| 2d6y_A | 202 | Putative TETR family regulatory protein; helix-tur | 93.14 | |
| 3egq_A | 170 | TETR family transcriptional regulator; DNA-binding | 93.14 | |
| 3ppb_A | 195 | Putative TETR family transcription regulator; DNA- | 93.13 | |
| 2gau_A | 232 | Transcriptional regulator, CRP/FNR family; structu | 93.13 | |
| 2x4h_A | 139 | Hypothetical protein SSO2273; transcription; 2.30A | 93.13 | |
| 3on4_A | 191 | Transcriptional regulator, TETR family; structural | 93.12 | |
| 1s3j_A | 155 | YUSO protein; structural genomics, MARR transcript | 93.12 | |
| 1ojl_A | 304 | Transcriptional regulatory protein ZRAR; response | 93.1 | |
| 3lwj_A | 202 | Putative TETR-family transcriptional regulator; st | 93.09 | |
| 3e6c_C | 250 | CPRK, cyclic nucleotide-binding protein; CPRK, hal | 93.09 | |
| 3vpr_A | 190 | Transcriptional regulator, TETR family; all alpha, | 93.09 | |
| 4dyq_A | 140 | Gene 1 protein; GP1, octamer, DNA-binding, viral p | 93.09 | |
| 3oou_A | 108 | LIN2118 protein; protein structure initiative, PSI | 93.03 | |
| 3e6m_A | 161 | MARR family transcriptional regulator; APC88769, s | 92.99 | |
| 3fx3_A | 237 | Cyclic nucleotide-binding protein; helix_TURN_heli | 92.96 | |
| 2rae_A | 207 | Transcriptional regulator, ACRR family protein; TE | 92.95 | |
| 3anp_C | 204 | Transcriptional repressor, TETR family; all alpha | 92.93 | |
| 2qtq_A | 213 | Transcriptional regulator, TETR family; transcript | 92.92 | |
| 3f1b_A | 203 | TETR-like transcriptional regulator; APC5888, rhod | 92.9 | |
| 3lhq_A | 220 | Acrab operon repressor (TETR/ACRR family); structu | 92.88 | |
| 3kcc_A | 260 | Catabolite gene activator; helix-turn-helix, CAMP, | 92.87 | |
| 2v57_A | 190 | TETR family transcriptional repressor LFRR; DNA-bi | 92.85 | |
| 3k2z_A | 196 | LEXA repressor; winged helix-turn-helix, SOS syste | 92.83 | |
| 2h09_A | 155 | Transcriptional regulator MNTR; transcription regu | 92.81 | |
| 3knw_A | 212 | Putative transcriptional regulator (TETR/ACRR FAM; | 92.79 | |
| 2fq4_A | 192 | Transcriptional regulator, TETR family; DNA-bindin | 92.78 | |
| 3jth_A | 98 | Transcription activator HLYU; transcription factor | 92.76 | |
| 2frh_A | 127 | SARA, staphylococcal accessory regulator A; winged | 92.76 | |
| 3jw4_A | 148 | Transcriptional regulator, MARR/EMRR family; DNA-b | 92.75 | |
| 3dcf_A | 218 | Transcriptional regulator of the TETR/ACRR family; | 92.73 | |
| 2zcm_A | 192 | Biofilm operon icaabcd HTH-type negative transcri | 92.72 | |
| 3qbm_A | 199 | TETR transcriptional regulator; DNA/RNA-binding th | 92.69 | |
| 3mkl_A | 120 | HTH-type transcriptional regulator GADX; PSI2, MCS | 92.69 | |
| 2g7s_A | 194 | Transcriptional regulator, TETR family; APC5906, P | 92.68 | |
| 2kko_A | 108 | Possible transcriptional regulatory protein (possi | 92.66 | |
| 3ljl_A | 156 | Transcriptional regulator LUXT; structural genomic | 92.65 | |
| 4aci_A | 191 | HTH-type transcriptional repressor ACNR; aconitase | 92.61 | |
| 3cdh_A | 155 | Transcriptional regulator, MARR family; helix-turn | 92.59 | |
| 3dpj_A | 194 | Transcription regulator, TETR family; APC88616, si | 92.59 | |
| 2dg7_A | 195 | Putative transcriptional regulator; helix-turn-hel | 92.59 | |
| 1ku9_A | 152 | Hypothetical protein MJ223; putative transcription | 92.58 | |
| 2oa4_A | 101 | SIR5; structure, structural genomics, PSI-2, prote | 92.54 | |
| 1yse_A | 141 | DNA-binding protein SATB1; all helical, DNA-bindin | 92.54 | |
| 2jrt_A | 95 | Uncharacterized protein; solution, structure, NESG | 92.53 | |
| 3kz9_A | 206 | SMCR; transcriptional regulator, quorum S DNA-bind | 92.5 | |
| 1z91_A | 147 | Organic hydroperoxide resistance transcriptional; | 92.46 | |
| 3bni_A | 229 | Putative TETR-family transcriptional regulator; st | 92.45 | |
| 2dg6_A | 222 | Putative transcriptional regulator; winged-helix m | 92.44 | |
| 4fx0_A | 148 | Probable transcriptional repressor protein; helix- | 92.43 | |
| 3vp5_A | 189 | Transcriptional regulator; heme, sensor protein, T | 92.43 | |
| 2eh3_A | 179 | Transcriptional regulator; all alpha proteins, tet | 92.41 | |
| 3fm5_A | 150 | Transcriptional regulator; MCSG, PF04017, PSI, MAR | 92.4 | |
| 3hsr_A | 140 | HTH-type transcriptional regulator SARZ; helix-tur | 92.39 | |
| 1tbx_A | 99 | ORF F-93, hypothetical 11.0 kDa protein; sulfolobu | 92.35 | |
| 3o60_A | 185 | LIN0861 protein; PSI, MCSG, structural genomics, m | 92.31 | |
| 3bru_A | 222 | Regulatory protein, TETR family; structural genomi | 92.31 | |
| 1pb6_A | 212 | Hypothetical transcriptional regulator YCDC; helix | 92.3 | |
| 3vib_A | 210 | MTRR; helix-turn-helix motif, DNA binding, DNA bin | 92.26 | |
| 3gzi_A | 218 | Transcriptional regulator, TETR family; TETR famil | 92.25 | |
| 3bhq_A | 211 | Transcriptional regulator; bacterial RE proteins, | 92.24 | |
| 3dew_A | 206 | Transcriptional regulator, TETR family; S genomics | 92.24 | |
| 3nqo_A | 189 | MARR-family transcriptional regulator; structural | 92.24 | |
| 2jj7_A | 186 | Hemolysin II regulatory protein; DNA-binding prote | 92.23 | |
| 2fu4_A | 83 | Ferric uptake regulation protein; DNA binding doma | 92.22 | |
| 1u78_A | 141 | TC3 transposase, transposable element TC3 transpos | 92.19 | |
| 3f0c_A | 216 | TETR-molecule A, transcriptional regulator; MCSG,P | 92.16 | |
| 3frq_A | 195 | Repressor protein MPHR(A); macrolide antibiotic. r | 92.11 | |
| 3szt_A | 237 | QCSR, quorum-sensing control repressor; quorum sen | 92.11 | |
| 3loc_A | 212 | HTH-type transcriptional regulator RUTR; helix-tur | 92.11 | |
| 4a0z_A | 190 | Transcription factor FAPR; lipid homeostasis; HET: | 92.1 | |
| 2yve_A | 185 | Transcriptional regulator; helix-turn-helix, TETR- | 92.09 | |
| 3pas_A | 195 | TETR family transcription regulator; structural ge | 92.09 | |
| 3rh2_A | 212 | Hypothetical TETR-like transcriptional regulator; | 92.08 | |
| 3clo_A | 258 | Transcriptional regulator; NP_811094.1, bacterial | 92.07 | |
| 3deu_A | 166 | Transcriptional regulator SLYA; MARR, WING-helix, | 92.0 | |
| 2kfs_A | 148 | Conserved hypothetical regulatory protein; WHTH, D | 91.97 | |
| 2d5v_A | 164 | Hepatocyte nuclear factor 6; transcription factor, | 91.96 | |
| 3mnl_A | 203 | KSTR, transcriptional regulatory protein (probably | 91.96 | |
| 3f3x_A | 144 | Transcriptional regulator, MARR family, putative; | 91.92 | |
| 2lfw_A | 157 | PHYR sigma-like domain; signal transduction, respo | 91.89 | |
| 3cwr_A | 208 | Transcriptional regulator, TETR family; YP_425770. | 91.88 | |
| 3c2b_A | 221 | Transcriptional regulator, TETR family; structural | 91.87 | |
| 2qwt_A | 196 | Transcriptional regulator, TETR family; structural | 91.86 | |
| 3e7q_A | 215 | Transcriptional regulator; structural genomics, PS | 91.85 | |
| 2ibd_A | 204 | Possible transcriptional regulator; probable trans | 91.83 | |
| 2fxa_A | 207 | Protease production regulatory protein HPR; protea | 91.81 | |
| 3cjd_A | 198 | Transcriptional regulator, TETR family; YP_510936. | 91.8 | |
| 2nx4_A | 194 | Transcriptional regulator, TETR family protein; HT | 91.8 | |
| 3dn7_A | 194 | Cyclic nucleotide binding regulatory protein; stru | 91.8 | |
| 2oer_A | 214 | Probable transcriptional regulator; helix-turn-hel | 91.79 | |
| 2dg8_A | 193 | Putative TETR-family transcriptional regulatory P; | 91.76 | |
| 1vi0_A | 206 | Transcriptional regulator; structural genomics; HE | 91.73 | |
| 2hku_A | 215 | A putative transcriptional regulator; structural g | 91.71 | |
| 3nxc_A | 212 | HTH-type protein SLMA; nucleoid occlusion, cell di | 91.69 | |
| 2g3b_A | 208 | Putative TETR-family transcriptional regulator; tr | 91.68 | |
| 3b81_A | 203 | Transcriptional regulator, ACRR family; NP_350189. | 91.67 | |
| 2zb9_A | 214 | Putative transcriptional regulator; transcription | 91.67 | |
| 2rek_A | 199 | Putative TETR-family transcriptional regulator; su | 91.61 | |
| 4aik_A | 151 | Transcriptional regulator SLYA; transcription, tra | 91.57 | |
| 2o7t_A | 199 | Transcriptional regulator; transcription regulator | 91.54 | |
| 2wui_A | 210 | MEXZ, transcriptional regulator; gene regulation, | 91.53 | |
| 2gen_A | 197 | Probable transcriptional regulator; APC6095, TETR | 91.53 | |
| 1r1t_A | 122 | Transcriptional repressor SMTB; zinc, transcriptio | 91.49 | |
| 2i10_A | 202 | Putative TETR transcriptional regulator; structura | 91.48 | |
| 3mvp_A | 217 | TETR/ACRR transcriptional regulator; PSI, MCSG, st | 91.47 | |
| 3g7r_A | 221 | Putative transcriptional regulator; TETR, all-heli | 91.47 | |
| 1okr_A | 123 | MECI, methicillin resistance regulatory protein ME | 91.47 | |
| 3b73_A | 111 | PHIH1 repressor-like protein; winged-helix-turn-he | 91.45 | |
| 2jsc_A | 118 | Transcriptional regulator RV1994C/MT2050; cadmium, | 91.42 | |
| 2hyt_A | 197 | TETR-family transcriptional regulator; structural | 91.4 | |
| 3bja_A | 139 | Transcriptional regulator, MARR family, putative; | 91.39 | |
| 2q0o_A | 236 | Probable transcriptional activator protein TRAR; h | 91.39 | |
| 2qib_A | 231 | TETR-family transcriptional regulator; HTH DNA bin | 91.34 | |
| 3nnr_A | 228 | Transcriptional regulator, TETR family; TETR-famil | 91.26 | |
| 2np5_A | 203 | Transcriptional regulator; TETR family, structural | 91.26 | |
| 3col_A | 196 | Putative transcription regulator; structural genom | 91.25 | |
| 3rd3_A | 197 | Probable transcriptional regulator; 2.40A {Pseudom | 91.19 | |
| 1uly_A | 192 | Hypothetical protein PH1932; helix-turn-helix, str | 91.16 | |
| 3q0w_A | 236 | HTH-type transcriptional regulator EThr; TETR fami | 91.16 | |
| 2bgc_A | 238 | PRFA; bacterial infection, human pathogen, transcr | 91.16 | |
| 3v6g_A | 208 | Probable transcriptional regulatory protein (PROB | 91.15 | |
| 1mkm_A | 249 | ICLR transcriptional regulator; structural genomic | 91.14 | |
| 3bjb_A | 207 | Probable transcriptional regulator, TETR family P; | 91.13 | |
| 3g7d_A | 443 | PHPD; non heme Fe(II) dioxygenase, cupin, biosynth | 91.12 | |
| 1xmk_A | 79 | Double-stranded RNA-specific adenosine deaminase; | 91.11 | |
| 3rqi_A | 184 | Response regulator protein; structural genomics, s | 91.09 | |
| 3crj_A | 199 | Transcription regulator; APC88200, TETR, structura | 91.08 | |
| 1rkt_A | 205 | Protein YFIR; transcription regulator, structural | 91.02 | |
| 2id3_A | 225 | Putative transcriptional regulator; structural gen | 90.96 | |
| 3s5r_A | 216 | Transcriptional regulator TETR family; DNA/RNA-bin | 90.96 | |
| 2pz9_A | 226 | Putative regulatory protein; structural genomics, | 90.85 | |
| 1b4a_A | 149 | Arginine repressor; helix turn helix; 2.50A {Geoba | 90.83 | |
| 1zk8_A | 183 | Transcriptional regulator, TETR family; TETR membe | 90.83 | |
| 2guh_A | 214 | Putative TETR-family transcriptional regulator; he | 90.8 | |
| 2gfn_A | 209 | HTH-type transcriptional regulator PKSA related P; | 90.76 | |
| 2zcx_A | 231 | SCO7815, TETR-family transcriptional regulator; he | 90.76 | |
| 3npi_A | 251 | TETR family regulatory protein; structural genomic | 90.73 | |
| 2q24_A | 194 | Putative TETR family transcriptional regulator; st | 90.67 | |
| 2o0m_A | 345 | Transcriptional regulator, SORC family; structural | 90.67 | |
| 1sfu_A | 75 | 34L protein; protein/Z-DNA complex, DNA binding pr | 90.65 | |
| 1l3l_A | 234 | Transcriptional activator protein TRAR; helix-turn | 90.63 | |
| 3uj3_X | 193 | DNA-invertase; helix-turn-helix, site-specific rec | 90.59 | |
| 1ui5_A | 215 | A-factor receptor homolog; helix-turn-helix, alpha | 90.58 | |
| 3he0_A | 196 | Transcriptional regulator, TETR family; ACRR, vibr | 90.58 | |
| 2bv6_A | 142 | MGRA, HTH-type transcriptional regulator MGRA; mul | 90.56 | |
| 3eup_A | 204 | Transcriptional regulator, TETR family; structural | 90.56 | |
| 2w53_A | 219 | Repressor, SMet; antibiotic resistance, multi-drug | 90.53 | |
| 2obp_A | 96 | Putative DNA-binding protein; structural genomics, | 90.4 | |
| 2id6_A | 202 | Transcriptional regulator, TETR family; 1.75A {The | 90.37 | |
| 3g1o_A | 255 | Transcriptional regulatory repressor protein (TETR | 90.34 | |
| 3qao_A | 249 | LMO0526 protein, MERR-like transcriptional regulat | 90.29 | |
| 1p6r_A | 82 | Penicillinase repressor; transcription regulation, | 90.28 | |
| 3geu_A | 189 | Intercellular adhesion protein R; TETR family, int | 90.22 | |
| 1z7u_A | 112 | Hypothetical protein EF0647; winged-helix-turn-hel | 90.21 | |
| 3pqk_A | 102 | Biofilm growth-associated repressor; helix-turn-he | 89.98 | |
| 3rkx_A | 323 | Biotin-[acetyl-COA-carboxylase] ligase; biotin pro | 89.97 | |
| 3jsj_A | 190 | Putative TETR-family transcriptional regulator; DN | 89.97 | |
| 1t33_A | 224 | Putative transcriptional repressor (TETR/ACRR FAM; | 89.93 | |
| 2xdn_A | 210 | HTH-type transcriptional regulator TTGR; transcrip | 89.85 | |
| 2ras_A | 212 | Transcriptional regulator, TETR family; bacterial | 89.84 | |
| 1bl0_A | 129 | Protein (multiple antibiotic resistance protein), | 89.79 | |
| 3szp_A | 291 | Transcriptional regulator, LYSR family; winged hel | 89.75 | |
| 1o5l_A | 213 | Transcriptional regulator, CRP family; TM1171, str | 89.73 | |
| 2oi8_A | 216 | Putative regulatory protein SCO4313; TETR, structu | 89.72 | |
| 2hzt_A | 107 | Putative HTH-type transcriptional regulator YTCD; | 89.69 | |
| 3bqy_A | 209 | Putative TETR family transcriptional regulator; st | 89.66 | |
| 2of7_A | 260 | Putative TETR-family transcriptional regulator; AP | 89.65 | |
| 2iai_A | 230 | Putative transcriptional regulator SCO3833; struct | 89.61 | |
| 3f6o_A | 118 | Probable transcriptional regulator, ARSR family pr | 89.59 | |
| 2xrn_A | 241 | HTH-type transcriptional regulator TTGV; DNA-bindi | 89.58 | |
| 3c07_A | 273 | Putative TETR-family transcriptional regulator; AP | 89.57 | |
| 4b8x_A | 147 | SCO5413, possible MARR-transcriptional regulator; | 89.57 | |
| 1sgm_A | 191 | Putative HTH-type transcriptional regulator YXAF; | 89.5 | |
| 1ixc_A | 294 | CBNR, LYSR-type regulatory protein; long alpha hel | 89.42 | |
| 3cdl_A | 203 | Transcriptional regulator AEFR; APC88582, TETR, ps | 89.39 | |
| 1r8e_A | 278 | Multidrug-efflux transporter regulator; protein-DN | 89.39 | |
| 3hta_A | 217 | EBRA repressor; TETR family, DNA binding protein, | 89.37 | |
| 2f2e_A | 146 | PA1607; transcription factor, helix-TRUN-helix, AP | 89.36 | |
| 2esn_A | 310 | Probable transcriptional regulator; PA0477, APC582 | 89.27 | |
| 1y6u_A | 70 | XIS, excisionase from transposon TN916; structure, | 89.27 | |
| 3hhg_A | 306 | Transcriptional regulator, LYSR family; transcript | 89.21 | |
| 2xpw_A | 207 | Tetracycline repressor protein class D; transcript | 89.16 | |
| 2opt_A | 234 | Actii protein; helical protein, TETR family, APO-p | 89.15 | |
| 3hrs_A | 214 | Metalloregulator SCAR; DTXR/MNTR family member, tr | 89.09 | |
| 2fbq_A | 235 | Probable transcriptional regulator; PA3006, APC589 | 88.88 | |
| 3qp6_A | 265 | CVIR transcriptional regulator; quorum sensing, ag | 88.83 | |
| 1l9z_H | 438 | Sigma factor SIGA; helix-turn-helix, coiled-coil, | 88.69 | |
| 2hyj_A | 200 | Putative TETR-family transcriptional regulator; HT | 88.64 | |
| 3boq_A | 160 | Transcriptional regulator, MARR family; MARR famil | 88.62 | |
| 2hxi_A | 241 | Putative transcriptional regulator; structural gen | 88.39 | |
| 3u2r_A | 168 | Regulatory protein MARR; structural genomics, PSI- | 88.35 | |
| 1u3e_M | 174 | HNH homing endonuclease; HNH catalytic motif, heli | 88.24 | |
| 4ich_A | 311 | Transcriptional regulator; structural genomics, PS | 88.18 | |
| 2ijl_A | 135 | AGR_C_4647P, molybdenum-binding transcriptional re | 88.18 | |
| 1iuf_A | 144 | Centromere ABP1 protein; riken structural genomics | 88.14 | |
| 3cta_A | 230 | Riboflavin kinase; structural genomics, transferas | 88.11 | |
| 2k4b_A | 99 | Transcriptional regulator; DNA binding protein, wi | 87.91 | |
| 2g7g_A | 213 | RHA04620, putative transcriptional regulator; heli | 87.9 | |
| 1sd4_A | 126 | Penicillinase repressor; BLAI, MECI, methicillin, | 87.85 | |
| 3fxq_A | 305 | LYSR type regulator of TSAMBCD; transcriptional re | 87.74 | |
| 3aqt_A | 245 | Bacterial regulatory proteins, TETR family; helix- | 87.74 | |
| 1bia_A | 321 | BIRA bifunctional protein; transcription regulatio | 87.67 | |
| 1l0o_C | 243 | Sigma factor; bergerat fold, helix-turn-helix, pro | 87.65 | |
| 1v4r_A | 102 | Transcriptional repressor; helix-turn-helix, winge | 87.64 | |
| 1z0x_A | 220 | Transcriptional regulator, TETR family; structural | 87.58 | |
| 2b0l_A | 102 | GTP-sensing transcriptional pleiotropic repressor; | 87.48 | |
| 4hku_A | 178 | LMO2814 protein, TETR transcriptional regulator; s | 87.31 | |
| 1rr7_A | 129 | Middle operon regulator; MOR, transcription; 2.20A | 87.3 | |
| 2qko_A | 215 | Possible transcriptional regulator, TETR family P; | 87.27 | |
| 1k78_A | 149 | Paired box protein PAX5; paired domain, ETS domain | 87.25 | |
| 2iu5_A | 195 | DHAS, YCEG, HTH-type dhaklm operon transcriptional | 87.24 | |
| 2og0_A | 52 | Excisionase; protein-DNA complex, DNA architectura | 87.0 | |
| 3ni7_A | 213 | Bacterial regulatory proteins, TETR family; transc | 86.94 | |
| 3him_A | 211 | Probable transcriptional regulator; TETR, bacteria | 86.78 | |
| 4ham_A | 134 | LMO2241 protein; structural genomics, PSI-biology, | 86.75 | |
| 2y2z_A | 267 | SIM16, SIMR, putative repressor simreg2; transcrip | 86.7 | |
| 3nrg_A | 217 | TETR family transcriptional regulator; structural | 86.64 | |
| 2o0y_A | 260 | Transcriptional regulator; ICLR-family, structural | 86.62 | |
| 3ccy_A | 203 | Putative TETR-family transcriptional regulator; AP | 86.56 | |
| 3tqn_A | 113 | Transcriptional regulator, GNTR family; regulatory | 86.53 | |
| 2g9w_A | 138 | Conserved hypothetical protein; DNA-binding domain | 86.48 | |
| 2g7u_A | 257 | Transcriptional regulator; ICLR family, structural | 86.4 | |
| 2g7l_A | 243 | TETR-family transcriptional regulator; APC6062, pr | 86.21 | |
| 3f6v_A | 151 | Possible transcriptional regulator, ARSR family pr | 86.21 | |
| 2np3_A | 212 | Putative TETR-family regulator; transcriptional re | 86.08 | |
| 2fd5_A | 180 | Transcriptional regulator; DNA-binding protein, st | 86.07 | |
| 3on2_A | 199 | Probable transcriptional regulator; protein struct | 85.97 | |
| 3fiw_A | 211 | Putative TETR-family transcriptional regulator; TE | 85.96 | |
| 2vn2_A | 128 | DNAD, chromosome replication initiation protein; D | 85.96 | |
| 3isp_A | 303 | HTH-type transcriptional regulator RV1985C/MT2039; | 85.84 | |
| 3lsj_A | 220 | DEST; transcriptional repressor, TETR family, DNA- | 85.83 | |
| 3neu_A | 125 | LIN1836 protein; structural genomics, PSI-2, prote | 85.83 | |
| 3plo_X | 193 | DNA-invertase; resolvase, helix-turn-helix, serine | 85.8 | |
| 2vpr_A | 207 | Tetracycline resistance repressor protein; transcr | 85.66 | |
| 4ac0_A | 202 | Tetracycline repressor protein class B from trans | 85.65 | |
| 2fbk_A | 181 | Transcriptional regulator, MARR family; winged-hel | 85.43 | |
| 2y75_A | 129 | HTH-type transcriptional regulator CYMR; DNA bindi | 85.27 | |
| 2fsw_A | 107 | PG_0823 protein; alpha-beta structure, helix-turn- | 85.27 | |
| 3gbg_A | 276 | TCP pilus virulence regulatory protein; cupin, hel | 85.26 | |
| 1fx7_A | 230 | Iron-dependent repressor IDER; DTXR, iron-dependen | 85.15 | |
| 3mq0_A | 275 | Transcriptional repressor of the blcabc operon; he | 84.87 | |
| 3r4k_A | 260 | Transcriptional regulator, ICLR family; DNA/RNA-bi | 84.83 |
| >2jvl_A TRMBF1; coactivator, helix-turn-helix, Pro binding, transcription; NMR {Trichoderma reesei} | Back alignment and structure |
|---|
Probab=99.75 E-value=7.4e-18 Score=96.74 Aligned_cols=76 Identities=30% Similarity=0.488 Sum_probs=66.7
Q ss_pred chhhhhhhccCCCCCCC--------HHHHHHHHH--hCCCCHHHHHHHhCCCHHHHHHHHcCCCCCCHHHHHHHHHHhCC
Q 038591 5 GAVINMRKLDEGTEPDT--------PRQIQRARL--GKKMSQPDLANQINQRPQVVSEYENGKAVPNQTVLAKMEKAIGV 74 (82)
Q Consensus 5 ~~~~~~~~~~~~~~~~~--------~~~lk~~r~--~~g~s~~elA~~~gis~~~i~~~e~g~~~p~~~~~~~la~~lgv 74 (82)
..+++..+++.....+. +.+|+.+|. ..|+||.+||+.+|+|+++|++||+|...|+.+.+.+||++|||
T Consensus 11 ~~~~~~~~~d~~~~~~~~~~~~~~~g~~lk~~R~~~~~glsq~elA~~~gis~~~is~~E~G~~~p~~~~l~~ia~~l~v 90 (107)
T 2jvl_A 11 TEGQRLTKVDRSDDIIKPKTVGKEVGKAIEQGRQKFEPTMTQAELGKEIGETAATVASYERGTATPDQNILSKMERVLNV 90 (107)
T ss_dssp CCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHTTSSSCCCHHHHHHHHTCCHHHHHHHTTTCSCCCHHHHHHHHHTTTC
T ss_pred CcccccccccccccccCHHHHHHHHHHHHHHHHHHHHcCCCHHHHHHHHCcCHHHHHHHHcCCCCCCHHHHHHHHHHHCc
Confidence 34566666666555432 899999999 99999999999999999999999999999999999999999999
Q ss_pred CCcccc
Q 038591 75 KLRVKI 80 (82)
Q Consensus 75 ~~~e~~ 80 (82)
++++.+
T Consensus 91 ~~~e~~ 96 (107)
T 2jvl_A 91 KLRGAN 96 (107)
T ss_dssp BSSSSS
T ss_pred CHhhhc
Confidence 999865
|
| >2ewt_A BLDD, putative DNA-binding protein; the DNA-binding domain of BLDD; 1.81A {Streptomyces coelicolor} | Back alignment and structure |
|---|
| >3qq6_A HTH-type transcriptional regulator SINR; helix-turn-helix motif, biofilm, repressor, SINI; 1.90A {Bacillus subtilis} | Back alignment and structure |
|---|
| >3s8q_A R-M controller protein; protein-DNA complex, helix-turn-helix; HET: DNA; 2.10A {Enterobacter SP} SCOP: a.35.1.0 PDB: 3clc_A* 3ufd_A* | Back alignment and structure |
|---|
| >3omt_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; 1.65A {Cytophaga hutchinsonii} | Back alignment and structure |
|---|
| >3kz3_A Repressor protein CI; five helix bundle, DNA-binding, transcription, transcription regulation; 1.64A {Enterobacteria phage lambda} | Back alignment and structure |
|---|
| >3g5g_A Regulatory protein; transcriptional regulator, helix-turn-helix, restriction- modification, transcription regulator; 2.80A {Enterobacter SP} PDB: 3fya_A | Back alignment and structure |
|---|
| >1y7y_A C.AHDI; helix-turn-helix, DNA-binding protein, transcriptional regulator, transcription regulator; 1.69A {Aeromonas hydrophila} SCOP: a.35.1.3 | Back alignment and structure |
|---|
| >3f6w_A XRE-family like protein; helix-turn-helix, DNA binding protein, xenobiotic response E family of transcriptional regulators; HET: MSE BTB; 1.85A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >3lfp_A CSP231I C protein; transcriptional regulator, DNA binding protein, helix-turn-H restriction-modification, transcription; 2.00A {Citrobacter SP} PDB: 3lis_A | Back alignment and structure |
|---|
| >2r1j_L Repressor protein C2; protein-DNA complex, helix-turn-helix, DNA-binding, transcription, transcription regulation; 1.53A {Enterobacteria phage P22} SCOP: a.35.1.2 PDB: 3jxb_C 3jxc_L 3jxd_L | Back alignment and structure |
|---|
| >2k9q_A Uncharacterized protein; all helix, helix-turn-helix, plasmid, structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >3b7h_A Prophage LP1 protein 11; structural genomics, PSI2, MCSG, protein structure initiative, midwest center for structural genomics; 2.00A {Lactobacillus plantarum WCFS1} | Back alignment and structure |
|---|
| >2b5a_A C.BCLI; helix-turn-helix motif, gene regulation; 1.54A {Bacillus caldolyticus} SCOP: a.35.1.3 | Back alignment and structure |
|---|
| >3op9_A PLI0006 protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG, transcription regulat; HET: MSE; 1.90A {Listeria innocua} | Back alignment and structure |
|---|
| >3ivp_A Putative transposon-related DNA-binding protein; APC62618, clostridium diffic structural genomics, PSI-2, protein structure initiative; HET: PG4; 2.02A {Clostridium difficile} | Back alignment and structure |
|---|
| >1x57_A Endothelial differentiation-related factor 1; HMBF1alpha, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.35.1.12 | Back alignment and structure |
|---|
| >1adr_A P22 C2 repressor; transcription regulation; NMR {Enterobacteria phage P22} SCOP: a.35.1.2 | Back alignment and structure |
|---|
| >2kpj_A SOS-response transcriptional repressor, LEXA; NESG, GFT, structural genomics, PSI-2, protein structure initiative; NMR {Eubacterium rectale atcc 33656} | Back alignment and structure |
|---|
| >3vk0_A NHTF, transcriptional regulator; HTH motif, XRE transcription factor, DNA binding protein; 1.88A {Neisseria meningitidis} | Back alignment and structure |
|---|
| >3eus_A DNA-binding protein; structural genomics, PSI2,MCSG, protein structure initiative, midwest center for structural genomic binding; 1.80A {Silicibacter pomeroyi} | Back alignment and structure |
|---|
| >3trb_A Virulence-associated protein I; mobIle and extrachromosomal element functions, DNA binding P; 2.00A {Coxiella burnetii} | Back alignment and structure |
|---|
| >2xi8_A Putative transcription regulator; HTH DNA-binding motif; HET: GOL; 1.21A {Enterococcus faecalis} PDB: 2gzu_A 1utx_A* 2xj3_A 2xiu_A | Back alignment and structure |
|---|
| >3bs3_A Putative DNA-binding protein; XRE-family, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.65A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >3mlf_A Transcriptional regulator; structural genomics, helix-turn-helix XRE-family like protei transcription regulator, PSI-2; 2.60A {Staphylococcus aureus subsp} | Back alignment and structure |
|---|
| >1lmb_3 Protein (lambda repressor); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 1.80A {Enterobacteria phage lambda} SCOP: a.35.1.2 PDB: 1lrp_A 1rio_A 1lli_A* | Back alignment and structure |
|---|
| >2wiu_B HTH-type transcriptional regulator HIPB; transferase transcription complex, serine kinase, DNA-bindin mercury derivative, repressor; 2.35A {Escherichia coli} PDB: 3dnv_B* 3dnw_B* 3hzi_B* | Back alignment and structure |
|---|
| >3fmy_A HTH-type transcriptional regulator MQSA (YGIT/B3021); helix-turn-helix, DNA-binding, transcription regulation, DNA binding protein; HET: MEQ; 1.40A {Escherichia coli k-12} | Back alignment and structure |
|---|
| >3f52_A CLP gene regulator (CLGR); helix-turn-helix motif, transcriptional ACTI human pathogen, transcription activator; 1.75A {Corynebacterium glutamicum} PDB: 3f51_A | Back alignment and structure |
|---|
| >2a6c_A Helix-turn-helix motif; putative transcriptional regulator, structural genomics, JOI for structural genomics, JCSG; HET: CIT; 1.90A {Nitrosomonas europaea} SCOP: a.35.1.13 | Back alignment and structure |
|---|
| >1r69_A Repressor protein CI; gene regulating protein; 2.00A {Phage 434} SCOP: a.35.1.2 PDB: 1pra_A 1per_L 1rpe_L* 2or1_L* 1r63_A 2r63_A 1sq8_A | Back alignment and structure |
|---|
| >3cec_A Putative antidote protein of plasmid maintenance; structural genomics, joint center for structural genomics, J protein structure initiative; HET: MSE; 1.60A {Nostoc punctiforme} | Back alignment and structure |
|---|
| >1b0n_A Protein (SINR protein); transcription regulator, antagonist, sporulation; 1.90A {Bacillus subtilis} SCOP: a.34.1.1 a.35.1.3 PDB: 2yal_A | Back alignment and structure |
|---|
| >4ghj_A Probable transcriptional regulator; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: MSE; 1.75A {Vibrio vulnificus} | Back alignment and structure |
|---|
| >2ict_A Antitoxin HIGA; helix-turn-helix, structural genomics, PSI-2, protein struct initiative, northeast structural genomics consortium, NESG; 1.63A {Escherichia coli} SCOP: a.35.1.3 PDB: 2icp_A | Back alignment and structure |
|---|
| >1zug_A Phage 434 CRO protein; gene regulating protein, transcription regulation; NMR {Phage 434} SCOP: a.35.1.2 PDB: 2cro_A 3cro_L* | Back alignment and structure |
|---|
| >3fym_A Putative uncharacterized protein; HTH DNA binding, DNA binding protein; 1.00A {Staphylococcus aureus subsp} | Back alignment and structure |
|---|
| >2ef8_A C.ECOT38IS, putative transcription factor; helix-turn-helix, DNA binding protein, transcription regulator; HET: CME; 1.95A {Enterobacteria phage P2} | Back alignment and structure |
|---|
| >2wus_R RODZ, putative uncharacterized protein; structural protein, cell WALL morphogenesis, bacterial cytos bacterial actin; 2.90A {Thermotoga maritima} | Back alignment and structure |
|---|
| >2l49_A C protein; P2 bacteriophage, P2 C, direct repeats, DNA-binding protein, binding protein; NMR {Enterobacteria phage P2} PDB: 2xcj_A | Back alignment and structure |
|---|
| >2o38_A Hypothetical protein; alpha-beta, helix-turn-helix, structural genomics, PSI-2, PR structure initiative; 1.83A {Rhodopseudomonas palustris} SCOP: a.35.1.13 | Back alignment and structure |
|---|
| >2ppx_A AGR_C_3184P, uncharacterized protein ATU1735; HTH-motif, XRE-family, structural genomics, PSI-2, protein structure initiative; 2.00A {Agrobacterium tumefaciens str} SCOP: a.35.1.3 | Back alignment and structure |
|---|
| >2eby_A Putative HTH-type transcriptional regulator YBAQ; hypothetical protein, JW0472, structural genomics, NPPSFA; 2.25A {Escherichia coli} | Back alignment and structure |
|---|
| >1y9q_A Transcriptional regulator, HTH_3 family; transcriptional regulaator, strucutral genomics, protein structure initiative, PSI; 1.90A {Vibrio cholerae} SCOP: a.35.1.8 b.82.1.15 | Back alignment and structure |
|---|
| >3kxa_A NGO0477 protein, putative uncharacterized protein; NEW protein fold, OPPF, STRU genomics, oxford protein production facility; 2.80A {Neisseria gonorrhoeae} | Back alignment and structure |
|---|
| >2bnm_A Epoxidase; oxidoreductase, cupin, HTH, cation-dependant, zinc, fosfomycin; 1.7A {Streptomyces wedmorensis} SCOP: a.35.1.3 b.82.1.10 PDB: 1zz7_A 1zz8_A 1zz9_A 1zzb_A 1zz6_A 1zzc_A 2bnn_A 2bno_A 3scf_A 3scg_A 3sch_A | Back alignment and structure |
|---|
| >2ofy_A Putative XRE-family transcriptional regulator; transcription regulator, structural genomics, PS protein structure initiative; 1.70A {Rhodococcus SP} SCOP: a.35.1.3 | Back alignment and structure |
|---|
| >3bd1_A CRO protein; transcription factor, helix-turn-helix, prophage, structural evolution, transcription; 1.40A {Xylella fastidiosa} | Back alignment and structure |
|---|
| >3r1f_A ESX-1 secretion-associated regulator ESPR; helix-turn-helix, transcription factor, helix-turn-helix transcription factor; 2.50A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A | Back alignment and structure |
|---|
| >3qwg_A ESX-1 secretion-associated regulator ESPR; N-terminal helix-turn-helix motif, transcription factor, transcription; 1.99A {Mycobacterium tuberculosis} PDB: 3qf3_A 3qyx_A | Back alignment and structure |
|---|
| >3pxp_A Helix-turn-helix domain protein; DNA-binding, basic helix-loop-helix motif, BHLH motif, lambd repressor-like DNA-binding fold; HET: MSE MYR; 2.30A {Chloroflexus aurantiacus} | Back alignment and structure |
|---|
| >3o9x_A Uncharacterized HTH-type transcriptional regulato; HTH-XRE DNA binding motif, transcriptional regulator, bacter antitoxin, Zn binding protein, transcription regulator-DNA; HET: DNA; 2.10A {Escherichia coli} PDB: 3gn5_A* 3gn5_B* 2kz8_A | Back alignment and structure |
|---|
| >2awi_A PRGX; repressor, pheromone, DNA binding, regulatory domain, transcription; 2.25A {Enterococcus faecalis} SCOP: a.35.1.11 a.118.8.4 PDB: 2axv_A 2axu_A 2aw6_A 2axz_A 2grl_A 2grm_A | Back alignment and structure |
|---|
| >4ich_A Transcriptional regulator; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, transcription RE; 1.95A {Saccharomonospora viridis} | Back alignment and structure |
|---|
| >1neq_A DNA-binding protein NER; NMR {Enterobacteria phage MU} SCOP: a.35.1.2 PDB: 1ner_A | Back alignment and structure |
|---|
| >2p5t_A Putative transcriptional regulator PEZA; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >3bdn_A Lambda repressor; repressor, allostery; HET: DNA; 3.91A {Enterobacteria phage lambda} | Back alignment and structure |
|---|
| >2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} | Back alignment and structure |
|---|
| >2l1p_A DNA-binding protein SATB1; PSI-biology, NESG, structural genomics, protein structure in northeast structural genomics consortium; NMR {Homo sapiens} PDB: 3nzl_A* | Back alignment and structure |
|---|
| >2fjr_A Repressor protein CI; genetic switch, regulation, cooperativity, transcription regulator; 1.95A {Enterobacteria phage 186} PDB: 2fkd_A | Back alignment and structure |
|---|
| >2auw_A Hypothetical protein NE0471; alpha-beta structure, structural genomics, PSI, protein STRU initiative; 1.85A {Nitrosomonas europaea} SCOP: a.35.1.10 d.331.1.1 | Back alignment and structure |
|---|
| >1dw9_A Cyanate lyase; cyanate degradation, structural genomics, PSI, protei structure initiative, midwest center for structural genomic; HET: SO4; 1.65A {Escherichia coli} SCOP: a.35.1.4 d.72.1.1 PDB: 1dwk_A* 2ivq_A 2ivb_A 2iu7_A 2iv1_A 2iuo_A 2ivg_A | Back alignment and structure |
|---|
| >1nr3_A MTH0916, DNA-binding protein TFX; northeast structural genomics consortium, reduced- dimensionality PSI; NMR {Methanothermobacterthermautotrophicus} SCOP: d.236.1.1 | Back alignment and structure |
|---|
| >1rzs_A Antirepressor, regulatory protein CRO; helix-turn-helix, DNA-binding protein, structural evolution, transcription; NMR {Enterobacteria phage P22} SCOP: a.35.1.2 | Back alignment and structure |
|---|
| >1uxc_A FRUR (1-57), fructose repressor; DNA-binding protein, LACI family, transc regulation; NMR {Escherichia coli} SCOP: a.35.1.5 PDB: 1uxd_A | Back alignment and structure |
|---|
| >2l8n_A Transcriptional repressor CYTR; bacterial gene repressor, helix turn helix binding domain, L family, transcription regulation, binding protein; NMR {Escherichia coli} PDB: 2lcv_A | Back alignment and structure |
|---|
| >1zx4_A P1 PARB, plasmid partition PAR B protein, PARB; translation; HET: CIT; 2.98A {Enterobacteria phage P1} PDB: 2ntz_A | Back alignment and structure |
|---|
| >3g7d_A PHPD; non heme Fe(II) dioxygenase, cupin, biosynthetic protein; 1.80A {Streptomyces viridochromogenes} PDB: 3gbf_A 3rzz_A | Back alignment and structure |
|---|
| >1s4k_A Putative cytoplasmic protein YDIL; structural genomics, MCSG, PSI, PROT structure initiative; 1.90A {Salmonella typhimurium} SCOP: a.35.1.6 | Back alignment and structure |
|---|
| >2h8r_A Hepatocyte nuclear factor 1-beta; trasncription factor, POU, homeo, protein-DNA, human disease; 3.20A {Homo sapiens} | Back alignment and structure |
|---|
| >2pij_A Prophage PFL 6 CRO; transcription factor, helix-turn-helix, structural evolution, transcription; 1.70A {Pseudomonas fluorescens} | Back alignment and structure |
|---|
| >1ic8_A Hepatocyte nuclear factor 1-alpha; transcription regulation, DNA-binding, POU domain, diabetes, disease mutation, MODY3, transcription/DNA comple; 2.60A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 | Back alignment and structure |
|---|
| >2hin_A GP39, repressor protein; transcription factor, dimer interface, helix-turn-helix; 1.05A {Enterobacteria phage N15} PDB: 3qws_A | Back alignment and structure |
|---|
| >2l0k_A Stage III sporulation protein D; SPOIIID, solution structure, DNA binding, bacillus subti transcription factor, transcription; NMR {Bacillus subtilis} | Back alignment and structure |
|---|
| >2cw1_A SN4M; lambda CRO fold, de novo protein; NMR {Synthetic} SCOP: k.46.1.1 | Back alignment and structure |
|---|
| >1zs4_A Regulatory protein CII; helix-turn-helix, transcription activator, transcription-DNA; HET: DNA; 1.70A {Enterobacteria phage lambda} SCOP: a.35.1.9 | Back alignment and structure |
|---|
| >1jhf_A LEXA repressor; LEXA SOS repressor, hydrolase; 1.80A {Escherichia coli} SCOP: a.4.5.2 b.87.1.1 PDB: 1jhh_A 3jso_A* 3jsp_A* 3k3r_E* 1jhc_A 1jhe_A 1lea_A 1leb_A | Back alignment and structure |
|---|
| >1xwr_A Regulatory protein CII; all-alpha fold, DNA binding protein; 2.56A {Bacteriophage lambda} SCOP: a.35.1.9 PDB: 1zpq_A | Back alignment and structure |
|---|
| >2ao9_A Phage protein; structural genomics, nine-fold NCS., PSI, protein structure initiative, midwest center for structural genomics, MCSG, U function; 1.90A {Bacillus cereus} SCOP: a.4.1.17 | Back alignment and structure |
|---|
| >2x48_A CAG38821; archeal virus, viral protein; 2.60A {Sulfolobus islandicus rod-shaped virusorganism_taxid} | Back alignment and structure |
|---|
| >2hsg_A Glucose-resistance amylase regulator; CCPA, transcriptional regulator, transcription regulator; 2.50A {Bacillus megaterium} SCOP: a.35.1.5 c.93.1.1 PDB: 1rzr_G 2jcg_A 1zvv_A 3oqo_A* 3oqm_A* 3oqn_A* | Back alignment and structure |
|---|
| >1qpz_A PURA, protein (purine nucleotide synthesis repressor); transcription regulation, DNA-binding, purine biosynthesis; HET: DNA HPA; 2.50A {Escherichia coli} SCOP: a.35.1.5 c.93.1.1 PDB: 1bdi_A* 1qp0_A* 1qp4_A* 1pnr_A* 1wet_A* 1zay_A* 1vpw_A* 2pue_A* 2puf_A* 2pug_A* 1bdh_A* 1qp7_A* 1qqa_A* 1qqb_A* 2puc_A* 2pua_A* 2pub_A* 2pud_A* 1jfs_A* 1jh9_A* ... | Back alignment and structure |
|---|
| >3kjx_A Transcriptional regulator, LACI family; LACL family, protein structure initiative II(PSI II), NYSGXRC, structural genomics; 2.33A {Silicibacter pomeroyi} | Back alignment and structure |
|---|
| >1tc3_C Protein (TC3 transposase); DNA binding, helix-turn-helix, TC1/mariner family, complex (transposase/DNA), DNA binding protein/DNA complex; HET: DNA; 2.45A {Caenorhabditis elegans} SCOP: a.4.1.2 | Back alignment and structure |
|---|
| >1jhg_A Trp operon repressor; complex (regulatory protein-peptide), DNA-binding regulatory complex (regulatory protein-peptide) complex; HET: TRP; 1.30A {Escherichia coli} SCOP: a.4.12.1 PDB: 1co0_A* 1mi7_R 1p6z_R 1wrp_R* 1zt9_A* 2oz9_R* 3ssw_R 3wrp_A 1rcs_A* 1wrs_R* 1wrt_R 2xdi_A 3ssx_R* 1trr_A* 1tro_A* | Back alignment and structure |
|---|
| >3h5t_A Transcriptional regulator, LACI family; DNA-dependent, protein structure initiative II(PSI II), NYSGXRC, 11232D), structural genomics; 2.53A {Corynebacterium glutamicum} | Back alignment and structure |
|---|
| >1jko_C HIN recombinase, DNA-invertase HIN; water-mediated recognition, protein-DNA complex, A10G mutant, DNA binding protein/DNA complex; 2.24A {Synthetic} SCOP: a.4.1.2 PDB: 1ijw_C* 1jj6_C* 1jj8_C* 1hcr_A 1jkp_C 1jkq_C 1jkr_C | Back alignment and structure |
|---|
| >2w7n_A TRFB transcriptional repressor protein; INCP, plasmid, repressor, DNA-binding, transcription/DNA; HET: BRU; 1.85A {Escherichia coli} | Back alignment and structure |
|---|
| >2ovg_A Phage lambda CRO; transcription factor, helix-turn-helix, bacteriophage, flexi transcription; 1.35A {Enterobacteria phage lambda} PDB: 2ecs_A 1cop_D 4cro_A* 5cro_O 1orc_A 2orc_A 2a63_A 1d1l_A 6cro_A* 3orc_A* 1d1m_B | Back alignment and structure |
|---|
| >2o20_A Catabolite control protein A; CCPA, transcriptional regulator, helix-turn-helix, transcrip; 1.90A {Lactococcus lactis} | Back alignment and structure |
|---|
| >1j9i_A GPNU1 DBD;, terminase small subunit; DNA binding domain, homodimer, viral assembly, winged helix-turn-helix, viral protein; NMR {Enterobacteria phage lambda} SCOP: a.6.1.5 | Back alignment and structure |
|---|
| >3dbi_A Sugar-binding transcriptional regulator, LACI FAM; structural genomics, sugar-binding transcriptional regulator structure initiative, PSI-2; HET: MSE; 2.45A {Escherichia coli K12} | Back alignment and structure |
|---|
| >2csf_A DNA-binding protein SATB2; CUT domain, special AT-rich sequence-binding protein 2, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.35.1.7 | Back alignment and structure |
|---|
| >3h5o_A Transcriptional regulator GNTR; transcription regulator, GNTR,chromobacterium violaceum, PSI, SGX, DNA-binding; 2.30A {Chromobacterium violaceum} | Back alignment and structure |
|---|
| >1x3u_A Transcriptional regulatory protein FIXJ; helix-turn-helix; NMR {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >3e3m_A Transcriptional regulator, LACI family; structural genomics, DNA-binding, plasmid, transcription regulation, PSI-2; 1.60A {Silicibacter pomeroyi} | Back alignment and structure |
|---|
| >3jvd_A Transcriptional regulators; structural genomics, PSI-2, sugar binding protein, transcrip regulation, protein structure initiative; 2.30A {Corynebacterium glutamicum} | Back alignment and structure |
|---|
| >3me5_A Cytosine-specific methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 1.75A {Shigella flexneri 2A} PDB: 3lx6_A | Back alignment and structure |
|---|
| >3ctp_A Periplasmic binding protein/LACI transcriptional; structural genomics, protein structure initiative; HET: XLF; 1.41A {Alkaliphilus metalliredigens} | Back alignment and structure |
|---|
| >3e7l_A Transcriptional regulator (NTRC family); sigma43 activator, AAA+ ATPase, response regulator, transcriptional activator, ATP-binding; 2.25A {Aquifex aeolicus} PDB: 4fth_A | Back alignment and structure |
|---|
| >2jn6_A Protein CGL2762, transposase; GFT PSI-2, protein structure, structural genomics, protein structure initiative; NMR {Corynebacterium glutamicum} SCOP: a.4.1.19 | Back alignment and structure |
|---|
| >1jye_A Lactose operon repressor; gene regulation, protein stability, protein DNA-binding, transcription; 1.70A {Escherichia coli} SCOP: c.93.1.1 PDB: 1lbi_A 1lbg_A* 1lbh_A 1jyf_A 3edc_A 1efa_A* 1jwl_A* 2pe5_A* 1tlf_A* 2p9h_A* 2paf_A* 1cjg_A* 1l1m_A 1osl_A 2kei_A* 2kej_A* 2kek_A* 2bjc_A 1lqc_A 1lcc_A* ... | Back alignment and structure |
|---|
| >1qgp_A Protein (double stranded RNA adenosine deaminase); Z-alpha-Z-DNA binding domain, RNA-editing, Z-DNA recognition, ADAR1, helix- turn-helix; NMR {Homo sapiens} SCOP: a.4.5.19 | Back alignment and structure |
|---|
| >2elh_A CG11849-PA, LD40883P; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Drosophila melanogaster} | Back alignment and structure |
|---|
| >2htj_A P fimbrial regulatory protein KS71A; winged helix-turn-helix, PAP PILI, transcription activator; NMR {Escherichia coli} SCOP: a.4.5.73 | Back alignment and structure |
|---|
| >1qbj_A Protein (double-stranded RNA specific adenosine D (ADAR1)); protein-Z-DNA complex, hydrolase-DNA complex; HET: DNA; 2.10A {Homo sapiens} SCOP: a.4.5.19 PDB: 3f21_A* 3f22_A* 3f23_A* 3irr_A* 3irq_D* 2gxb_A 2acj_A 2l54_A | Back alignment and structure |
|---|
| >2glo_A Brinker CG9653-PA; protein-DNA complex, helix-turn-helix motif, transcription/DNA complex; NMR {Drosophila melanogaster} | Back alignment and structure |
|---|
| >3bil_A Probable LACI-family transcriptional regulator; structural genomics, unknown function, PSI-2, protein structure initiative; 2.50A {Corynebacterium glutamicum atcc 13032} | Back alignment and structure |
|---|
| >1z4h_A TORI, TOR inhibition protein; winged helix, reverse turn, protein binding, DNA binding protein; NMR {Escherichia coli} | Back alignment and structure |
|---|
| >1g2h_A Transcriptional regulatory protein TYRR homolog; protein structure, , DNA-binding domain, helix- turn-helix motif; NMR {Haemophilus influenzae} SCOP: a.4.1.12 | Back alignment and structure |
|---|
| >1hlv_A CENP-B, major centromere autoantigen B; helix-turn-helix, protein-DNA complex, riken structural genomics/proteomics initiative, RSGI; 2.50A {Homo sapiens} SCOP: a.4.1.7 a.4.1.7 PDB: 1bw6_A | Back alignment and structure |
|---|
| >2p7v_B Sigma-70, RNA polymerase sigma factor RPOD; RSD, regulator of sigma 70, sigma 70 domain 4, transcription, regulation, helix-turn-helix; 2.60A {Escherichia coli} SCOP: a.4.13.2 | Back alignment and structure |
|---|
| >1e3o_C Octamer-binding transcription factor 1; transcription factor, POU domain, dimer, DNA binding; 1.9A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 PDB: 1gt0_C 1hf0_A* 1cqt_A* 1o4x_A 1oct_C* 1pou_A 1pog_A 1hdp_A | Back alignment and structure |
|---|
| >1pdn_C Protein (PRD paired); protein-DNA complex, double helix, PAX, paired domain, DNA-binding protein, gene regulation/DNA complex; HET: DNA; 2.50A {Drosophila melanogaster} SCOP: a.4.1.5 | Back alignment and structure |
|---|
| >2jml_A DNA binding domain/transcriptional regulator; anti-repressor, MERR, carotenogenesis; HET: DNA; NMR {Myxococcus xanthus} | Back alignment and structure |
|---|
| >1u78_A TC3 transposase, transposable element TC3 transposase; transposon DNA, bipartite DNA-binding, HTH- motif, DNA binding protein/DNA complex; 2.69A {Caenorhabditis elegans} SCOP: a.4.1.2 a.4.1.2 | Back alignment and structure |
|---|
| >2heo_A Z-DNA binding protein 1; protein DLM1-Z-DNA complex, immune system-DNA complex; 1.70A {Mus musculus} PDB: 1j75_A | Back alignment and structure |
|---|
| >2o8x_A Probable RNA polymerase sigma-C factor; promoter recognition, transcription regulation, helix-turn-H motif, transcription; 3.00A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >2jpc_A SSRB; DNA binding protein, structural genomics, PSI-2, protein structure initiative; NMR {Salmonella typhimurium} | Back alignment and structure |
|---|
| >2xsd_C POU domain, class 3, transcription factor 1; transcription-DNA complex, SOX; 2.05A {Mus musculus} | Back alignment and structure |
|---|
| >1au7_A Protein PIT-1, GHF-1; complex (DNA-binding protein/DNA), pituitary, CPHD, POU domain, transcription factor, transcription/DNA complex; HET: DNA; 2.30A {Rattus norvegicus} SCOP: a.4.1.1 a.35.1.1 | Back alignment and structure |
|---|
| >1r71_A Transcriptional repressor protein KORB; INCP, plasmid partitioning, protein-DNA complex, heilx-turn- helix motif, transcription factor; HET: BRU; 2.20A {Escherichia coli} SCOP: a.4.14.1 | Back alignment and structure |
|---|
| >1je8_A Nitrate/nitrite response regulator protein NARL; protein-DNA complex, two-component response regulator, helix-turn-helix, DNA bending; 2.12A {Escherichia coli} SCOP: a.4.6.2 PDB: 1zg1_A 1zg5_A | Back alignment and structure |
|---|
| >3hug_A RNA polymerase sigma factor; ECF sigma factor, zinc binding anti-sigma factor, oxidative transcription regulation; 2.35A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >1ntc_A Protein (nitrogen regulation protein (NTRC)); helix-turn-helix, FIS, four-helix bundle, transcription regulation; NMR {Salmonella typhimurium} SCOP: a.4.1.12 | Back alignment and structure |
|---|
| >2vz4_A Tipal, HTH-type transcriptional activator TIPA; transcription, resistance, antibiotic; 2.90A {Streptomyces lividans} | Back alignment and structure |
|---|
| >1k78_A Paired box protein PAX5; paired domain, ETS domain, transcription factor, transcription/DNA complex; 2.25A {Homo sapiens} SCOP: a.4.1.5 a.4.1.5 PDB: 1mdm_A 6pax_A | Back alignment and structure |
|---|
| >2dk5_A DNA-directed RNA polymerase III 39 kDa polypeptide; structural genomics, winged helix domain, NPPSFA; NMR {Homo sapiens} SCOP: a.4.5.85 | Back alignment and structure |
|---|
| >1ku3_A Sigma factor SIGA; helix-turn-helix, transcription; 1.80A {Thermus aquaticus} SCOP: a.4.13.2 PDB: 1ku7_A 1rio_H 3n97_A* | Back alignment and structure |
|---|
| >1xn7_A Hypothetical protein YHGG; alpha+beta, GFT structural genomics, protein structure initiative, PSI, NESG; NMR {Escherichia coli} SCOP: a.4.5.62 | Back alignment and structure |
|---|
| >2w48_A Sorbitol operon regulator; SORC, activator, repressor, DNA-binding, transcription, transcription regulator, transcription regulation; 3.20A {Klebsiella pneumoniae} | Back alignment and structure |
|---|
| >3ulq_B Transcriptional regulatory protein COMA; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} PDB: 2krf_A | Back alignment and structure |
|---|
| >2ox6_A Hypothetical protein SO3848; structural genomics, PSI-2, MCSG, Pro structure initiative; 1.70A {Shewanella oneidensis} SCOP: a.35.1.6 | Back alignment and structure |
|---|
| >1vz0_A PARB, chromosome partitioning protein PARB; nuclear protein, chromosome segregation, DNA-binding, helix-turn-helix; 2.3A {Thermus thermophilus} SCOP: a.4.14.1 d.268.1.1 | Back alignment and structure |
|---|
| >1x2l_A CUT-like 2, homeobox protein CUX-2; CUT domain, human homeobox protein CUX-2, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.35.1.7 | Back alignment and structure |
|---|
| >1wh6_A CUT-like 2, homeobox protein CUX-2; CUT domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, transcription; NMR {Homo sapiens} SCOP: a.35.1.7 | Back alignment and structure |
|---|
| >1fse_A GERE; helix-turn-helix DNA-binding protein transcriptional regulat transcription; 2.05A {Bacillus subtilis} SCOP: a.4.6.2 | Back alignment and structure |
|---|
| >3kor_A Possible Trp repressor; putative DNA-binding Trp repressor, TRPR like protein, struc genomics, transcription; 1.60A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >2o4a_A DNA-binding protein SATB1; protein-DNA complex, transcription, transcription/DNA complex; HET: DNA; 1.75A {Homo sapiens} SCOP: a.35.1.7 PDB: 2o49_A* | Back alignment and structure |
|---|
| >1eto_A FIS, factor for inversion stimulation; transcriptional activation region, DNA-binding protein, transcription activator; 1.90A {Escherichia coli} SCOP: a.4.1.12 PDB: 1etq_A 1ety_A 1fia_A 3fis_A 3iv5_A* 3jr9_A* 3jra_A* 3jrb_A* 3jrc_A* 3jrd_A* 3jre_A* 3jrf_A* 3jrg_A* 3jrh_A* 3jri_A* 1f36_A 1etv_A 1etk_A 1etx_A 1fip_A ... | Back alignment and structure |
|---|
| >1tty_A Sigma-A, RNA polymerase sigma factor RPOD; helix-turn-helix, transcription; NMR {Thermotoga maritima} SCOP: a.4.13.2 | Back alignment and structure |
|---|
| >1sfx_A Conserved hypothetical protein AF2008; structural genomics, HTH MOT protein structure initiative, midwest center for structural genomics; 1.55A {Archaeoglobus fulgidus} SCOP: a.4.5.50 | Back alignment and structure |
|---|
| >1r8d_A Transcription activator MTAN; protein-DNA complex, transcription/DNA complex; 2.70A {Bacillus subtilis} SCOP: a.6.1.3 PDB: 1jbg_A | Back alignment and structure |
|---|
| >2d1h_A ST1889, 109AA long hypothetical transcriptional regulator; helix-turn-helix, intermolecular and intramolecular S-S bond structural genomics; 2.05A {Sulfolobus tokodaii} SCOP: a.4.5.50 | Back alignment and structure |
|---|
| >2k27_A Paired box protein PAX-8; paired domain, solution structure, triple frequency, 3D NMR, induced FIT, alternative splicing, developmental protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2rn7_A IS629 ORFA; helix, all alpha, unknown function, structural genomics, PSI-2, protein structure initiative; NMR {Shigella flexneri} | Back alignment and structure |
|---|
| >3r0a_A Putative transcriptional regulator; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.31A {Methanosarcina mazei} | Back alignment and structure |
|---|
| >1oyi_A Double-stranded RNA-binding protein; (alpha+beta) helix-turn-helix, viral protein; NMR {Vaccinia virus} SCOP: a.4.5.19 | Back alignment and structure |
|---|
| >3c57_A Two component transcriptional regulatory protein; response regulator, two-component regulatory system, DNA-BIN protein; 1.70A {Mycobacterium tuberculosis} PDB: 1zlk_A 1zlj_A | Back alignment and structure |
|---|
| >1s7o_A Hypothetical UPF0122 protein SPY1201/SPYM3_0842/SPS1042/SPYM18_1152; putative DNA binding protein, structural genomics; 2.31A {Streptococcus pyogenes serotype M3} SCOP: a.4.13.3 | Back alignment and structure |
|---|
| >2k02_A Ferrous iron transport protein C; FEOC, iron-sulfur, metal-binding, metal binding protein; NMR {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
| >3cuo_A Uncharacterized HTH-type transcriptional regulato; DNA-binding transcriptional regulator, structural genomics, MCSG; 2.00A {Escherichia coli K12} | Back alignment and structure |
|---|
| >2o3f_A Putative HTH-type transcriptional regulator YBBH; APC85504, putative transcriptional regulator YBBH; HET: MLY; 1.75A {Bacillus subtilis} SCOP: a.4.1.20 | Back alignment and structure |
|---|
| >2cfx_A HTH-type transcriptional regulator LRPC; transcriptional regulation, DNA binding, FFRP; 2.4A {Bacillus subtilis} SCOP: a.4.5.32 d.58.4.2 | Back alignment and structure |
|---|
| >3d1n_I POU domain, class 6, transcription factor 1; protein-DNA complex, helix-turn-helix (HTH), DNA-binding, homeobox, nucleus, transcription regulation; 2.51A {Homo sapiens} | Back alignment and structure |
|---|
| >2rnj_A Response regulator protein VRAR; HTH LUXR-type domain, DNA binding domain, activator, antibiotic resistance, cytoplasm, DNA-binding; NMR {Staphylococcus aureus} | Back alignment and structure |
|---|
| >1wiz_A DNA-binding protein SATB2; helix bundle, KIAA1034 protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: a.35.1.7 | Back alignment and structure |
|---|
| >3l1p_A POU domain, class 5, transcription factor 1; POU, transcription factor DNA complex, pore, stem cells; HET: DNA; 2.80A {Mus musculus} PDB: 1ocp_A | Back alignment and structure |
|---|
| >1p4w_A RCSB; solution structure, DNA binding domain, DNA binding protein; NMR {Erwinia amylovora} SCOP: a.4.6.2 | Back alignment and structure |
|---|
| >2jt1_A PEFI protein; solution structure, winged helix-turn-helix, transcripti regulatory protein, structural genomics, PSI-2; NMR {Salmonella typhimurium LT2} | Back alignment and structure |
|---|
| >2w25_A Probable transcriptional regulatory protein; transcription regulation, mutant, RV3291C, Glu104Ala, DNA-binding; 2.15A {Mycobacterium tuberculosis} PDB: 2vbw_A* 2vbx_A* 2vby_A* 2vbz_A* 2vc0_A 2vc1_A 2w24_A 2ivm_A 2w29_A 2qz8_A | Back alignment and structure |
|---|
| >3frw_A Putative Trp repressor protein; structural genomics, APC21159, PSI-2, P structure initiative; 2.05A {Ruminococcus obeum atcc 29174} PDB: 3g1c_A | Back alignment and structure |
|---|
| >2p5k_A Arginine repressor; DNA-binding domain, winged helix-turn-helix (WHTH), DNA binding protein; 1.00A {Bacillus subtilis} SCOP: a.4.5.3 PDB: 2p5l_C* | Back alignment and structure |
|---|
| >2cg4_A Regulatory protein ASNC; DNA binding, FFRP, LRP family, transcription, DNA- binding, transcription regulation; 2.4A {Escherichia coli} SCOP: a.4.5.32 d.58.4.2 | Back alignment and structure |
|---|
| >2pg4_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, DNA binding protein; HET: MSE CIT; 2.21A {Aeropyrum pernix} SCOP: a.4.5.48 | Back alignment and structure |
|---|
| >2p5v_A Transcriptional regulator, LRP/ASNC family; NMB0573, structu genomics; 1.99A {Neisseria meningitidis} PDB: 2p6s_A 2p6t_A | Back alignment and structure |
|---|
| >1ub9_A Hypothetical protein PH1061; helix-turn-helix motif, winged helix motif, structural genom transcription; 2.05A {Pyrococcus horikoshii} SCOP: a.4.5.28 | Back alignment and structure |
|---|
| >2dbb_A Putative HTH-type transcriptional regulator PH006; ASNC family, helix-turn-helix (HTH) domain, structural genom NPPSFA; 2.00A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >1q06_A Transcriptional regulator CUER; MERR family transcriptional regulator, copper efflux regulator; 2.07A {Escherichia coli} SCOP: a.6.1.3 PDB: 1q05_A 1q07_A | Back alignment and structure |
|---|
| >1xsv_A Hypothetical UPF0122 protein SAV1236; helix-turn-helix, putative DNA-binding protein, signal recognition particle, unknown function; 1.70A {Staphylococcus aureus subsp} SCOP: a.4.13.3 | Back alignment and structure |
|---|
| >1y0u_A Arsenical resistance operon repressor, putative; structural genomics, protein structure initiative, PSI; HET: MSE; 1.60A {Archaeoglobus fulgidus} SCOP: a.4.5.5 | Back alignment and structure |
|---|
| >3bpv_A Transcriptional regulator; MARR, DNA binding, transcription factor, winged helix motif, DNA-binding; 1.40A {Methanobacterium thermoautotrophicum} PDB: 3bpx_A* | Back alignment and structure |
|---|
| >3hh0_A Transcriptional regulator, MERR family; protein structure initiative II(PSI II), NYSGXRC, 11183J, structural genomics; 2.67A {Bacillus cereus atcc 14579} | Back alignment and structure |
|---|
| >3bdd_A Regulatory protein MARR; putative multiple antibiotic-resistance repressor, structura genomics, joint center for structural genomics, JCSG; 2.20A {Streptococcus suis} | Back alignment and structure |
|---|
| >3nrv_A Putative transcriptional regulator (MARR/EMRR FAM; PSI-2, protein structure initiati structural genomics; HET: MSE; 2.00A {Acinetobacter SP} | Back alignment and structure |
|---|
| >3iwf_A Transcription regulator RPIR family; transcriptional, N-terminal, PSI, MCSG, structural genomics, midwest center structural genomics; 1.40A {Staphylococcus epidermidis} | Back alignment and structure |
|---|
| >3ech_A MEXR, multidrug resistance operon repressor; winged helix, helix-turn-helix, protein-peptide complex; 1.80A {Pseudomonas aeruginosa} SCOP: a.4.5.28 PDB: 1lnw_A 3mex_A | Back alignment and structure |
|---|
| >3g3z_A NMB1585, transcriptional regulator, MARR family; transcription factor, structur genomics, oxford protein production facility; 2.10A {Neisseria meningitidis serogroup B} | Back alignment and structure |
|---|
| >2cyy_A Putative HTH-type transcriptional regulator PH151; structural genomics, pyrococcus horikosii OT3, NPPSFA; HET: MSE GLN; 1.80A {Pyrococcus horikoshii} SCOP: a.4.5.32 d.58.4.2 | Back alignment and structure |
|---|
| >2pn6_A ST1022, 150AA long hypothetical transcriptional regulator; LRP/ASNC family Gln binding, structural genomics, NPPSFA; HET: GLN; 1.44A {Sulfolobus tokodaii} PDB: 2efn_A* 2e7x_A* 2e7w_A* 2yx4_A* 2efq_A* 2pmh_A* 2yx7_A* 2efp_A* 2efo_A* | Back alignment and structure |
|---|
| >1r1u_A CZRA, repressor protein; zinc, DNA binding, transcriptional regulation, winged HTH protein, transcription repressor; 2.00A {Staphylococcus aureus} SCOP: a.4.5.5 PDB: 1r1v_A 2kjb_A 2kjc_A | Back alignment and structure |
|---|
| >3t72_q RNA polymerase sigma factor RPOD, DNA-directed RN polymerase subunit beta; winged-helix motif, transcription activation, DNA-binding; 4.33A {Escherichia coli} PDB: 1tlh_B | Back alignment and structure |
|---|
| >2ia0_A Putative HTH-type transcriptional regulator PF086; ASNC, PSI, structural genomics, southeast collaboratory for structural genomics; 2.37A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >2nnn_A Probable transcriptional regulator; structural genomics, PSI-2, protein structure initiative, M center for structural genomics, MCSG; 2.40A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >1u2w_A CADC repressor, cadmium efflux system accessory protein; LEAD, SOFT metal ION resistance, ARSR/SM family, DNA binding protein; 1.90A {Staphylococcus aureus} SCOP: a.4.5.5 PDB: 3f72_A | Back alignment and structure |
|---|
| >3mzy_A RNA polymerase sigma-H factor; PSI, MCSG, structural genomics, midwest center for structura genomics, protein structure initiative; 2.50A {Fusobacterium nucleatum subsp} | Back alignment and structure |
|---|
| >1i1g_A Transcriptional regulator LRPA; helix-turn-helix, LRP/ASNC family; 2.90A {Pyrococcus furiosus} SCOP: a.4.5.32 d.58.4.2 | Back alignment and structure |
|---|
| >2hr3_A Probable transcriptional regulator; MCSG, structural genomics, PSI-2, protein structure initiati midwest center for structural genomics; 2.40A {Pseudomonas aeruginosa} SCOP: a.4.5.28 | Back alignment and structure |
|---|
| >3oop_A LIN2960 protein; protein structure initiative, PSI-2, structural genomics, MI center for structural genomics, MCSG, unknown function; 1.78A {Listeria innocua} | Back alignment and structure |
|---|
| >3gp4_A Transcriptional regulator, MERR family; structural genomics, DNA-BI transcription regulator, PSI-2; 1.85A {Listeria monocytogenes str} | Back alignment and structure |
|---|
| >2wte_A CSA3; antiviral protein, viral resistance, winged helix-turn-helix prnai nucleotide-binding domain; HET: MSE; 1.80A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >2oz6_A Virulence factor regulator; winged helix, helix-turn-helix, transcription factor, CAMP-B proteins, CAMP receptor protein; HET: CMP; 2.80A {Pseudomonas aeruginosa} SCOP: a.4.5.4 b.82.3.2 | Back alignment and structure |
|---|
| >2oqg_A Possible transcriptional regulator, ARSR family P; winged-helix-turn-helix, structural genomics, PSI-2, protein structure initiative; 1.54A {Rhodococcus SP} | Back alignment and structure |
|---|
| >2a61_A Transcriptional regulator TM0710; APC4350, MCSG, midwest center for structural genomics, PSI, protein structure initiative, MARR; 1.80A {Thermotoga maritima} SCOP: a.4.5.28 | Back alignment and structure |
|---|
| >2rdp_A Putative transcriptional regulator MARR; PFAM PF01047, winged-helix binding motif, structural genomics, PSI-2; 2.30A {Geobacillus stearothermophilus} | Back alignment and structure |
|---|
| >2lkp_A Transcriptional regulator, ARSR family; symmetric homodimer, NI(II) binding protein, DNA binding Pro transcription regulator; NMR {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >2fa5_A Transcriptional regulator MARR/EMRR family; multiple antibiotics resistance repressor, XCC structural genomics, X-RAY diffraction; 1.80A {Xanthomonas campestris} | Back alignment and structure |
|---|
| >3ryp_A Catabolite gene activator; CAMP receptor protein (CRP), allostery, DNA binding cyclic A transcription regulator; HET: CMP; 1.60A {Escherichia coli} PDB: 2cgp_A* 3hif_A 1g6n_A* 3ryr_A* 1i5z_A* 1j59_A* 1lb2_A* 1run_A* 1zrc_A* 1zrd_A* 1zre_A* 1zrf_A* 2gzw_A* 2wc2_A 3iyd_G* 3n4m_A* 3qop_A* 3rdi_A* 3rou_A* 3rpq_A* ... | Back alignment and structure |
|---|
| >1on2_A Transcriptional regulator MNTR; helix-turn-helix, DNA-binding protein, metalloregulatory protein; 1.61A {Bacillus subtilis} SCOP: a.4.5.24 a.76.1.1 PDB: 2ev0_A 1on1_A 2ev5_A 2ev6_A* 2f5c_A 2f5d_A 2f5e_A 2f5f_A 2hyf_A* 2hyg_D 3r60_A* 3r61_A* | Back alignment and structure |
|---|
| >2zkz_A Transcriptional repressor PAGR; protein-DNA, HTH motif, dimer, DN binding, transcription regulation; 2.00A {Bacillus anthracis} | Back alignment and structure |
|---|
| >3mky_B Protein SOPB; partition, F plasmid, centromere, DNA binding protein- complex; HET: DNA; 2.86A {Escherichia coli} PDB: 3mkw_B* 3mkz_A* | Back alignment and structure |
|---|
| >3bro_A Transcriptional regulator; helix_TURN_helix, multiple antibiotic resistance protein (MA structural genomics, PSI-2, protein structure initiative; HET: MSE; 2.04A {Oenococcus oeni} SCOP: a.4.5.28 | Back alignment and structure |
|---|
| >2zcw_A TTHA1359, transcriptional regulator, FNR/CRP family; stationary phase, DNA-binding, transcription regulation; 1.50A {Thermus thermophilus} | Back alignment and structure |
|---|
| >4hbl_A Transcriptional regulator, MARR family; HTH, transcription factor, DNA binding; 2.50A {Staphylococcus epidermidis} | Back alignment and structure |
|---|
| >2fbi_A Probable transcriptional regulator; MARR, APC5816, structural genomic protein structure initiative; 2.10A {Pseudomonas aeruginosa} SCOP: a.4.5.28 | Back alignment and structure |
|---|
| >2fbh_A Transcriptional regulator PA3341; MARR, transcription regulator, APC5857, structural genomics, protein structure initiative; 1.80A {Pseudomonas aeruginosa} SCOP: a.4.5.28 | Back alignment and structure |
|---|
| >2eth_A Transcriptional regulator, putative, MAR family; MARR family, structural genomics, joint center for structura genomics, JCSG; 2.30A {Thermotoga maritima} SCOP: a.4.5.28 | Back alignment and structure |
|---|
| >2f07_A YVDT; helix-turn-helix, transcription; HET: BTB; 2.30A {Bacillus subtilis subsp} | Back alignment and structure |
|---|
| >1jgs_A Multiple antibiotic resistance protein MARR; transcription regulation, DNA-binding, repressor, transcription; HET: SAL; 2.30A {Escherichia coli} SCOP: a.4.5.28 | Back alignment and structure |
|---|
| >1j5y_A Transcriptional regulator, biotin repressor famil; structural genomics, TM1602, BIOT repressor family, JCSG, conserved hypothetical protein; 2.30A {Thermotoga maritima} SCOP: a.4.5.1 d.94.2.1 | Back alignment and structure |
|---|
| >3s2w_A Transcriptional regulator, MARR family; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics; 2.45A {Methanosarcina mazei} | Back alignment and structure |
|---|
| >3eco_A MEPR; mutlidrug efflux pump regulator winged helix-turn-helix motif, DNA-binding, transcription, transcription regulation; 2.40A {Staphylococcus aureus} SCOP: a.4.5.0 | Back alignment and structure |
|---|
| >3dv8_A Transcriptional regulator, CRP/FNR family; cyclic nucleotide-binding domain, structural genomics, joint for structural genomics; 2.55A {Eubacterium rectale atcc 33656} | Back alignment and structure |
|---|
| >3iwz_A CAP-like, catabolite activation-like protein; XCC, pathogenicity, CRP, CLP, C-DI-GMP receptor, quorum SENS binding, transcription; 2.30A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >3b02_A Transcriptional regulator, CRP family; structural genomics, riken structural genomics/proteomics in RSGI; 1.92A {Thermus thermophilus} PDB: 2zdb_A | Back alignment and structure |
|---|
| >3e97_A Transcriptional regulator, CRP/FNR family; YP_604437.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.86A {Deinococcus geothermalis dsm 11300} | Back alignment and structure |
|---|
| >3i4p_A Transcriptional regulator, ASNC family; PSI, structural genom protein structure initiative, midwest center for structural genomics; 2.30A {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >3kkc_A TETR family transcriptional regulator; APC20805, structural genomics, PSI-2, protein structure initiative; 2.50A {Streptococcus agalactiae 2603V} | Back alignment and structure |
|---|
| >2qww_A Transcriptional regulator, MARR family; YP_013417.1, multiple antibiotic-resistance repressor (MARR) structural genomics; HET: MSE; 2.07A {Listeria monocytogenes str} | Back alignment and structure |
|---|
| >3mn2_A Probable ARAC family transcriptional regulator; structural genomics, PSI-2, protein structure initiative; 1.80A {Rhodopseudomonas palustris} | Back alignment and structure |
|---|
| >2fmy_A COOA, carbon monoxide oxidation system transcription RE COOA-1; DNA transcription regulator, DNA binding protein; HET: HEM; 2.20A {Carboxydothermus hydrogenoformans} PDB: 2hkx_A* | Back alignment and structure |
|---|
| >4ev0_A Transcription regulator, CRP family; CAMP binding, winged helix-turn-helix motif, DNA binding, transcription activator; HET: CMP; 2.40A {Thermus thermophilus} | Back alignment and structure |
|---|
| >1lj9_A Transcriptional regulator SLYA; HTH DNA binding protein, structural genomics, PSI, protein structure initiative; 1.60A {Enterococcus faecalis} SCOP: a.4.5.28 | Back alignment and structure |
|---|
| >3d0s_A Transcriptional regulatory protein; CAMP receptor protein (CRP), dimer, inactive(APO, unliganded allostery, DNA binding, cyclic AMP; 2.00A {Mycobacterium tuberculosis} PDB: 3i54_A* 3i59_A* 3mzh_A* 3h3u_A* 3r6s_A* | Back alignment and structure |
|---|
| >1ft9_A Carbon monoxide oxidation system transcription regulator; heme sensor, catabolite gene activator protein; HET: HEM; 2.60A {Rhodospirillum rubrum} SCOP: a.4.5.4 b.82.3.1 | Back alignment and structure |
|---|
| >1wh8_A CUT-like 2, homeobox protein CUX-2; CUT domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, transcription; NMR {Homo sapiens} SCOP: a.35.1.7 | Back alignment and structure |
|---|
| >3kp7_A Transcriptional regulator TCAR; multiple drug resistance, biofilm, transcription regulation, binding, transcription regulator; 2.30A {Staphylococcus epidermidis RP62A} PDB: 3kp3_A* 3kp4_A* 3kp5_A* 3kp2_A* 3kp6_A | Back alignment and structure |
|---|
| >2qvo_A Uncharacterized protein AF_1382; PSI, structural genomics, southeast collaboratory for structural genomics; 1.85A {Archaeoglobus fulgidus dsm 4304} PDB: 3o3k_A 3ov8_A | Back alignment and structure |
|---|
| >1z05_A Transcriptional regulator, ROK family; structural genomics, protein structure initiative, midwest center for structural genomics; 2.00A {Vibrio cholerae o1 biovar eltor} SCOP: a.4.5.63 c.55.1.10 c.55.1.10 | Back alignment and structure |
|---|
| >3k0l_A Repressor protein; helix-turn-helix, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.35A {Acinetobacter SP} | Back alignment and structure |
|---|
| >3qkx_A Uncharacterized HTH-type transcriptional regulato; structural genomics, joint center for structural genomics; HET: MSE; 2.35A {Haemophilus influenzae} | Back alignment and structure |
|---|
| >2zhg_A Redox-sensitive transcriptional activator SOXR; oxidative stress, MERR family, activator; HET: DNA; 2.80A {Escherichia coli} PDB: 2zhh_A | Back alignment and structure |
|---|
| >1z6r_A MLC protein; transcriptional repressor, ROK family protein, DNA binding P helix-turn-helix, phosphotransferase system; 2.70A {Escherichia coli} SCOP: a.4.5.63 c.55.1.10 c.55.1.10 PDB: 3bp8_A | Back alignment and structure |
|---|
| >1q1h_A TFE, transcription factor E, TFE; TFIIE, transcription initiation, preinitiation complex, RNA polymerase II, transcription bubble; 2.90A {Sulfolobus solfataricus} SCOP: a.4.5.41 | Back alignment and structure |
|---|
| >2r0q_C Putative transposon TN552 DNA-invertase BIN3; site-specific recombinase, resolvase, DNA-binding protein, protein-DNA complex, DNA integration, DNA invertase, DNA recombination; 3.20A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >3bqz_B HTH-type transcriptional regulator QACR; multidrug resistance, TETR, malachite green, DNA- binding, plasmid, repressor; HET: MGR; 2.17A {Staphylococcus aureus} PDB: 3br1_B* 3br3_B* 3pm1_B* 1rkw_B* 1jt0_A* 1jty_B* 1jum_B* 1jup_B* 1jtx_B* 1jus_B* 2dtz_B 2gby_B* 2hq5_B 3br2_B* 3br5_B* 1qvt_B* 1qvu_B* 3br0_B* 3br6_B* 1jt6_B* ... | Back alignment and structure |
|---|
| >3gpv_A Transcriptional regulator, MERR family; protein structure initiative II(PSI II), NYSGXRC, structural genomics; 1.90A {Bacillus thuringiensis serovarkonkukian} | Back alignment and structure |
|---|
| >2pex_A Transcriptional regulator OHRR; transcription regulator; 1.90A {Xanthomonas campestris} PDB: 2pfb_A | Back alignment and structure |
|---|
| >1zyb_A Transcription regulator, CRP family; NP_813211.1, structural genomics, joint center for structura genomics, JCSG; 2.15A {Bacteroides thetaiotaomicron} SCOP: a.4.5.4 b.82.3.2 | Back alignment and structure |
|---|
| >3bj6_A Transcriptional regulator, MARR family; helix-turn-helix, trasnscription regulator, STR genomics, PSI-2, protein structure initiative; 2.01A {Silicibacter pomeroyi dss-3} | Back alignment and structure |
|---|
| >3lsg_A Two-component response regulator YESN; structural genomics, PSI-2, protein structure initiative, MCSG; 2.05A {Fusobacterium nucleatum} | Back alignment and structure |
|---|
| >2nyx_A Probable transcriptional regulatory protein, RV14; alpha/beta, structural genomics, PSI-2; 2.30A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >1u8b_A ADA polyprotein; protein-DNA complex, methylation, zinc, helix-turn-helix, metal binding protein/DNA complex; 2.10A {Escherichia coli} PDB: 1zgw_A* 1wpk_A* 1adn_A 1eyf_A | Back alignment and structure |
|---|
| >2hoe_A N-acetylglucosamine kinase; TM1224, structural genomics, PSI-2, protein structure initiative, joint center structural genomics, JCSG; 2.46A {Thermotoga maritima} SCOP: a.4.5.63 c.55.1.10 c.55.1.10 | Back alignment and structure |
|---|
| >3oio_A Transcriptional regulator (ARAC-type DNA-binding containing proteins); PSI-2, midwest center for structural genomics; 1.65A {Chromobacterium violaceum} | Back alignment and structure |
|---|
| >2gxg_A 146AA long hypothetical transcriptional regulator; winged helix; 1.45A {Sulfolobus tokodaii} PDB: 2eb7_A 2yr2_A 3gez_A 3gf2_A* 3gfi_A 3gfm_A 3gfj_A 3gfl_A | Back alignment and structure |
|---|
| >2k9s_A Arabinose operon regulatory protein; activator, arabinose catabolism, carbohydrate metabolism, cytoplasm, DNA-binding, repressor, transcription; NMR {Escherichia coli} | Back alignment and structure |
|---|
| >1or7_A Sigma-24, RNA polymerase sigma-E factor; regulation, DNA-binding, transmembrane, transcription; 2.00A {Escherichia coli} SCOP: a.4.13.2 a.177.1.1 PDB: 2h27_A | Back alignment and structure |
|---|
| >3la7_A Global nitrogen regulator; activator, DNA-binding, transcription, transcription regulation; HET: BOG; 1.90A {Anabaena} PDB: 3la2_A* 3la3_A* 2xko_A* 2xgx_A* 2xhk_A* 2xkp_A* | Back alignment and structure |
|---|
| >3cjn_A Transcriptional regulator, MARR family; silicibacter pomeroy structural genomics, PSI-2, protein structure initiative; 1.95A {Silicibacter pomeroyi dss-3} | Back alignment and structure |
|---|
| >1gdt_A GD resolvase, protein (gamma delta resolvase); protein-DNA complex, double helix, overhanging base, DNA binding protein/DNA complex; 3.00A {Escherichia coli} SCOP: a.4.1.2 c.53.1.1 PDB: 1zr4_A 1zr2_A 2gm4_A 1res_A 1ret_A | Back alignment and structure |
|---|
| >1rp3_A RNA polymerase sigma factor sigma-28 (FLIA); transcription; 2.30A {Aquifex aeolicus} SCOP: a.4.13.1 a.4.13.2 a.177.1.1 PDB: 1sc5_A | Back alignment and structure |
|---|
| >3dkw_A DNR protein; CRP-FNR, HTH, beta barrel, dimerization helix, homodimer, transcription regulator; 3.60A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >3tgn_A ADC operon repressor ADCR; helix-turn-helix, transcriptional regulator, transcription; 2.00A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >2d6y_A Putative TETR family regulatory protein; helix-turn-helix, gene regulation; HET: TLA; 2.30A {Streptomyces coelicolor} SCOP: a.4.1.9 a.121.1.1 | Back alignment and structure |
|---|
| >3egq_A TETR family transcriptional regulator; DNA-binding, transcription regulation, bacterial regulatory DNA/RNA-binding 3-helical bundle fold; HET: MSE PE8; 2.55A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >3ppb_A Putative TETR family transcription regulator; DNA-binding, helix-turn-helix motif, HTH motif, DNA/RNA-BIND helical bundle fold; HET: MSE PG4; 2.10A {Shewanella loihica} | Back alignment and structure |
|---|
| >2gau_A Transcriptional regulator, CRP/FNR family; structural genomics, porphyromona gingivalis, PSI, protein structure initiative; 1.90A {Porphyromonas gingivalis} SCOP: a.4.5.4 b.82.3.2 | Back alignment and structure |
|---|
| >2x4h_A Hypothetical protein SSO2273; transcription; 2.30A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >3on4_A Transcriptional regulator, TETR family; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics; HET: MSE; 1.85A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >1s3j_A YUSO protein; structural genomics, MARR transcriptional regulator family, PSI, protein structure initiative; HET: MSE; 2.25A {Bacillus subtilis} SCOP: a.4.5.28 | Back alignment and structure |
|---|
| >1ojl_A Transcriptional regulatory protein ZRAR; response regulator, two component system, AAA domain, NTRC family, DNA-binding; HET: ATP; 3.0A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >3lwj_A Putative TETR-family transcriptional regulator; structural G joint center for structural genomics, JCSG, protein structu initiative; 2.07A {Syntrophomonas wolfei subsp} | Back alignment and structure |
|---|
| >3e6c_C CPRK, cyclic nucleotide-binding protein; CPRK, halorespiration; HET: DNA 3C4; 1.80A {Desulfitobacterium hafniense} SCOP: a.4.5.4 b.82.3.2 PDB: 3e6b_A* 3e5u_C* 3e6d_A 3e5x_A* 3e5q_A 2h6b_A* 2h6c_A | Back alignment and structure |
|---|
| >3vpr_A Transcriptional regulator, TETR family; all alpha, helix-turn-helix, transcriptional repressor, DNA protein; 2.27A {Thermus thermophilus} | Back alignment and structure |
|---|
| >4dyq_A Gene 1 protein; GP1, octamer, DNA-binding, viral protein; 1.50A {Shigella phage SF6} PDB: 4dyc_A 4dyr_A 3hef_A 4dzj_A 4dzp_A | Back alignment and structure |
|---|
| >3oou_A LIN2118 protein; protein structure initiative, PSI-2, structural genomics, MI center for structural genomics, MCSG, unknown function; HET: BTB; 1.57A {Listeria innocua} | Back alignment and structure |
|---|
| >3e6m_A MARR family transcriptional regulator; APC88769, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; 2.20A {Silicibacter pomeroyi} | Back alignment and structure |
|---|
| >3fx3_A Cyclic nucleotide-binding protein; helix_TURN_helix, CAMP regulatory protein, structural genomi 2, protein structure initiative; 2.20A {Ruegeria pomeroyi} PDB: 3h3z_A* | Back alignment and structure |
|---|
| >2rae_A Transcriptional regulator, ACRR family protein; TETR/ACRR family transcriptional regulator, structural genom 2, RHA08332, MCSG; 2.20A {Rhodococcus SP} | Back alignment and structure |
|---|
| >3anp_C Transcriptional repressor, TETR family; all alpha protein, DNA, acyl-COA; HET: DCC DAO; 1.95A {Thermus thermophilus} PDB: 3ang_C* | Back alignment and structure |
|---|
| >2qtq_A Transcriptional regulator, TETR family; transcription regulator, DNA/RNA-binding 3-helical bundle FO turn helix motif, HTH motif; HET: MSE; 1.85A {Novosphingobium aromaticivorans} PDB: 2rha_A* | Back alignment and structure |
|---|
| >3f1b_A TETR-like transcriptional regulator; APC5888, rhodococcus SP. RHA1, structural genomics, PS protein structure initiative; 2.40A {Rhodococcus} | Back alignment and structure |
|---|
| >3lhq_A Acrab operon repressor (TETR/ACRR family); structural genomics, IDP02616, csgid, DNA-binding, transcription, transcription regulation; 1.56A {Salmonella enterica subsp} PDB: 3bcg_A 2qop_A | Back alignment and structure |
|---|
| >3kcc_A Catabolite gene activator; helix-turn-helix, CAMP, CAMP-binding, DNA-binding nucleotide-binding, transcription, transcription regulation; HET: CMP; 1.66A {Escherichia coli} | Back alignment and structure |
|---|
| >2v57_A TETR family transcriptional repressor LFRR; DNA-binding, transcription regulation; HET: PRL; 1.90A {Mycobacterium smegmatis} PDB: 2wgb_A | Back alignment and structure |
|---|
| >3k2z_A LEXA repressor; winged helix-turn-helix, SOS system, autoca cleavage, DNA damage, DNA repair, DNA replication, DNA-BIND hydrolase; 1.37A {Thermotoga maritima} | Back alignment and structure |
|---|
| >2h09_A Transcriptional regulator MNTR; transcription regulator, diphtheria toxin, manganese transport, structural genomics, NPPSFA; 2.10A {Escherichia coli} | Back alignment and structure |
|---|
| >3knw_A Putative transcriptional regulator (TETR/ACRR FAM; TETR-like protein, MCSG, PSI, structural genomics, protein S initiative; 2.45A {Acinetobacter SP} | Back alignment and structure |
|---|
| >2fq4_A Transcriptional regulator, TETR family; DNA-binding protein, bacillu structural genomics, PSI, protein structure initiative; 1.79A {Bacillus cereus} SCOP: a.4.1.9 a.121.1.1 | Back alignment and structure |
|---|
| >3jth_A Transcription activator HLYU; transcription factor, RTXA, DNA-binding, transcription regulation; 2.00A {Vibrio vulnificus} | Back alignment and structure |
|---|
| >2frh_A SARA, staphylococcal accessory regulator A; winged-helix protein, divalent metal binding, transcription; 2.50A {Staphylococcus aureus} SCOP: a.4.5.28 PDB: 2fnp_A 1fzp_D | Back alignment and structure |
|---|
| >3jw4_A Transcriptional regulator, MARR/EMRR family; DNA-binding protein, structural genomics, PSI-2, protein structure initiative; HET: MSE; 2.10A {Clostridium acetobutylicum} SCOP: a.4.5.0 | Back alignment and structure |
|---|
| >3dcf_A Transcriptional regulator of the TETR/ACRR family; YP_290855.1, structural genomics, joint center for structural genomics, JCSG; 2.50A {Thermobifida fusca YX} | Back alignment and structure |
|---|
| >2zcm_A Biofilm operon icaabcd HTH-type negative transcri regulator ICAR; helix-turn-helix, TETR family, repressor; 1.33A {Staphylococcus epidermidis} PDB: 2zcn_A | Back alignment and structure |
|---|
| >3qbm_A TETR transcriptional regulator; DNA/RNA-binding three-helical bundle, structural genomics, J center for structural genomics, JCSG; HET: MSE PGE; 1.80A {Chloroflexus aurantiacus} | Back alignment and structure |
|---|
| >3mkl_A HTH-type transcriptional regulator GADX; PSI2, MCSG, structural genomics, protein structure initiativ midwest center for structural genomics; 2.15A {Escherichia coli} | Back alignment and structure |
|---|
| >2g7s_A Transcriptional regulator, TETR family; APC5906, PSI, protein structure initiat midwest center for structural genomics, MCSG; HET: MSE; 1.40A {Agrobacterium tumefaciens str} SCOP: a.4.1.9 a.121.1.1 | Back alignment and structure |
|---|
| >2kko_A Possible transcriptional regulatory protein (possibly ARSR-family); NESG, DNA-binding, transcription regulation, WHTH, homodimer; NMR {Mycobacterium bovis} PDB: 3gw2_A | Back alignment and structure |
|---|
| >3ljl_A Transcriptional regulator LUXT; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MES; 3.20A {Vibrio parahaemolyticus} | Back alignment and structure |
|---|
| >4aci_A HTH-type transcriptional repressor ACNR; aconitase, citrate, TETR superfamily; HET: CIT; 1.65A {Corynebacterium glutamicum} PDB: 4ac6_A* | Back alignment and structure |
|---|
| >3cdh_A Transcriptional regulator, MARR family; helix-turn-hleix, structura genomics, PSI-2, protein structure initiative; 2.69A {Silicibacter pomeroyi dss-3} | Back alignment and structure |
|---|
| >3dpj_A Transcription regulator, TETR family; APC88616, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; HET: MES; 1.90A {Silicibacter pomeroyi} | Back alignment and structure |
|---|
| >2dg7_A Putative transcriptional regulator; helix-turn-helix motif, TETR family, gene regulation; 2.30A {Streptomyces coelicolor} | Back alignment and structure |
|---|
| >1ku9_A Hypothetical protein MJ223; putative transcription factor, homodimeric winged-helix fold, structural genomics, PSI; 2.80A {Methanocaldococcus jannaschii} SCOP: a.4.5.36 | Back alignment and structure |
|---|
| >2oa4_A SIR5; structure, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; NMR {Silicibacter pomeroyi} SCOP: a.4.12.3 | Back alignment and structure |
|---|
| >1yse_A DNA-binding protein SATB1; all helical, DNA-binding domain, T-cell development; NMR {Homo sapiens} SCOP: a.35.1.7 | Back alignment and structure |
|---|
| >2jrt_A Uncharacterized protein; solution, structure, NESG, PSI, target RHR5, structural genomics, protein structure initiative; NMR {Rhodobacter sphaeroides} | Back alignment and structure |
|---|
| >3kz9_A SMCR; transcriptional regulator, quorum S DNA-binding, transcription regulation, transcription regula; HET: MSE; 2.10A {Vibrio vulnificus} PDB: 2pbx_A | Back alignment and structure |
|---|
| >1z91_A Organic hydroperoxide resistance transcriptional; OHRR, MARR family, bacterial transcription factor, DNA bindi protein; 2.50A {Bacillus subtilis} SCOP: a.4.5.28 PDB: 1z9c_A* | Back alignment and structure |
|---|
| >3bni_A Putative TETR-family transcriptional regulator; structural genomics, APC7281; HET: PG4; 2.30A {Streptomyces coelicolor A3} | Back alignment and structure |
|---|
| >2dg6_A Putative transcriptional regulator; winged-helix motif, MERR family, gene regulation; 2.20A {Streptomyces coelicolor} | Back alignment and structure |
|---|
| >4fx0_A Probable transcriptional repressor protein; helix-turn-helix, DNA binding, transcription regulator; 2.70A {Mycobacterium tuberculosis} PDB: 4fx4_A* | Back alignment and structure |
|---|
| >3vp5_A Transcriptional regulator; heme, sensor protein, TETR superf transcription; HET: HEM; 1.90A {Lactococcus lactis} PDB: 3vox_A 3vok_A* | Back alignment and structure |
|---|
| >2eh3_A Transcriptional regulator; all alpha proteins, tetracyclin repressor-like, C-terminal D homeodomain-like, DNA/RNA-binding 3-helical bundle; 1.55A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >3fm5_A Transcriptional regulator; MCSG, PF04017, PSI, MARR, structu genomics, protein structure initiative, midwest center for structural genomics; HET: GOL; 2.00A {Rhodococcus jostii} | Back alignment and structure |
|---|
| >3hsr_A HTH-type transcriptional regulator SARZ; helix-turn-helix, cysteine disulfide, MARR-family transcript regulator, DNA-binding; 1.90A {Staphylococcus aureus subsp} PDB: 3hse_A 3hrm_A 4gxo_A | Back alignment and structure |
|---|
| >1tbx_A ORF F-93, hypothetical 11.0 kDa protein; sulfolobus spindle virus, winged helix, fusellovirus; 2.70A {Sulfolobus virus 1} SCOP: a.4.5.48 | Back alignment and structure |
|---|
| >3o60_A LIN0861 protein; PSI, MCSG, structural genomics, midwest center for structura genomics, protein structure initiative, unknown function; 2.80A {Listeria innocua} | Back alignment and structure |
|---|
| >3bru_A Regulatory protein, TETR family; structural genomics, APC88928, PSI-2, protein structur initiative; 2.30A {Rhodobacter sphaeroides 2} | Back alignment and structure |
|---|
| >1pb6_A Hypothetical transcriptional regulator YCDC; helix-loop-helix, dimer, structural genomics, PSI, protein structure initiative; 2.50A {Escherichia coli} PDB: 3loc_A* | Back alignment and structure |
|---|
| >3vib_A MTRR; helix-turn-helix motif, DNA binding, DNA binding protein; HET: CXS; 2.40A {Neisseria gonorrhoeae} | Back alignment and structure |
|---|
| >3gzi_A Transcriptional regulator, TETR family; TETR family transcriptional regulator, structural genomics, center for structural genomics, JCSG; 2.05A {Shewanella loihica pv-4} | Back alignment and structure |
|---|
| >3bhq_A Transcriptional regulator; bacterial RE proteins, structural genomics, joint center for structural JCSG, protein structure initiative, PSI-2; HET: MSE; 1.54A {Mesorhizobium loti} | Back alignment and structure |
|---|
| >3dew_A Transcriptional regulator, TETR family; S genomics, PSI-2, protein structure initiative, midwest CENT structural genomics, MCSG; HET: MSE; 1.75A {Geobacter sulfurreducens} | Back alignment and structure |
|---|
| >3nqo_A MARR-family transcriptional regulator; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE PG4; 2.20A {Clostridium difficile} | Back alignment and structure |
|---|
| >2jj7_A Hemolysin II regulatory protein; DNA-binding protein, transcription regulation, DNA-binding, family, transcription, transcriptional regulator; 2.10A {Bacillus cereus} PDB: 2wv1_A 2jk3_A 2fx0_A | Back alignment and structure |
|---|
| >2fu4_A Ferric uptake regulation protein; DNA binding domain, helix-turn-helix, DNA binding protein; 1.80A {Escherichia coli} | Back alignment and structure |
|---|
| >1u78_A TC3 transposase, transposable element TC3 transposase; transposon DNA, bipartite DNA-binding, HTH- motif, DNA binding protein/DNA complex; 2.69A {Caenorhabditis elegans} SCOP: a.4.1.2 a.4.1.2 | Back alignment and structure |
|---|
| >3f0c_A TETR-molecule A, transcriptional regulator; MCSG,PSI, SAD, structural genomics, protein structure initiative; 2.96A {Cytophaga hutchinsonii} | Back alignment and structure |
|---|
| >3frq_A Repressor protein MPHR(A); macrolide antibiotic. repressor, biosensor, erythromycin, STRPTOMYCES, natural products, biosynthesis, DNA-binding; HET: ERY; 1.76A {Escherichia coli} PDB: 3g56_A | Back alignment and structure |
|---|
| >3szt_A QCSR, quorum-sensing control repressor; quorum sensing acyl-homoserine lactone, helix-turn-helix, transcription factor, 3-OXO-C12 HSL; HET: OHN; 2.55A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >3loc_A HTH-type transcriptional regulator RUTR; helix-turn-helix, putative transcriptional regulator, dimer, structural genomics, PSI; HET: MSE; 2.50A {Escherichia coli} | Back alignment and structure |
|---|
| >4a0z_A Transcription factor FAPR; lipid homeostasis; HET: MLC; 1.90A {Staphylococcus aureus} PDB: 4a0y_A 4a0x_A* 4a12_A | Back alignment and structure |
|---|
| >2yve_A Transcriptional regulator; helix-turn-helix, TETR-family; HET: MBT; 1.40A {Corynebacterium glutamicum} PDB: 1v7b_A 2zoy_A 2yvh_A 2dh0_A* 2zoz_A* | Back alignment and structure |
|---|
| >3pas_A TETR family transcription regulator; structural genomics, joint center for structural genomics, J protein structure initiative; HET: MSE; 1.90A {Marinobacter aquaeolei} | Back alignment and structure |
|---|
| >3rh2_A Hypothetical TETR-like transcriptional regulator; DNA/RNA-binding 3-helical bundle, structural genomics, joint for structural genomics; 2.42A {Shewanella amazonensis} | Back alignment and structure |
|---|
| >3clo_A Transcriptional regulator; NP_811094.1, bacterial regulatory proteins, LUXR family, structural genomics; 2.04A {Bacteroides thetaiotaomicron vpi-5482} | Back alignment and structure |
|---|
| >3deu_A Transcriptional regulator SLYA; MARR, WING-helix, transcription regulator, activator, DNA-binding, repressor; HET: SAL; 2.30A {Salmonella typhimurium} SCOP: a.4.5.28 | Back alignment and structure |
|---|
| >2kfs_A Conserved hypothetical regulatory protein; WHTH, DNA binding, phosphorylation, DNA-binding protein; NMR {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >2d5v_A Hepatocyte nuclear factor 6; transcription factor, transcription-DNA complex; 2.00A {Rattus norvegicus} PDB: 1s7e_A | Back alignment and structure |
|---|
| >3mnl_A KSTR, transcriptional regulatory protein (probably TETR; TETR family of transcriptional regulator, all-helical; 1.80A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >3f3x_A Transcriptional regulator, MARR family, putative; DNA binding protein, DNA-binding, transcription regulation; 1.90A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >2lfw_A PHYR sigma-like domain; signal transduction, response regulator, sigma factor mimicr sigma factor, general stress response, signaling protein; NMR {Sphingomonas SP} | Back alignment and structure |
|---|
| >3cwr_A Transcriptional regulator, TETR family; YP_425770.1, transcriptional regulator of TETR family, bacterial regulatory proteins; 1.50A {Rhodospirillum rubrum atcc 11170} | Back alignment and structure |
|---|
| >3c2b_A Transcriptional regulator, TETR family; structural genomics, APC5923, PSI-2, PR structure initiative; 2.10A {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >2qwt_A Transcriptional regulator, TETR family; structural genomics, PSI-2, protein structure initiative; 2.30A {Mycobacterium vanbaalenii pyr-1} | Back alignment and structure |
|---|
| >3e7q_A Transcriptional regulator; structural genomics, PSI, MCSG, P structure initiative, midwest center for structural genomic binding; 2.20A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >2ibd_A Possible transcriptional regulator; probable transcriptional regulatory protein, rhodococcus SP. structural genomics, PSI-2; 1.50A {Rhodococcus SP} | Back alignment and structure |
|---|
| >2fxa_A Protease production regulatory protein HPR; protease porduction, regulation, STR genomics, PSI, protein structure initiative; HET: PGE P6G 1PE; 2.40A {Bacillus subtilis} SCOP: a.4.5.28 | Back alignment and structure |
|---|
| >3cjd_A Transcriptional regulator, TETR family; YP_510936.1, putative TETR transcriptional regulator, struct genomics; HET: STE; 1.79A {Jannaschia SP} | Back alignment and structure |
|---|
| >2nx4_A Transcriptional regulator, TETR family protein; HTH DNA binding motif, structural genomics, PSI-2, Pro structure initiative; 1.70A {Rhodococcus SP} | Back alignment and structure |
|---|
| >3dn7_A Cyclic nucleotide binding regulatory protein; structural genomics, APC88869, cyclic nucleotide binding REG protein, PSI-2; 1.80A {Cytophaga hutchinsonii} | Back alignment and structure |
|---|
| >2oer_A Probable transcriptional regulator; helix-turn-helix, alpha-beta, structural genomics, PSI-2, protein structure initiative; 2.00A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >2dg8_A Putative TETR-family transcriptional regulatory P; helix-turn-helix motif, gene regulation; 2.21A {Streptomyces coelicolor} | Back alignment and structure |
|---|
| >1vi0_A Transcriptional regulator; structural genomics; HET: MSE DCC; 1.65A {Bacillus subtilis} SCOP: a.4.1.9 a.121.1.1 | Back alignment and structure |
|---|
| >2hku_A A putative transcriptional regulator; structural genomics, APC6040, TET rhodococcus SP. RHA1, PSI-2, protein structure initiative; HET: PG4; 2.00A {Rhodococcus SP} SCOP: a.4.1.9 a.121.1.1 | Back alignment and structure |
|---|
| >3nxc_A HTH-type protein SLMA; nucleoid occlusion, cell division, TETR family member, DNA B protein; 2.50A {Escherichia coli} | Back alignment and structure |
|---|
| >2g3b_A Putative TETR-family transcriptional regulator; transcription regulator, structural genomics, P protein structure initiative; HET: MSE; 2.00A {Rhodococcus SP} SCOP: a.4.1.9 a.121.1.1 | Back alignment and structure |
|---|
| >3b81_A Transcriptional regulator, ACRR family; NP_350189.1, predicted DNA-binding transcriptional regulator TETR/ACRR family; 2.10A {Clostridium acetobutylicum atcc 824} | Back alignment and structure |
|---|
| >2zb9_A Putative transcriptional regulator; transcription regulator, TETR family, helix-turn-helix, DNA- binding, transcription regulation; 2.25A {Streptomyces coelicolor} | Back alignment and structure |
|---|
| >2rek_A Putative TETR-family transcriptional regulator; sulfur, SAD, structural genomics, PSI-2, protein structure initiative; 1.86A {Streptomyces coelicolor A3} | Back alignment and structure |
|---|
| >4aik_A Transcriptional regulator SLYA; transcription, transcription factor; 1.85A {Yersinia pseudotuberculosis} PDB: 4aih_A 4aij_A 3qpt_A* 3q5f_A* | Back alignment and structure |
|---|
| >2o7t_A Transcriptional regulator; transcription regulator, DNA/RNA-binding 3-helical bundle FO turn helix motif, HTH motif; HET: UNL; 2.10A {Corynebacterium glutamicum} SCOP: a.4.1.9 a.121.1.1 | Back alignment and structure |
|---|
| >2wui_A MEXZ, transcriptional regulator; gene regulation, transcription regulation, TETR, DNA-binding transcription; 2.90A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >2gen_A Probable transcriptional regulator; APC6095, TETR family, structural genomics, PSI, protein structure initiative; 1.70A {Pseudomonas aeruginosa PAO1} SCOP: a.4.1.9 a.121.1.1 | Back alignment and structure |
|---|
| >1r1t_A Transcriptional repressor SMTB; zinc, transcriptional regulation, winged HTH protein, DNA binding, transcription repressor; 1.70A {Synechococcus elongatus pcc 7942} SCOP: a.4.5.5 PDB: 1r23_A 1smt_A 1r22_A | Back alignment and structure |
|---|
| >2i10_A Putative TETR transcriptional regulator; structural genomics, APC5890, TETR family, PSI-2, protein ST initiative; HET: MSE NPO PGE; 2.05A {Rhodococcus SP} SCOP: a.4.1.9 a.121.1.1 | Back alignment and structure |
|---|
| >3mvp_A TETR/ACRR transcriptional regulator; PSI, MCSG, structural genomics, midwest center for structura genomics, protein structure initiative; 1.85A {Streptococcus mutans} | Back alignment and structure |
|---|
| >3g7r_A Putative transcriptional regulator; TETR, all-helical, structural genomics, PSI-2, protein structure initiative; 1.38A {Streptomyces coelicolor A3} | Back alignment and structure |
|---|
| >1okr_A MECI, methicillin resistance regulatory protein MECI; bacterial antibiotic resistance, MECI protein, transcriptional regulatory element; 2.4A {Staphylococcus aureus} SCOP: a.4.5.39 PDB: 1sax_A 1sd7_A 2d45_A 1sd6_A | Back alignment and structure |
|---|
| >3b73_A PHIH1 repressor-like protein; winged-helix-turn-helix, structural genomics, PSI-2, protein structure initiative; 2.12A {Haloarcula marismortui atcc 43049} | Back alignment and structure |
|---|
| >2hyt_A TETR-family transcriptional regulator; structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.64A {Pectobacterium atrosepticum} | Back alignment and structure |
|---|
| >3bja_A Transcriptional regulator, MARR family, putative; NP_978771.1, putative MARR-like transcription regulator, MAR structural genomics; 2.38A {Bacillus cereus} | Back alignment and structure |
|---|
| >2q0o_A Probable transcriptional activator protein TRAR; helix-turn-helix, two-helix coiled coil; HET: LAE; 2.00A {Rhizobium SP} | Back alignment and structure |
|---|
| >2qib_A TETR-family transcriptional regulator; HTH DNA binding, STRU genomics, MCSG, PSI-2, protein structure initiative; HET: P6G; 1.70A {Streptomyces coelicolor A3} | Back alignment and structure |
|---|
| >3nnr_A Transcriptional regulator, TETR family; TETR-family transcriptional regulator, structural genomics, center for structural genomics, JCSG; HET: MSE; 2.49A {Marinobacter aquaeolei} | Back alignment and structure |
|---|
| >2np5_A Transcriptional regulator; TETR family, structural genomics, protein structure initiative, midwest center for structural genomics, MCSG; HET: MSE LMT NDS; 1.80A {Rhodococcus SP} SCOP: a.4.1.9 a.121.1.1 | Back alignment and structure |
|---|
| >3col_A Putative transcription regulator; structural genomics, PSI-2, protein structure initiative, midwest CENT structural genomics, MCSG; HET: MSE; 2.10A {Lactobacillus plantarum WCFS1} | Back alignment and structure |
|---|
| >3rd3_A Probable transcriptional regulator; 2.40A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >1uly_A Hypothetical protein PH1932; helix-turn-helix, structural genomics, DNA binding protein; 2.50A {Pyrococcus horikoshii} SCOP: a.4.5.58 PDB: 2cwe_A | Back alignment and structure |
|---|
| >3q0w_A HTH-type transcriptional regulator EThr; TETR family, transcriptional repressor, transcription-transc inhibitor complex; HET: LL5; 1.60A {Mycobacterium tuberculosis} PDB: 3o8g_A* 3o8h_A* 3q0u_A* 3q0v_A* 3g1m_A* 3q3s_A* 3sdg_A* 3sfi_A* 1u9n_A* 1u9o_A* 3tp3_A 3qpl_A 3g1l_A* 1t56_A 3tp0_A* | Back alignment and structure |
|---|
| >2bgc_A PRFA; bacterial infection, human pathogen, transcriptional regulat transcription; HET: PR3; 2.3A {Listeria monocytogenes} SCOP: a.4.5.4 b.82.3.3 PDB: 2beo_A* 1omi_A | Back alignment and structure |
|---|
| >3v6g_A Probable transcriptional regulatory protein (PROB family); helix-turn-helix DNA binding domain; 1.82A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >1mkm_A ICLR transcriptional regulator; structural genomics, winged helix-turn-helix, PSI, protein structure initiative; 2.20A {Thermotoga maritima} SCOP: a.4.5.33 d.110.2.2 | Back alignment and structure |
|---|
| >3bjb_A Probable transcriptional regulator, TETR family P; APC7331, rhodococcus SP. RHA1, structural genomics, PS protein structure initiative; 2.50A {Rhodococcus SP} | Back alignment and structure |
|---|
| >3g7d_A PHPD; non heme Fe(II) dioxygenase, cupin, biosynthetic protein; 1.80A {Streptomyces viridochromogenes} PDB: 3gbf_A 3rzz_A | Back alignment and structure |
|---|
| >1xmk_A Double-stranded RNA-specific adenosine deaminase; winged helix-turn-helix, RNA editing, interferon, ADAR1, hydrolase; 0.97A {Homo sapiens} SCOP: a.4.5.19 | Back alignment and structure |
|---|
| >3rqi_A Response regulator protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: PHD CIT; 1.70A {Burkholderia pseudomallei} | Back alignment and structure |
|---|
| >3crj_A Transcription regulator; APC88200, TETR, structura genomics, PSI-2, protein structure initiative; HET: MSE; 2.60A {Haloarcula marismortui atcc 43049} | Back alignment and structure |
|---|
| >1rkt_A Protein YFIR; transcription regulator, structural genomics, PSI, protein S initiative, midwest center for structural genomics, MCSG; 1.95A {Bacillus subtilis} SCOP: a.4.1.9 a.121.1.1 | Back alignment and structure |
|---|
| >2id3_A Putative transcriptional regulator; structural genomics, PSI-2, prote structure initiative; 1.70A {Streptomyces coelicolor} SCOP: a.4.1.9 a.121.1.1 | Back alignment and structure |
|---|
| >3s5r_A Transcriptional regulator TETR family; DNA/RNA-binding 3-helical bundle, tetracyclin repressor-like structural genomics; 2.60A {Syntrophus aciditrophicus} | Back alignment and structure |
|---|
| >2pz9_A Putative regulatory protein; structural genomics, transcriptional regulator, PSI, protein structure initiative; 2.80A {Streptomyces coelicolor A3} | Back alignment and structure |
|---|
| >1b4a_A Arginine repressor; helix turn helix; 2.50A {Geobacillus stearothermophilus} SCOP: a.4.5.3 d.74.2.1 PDB: 1f9n_A | Back alignment and structure |
|---|
| >1zk8_A Transcriptional regulator, TETR family; TETR member,transcriptional regulator, STRU genomics, PSI, protein structure initiative; 2.15A {Bacillus cereus atcc 14579} SCOP: a.4.1.9 a.121.1.1 | Back alignment and structure |
|---|
| >2guh_A Putative TETR-family transcriptional regulator; helix-turn-helix, TETR fold, structural genomics, PSI, prote structure initiative; HET: MSE; 1.52A {Rhodococcus SP} | Back alignment and structure |
|---|
| >2gfn_A HTH-type transcriptional regulator PKSA related P; transcriptional regulato PSI-2, regulatory protein, structural genomics, protein STR initiative; 1.90A {Rhodococcus SP} SCOP: a.4.1.9 a.121.1.1 | Back alignment and structure |
|---|
| >2zcx_A SCO7815, TETR-family transcriptional regulator; helix-turn-helix, DNA-binding, transcription regulation; 2.22A {Streptomyces coelicolor} | Back alignment and structure |
|---|
| >3npi_A TETR family regulatory protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; 2.96A {Corynebacterium diphtheriae} | Back alignment and structure |
|---|
| >2q24_A Putative TETR family transcriptional regulator; structural genomics, PSI, protein structure initiative; 1.80A {Streptomyces coelicolor A3} | Back alignment and structure |
|---|
| >2o0m_A Transcriptional regulator, SORC family; structural genomics, protein structure initiative, midwest center for structural genomics, MCSG; 1.60A {Enterococcus faecalis} SCOP: c.124.1.8 | Back alignment and structure |
|---|
| >1sfu_A 34L protein; protein/Z-DNA complex, DNA binding protein/DNA complex; 2.00A {Yaba-like disease virus} SCOP: a.4.5.19 | Back alignment and structure |
|---|
| >1l3l_A Transcriptional activator protein TRAR; helix-turn-helix DNA binding motif, alpha/beta/alpha sandwich; HET: LAE; 1.66A {Agrobacterium tumefaciens} SCOP: a.4.6.2 d.110.5.1 PDB: 1h0m_A* | Back alignment and structure |
|---|
| >3uj3_X DNA-invertase; helix-turn-helix, site-specific recombinase, recombination; 3.51A {Enterobacteria phage MU} PDB: 3plo_X | Back alignment and structure |
|---|
| >1ui5_A A-factor receptor homolog; helix-turn-helix, alpha-helix-bundle, antibiotic; 2.40A {Streptomyces coelicolor} SCOP: a.4.1.9 a.121.1.1 PDB: 1ui6_A | Back alignment and structure |
|---|
| >3he0_A Transcriptional regulator, TETR family; ACRR, vibrio parahaemolytic structural genomics, PSI-2, protein structure initiative; HET: MSE; 2.20A {Vibrio parahaemolyticus} | Back alignment and structure |
|---|
| >2bv6_A MGRA, HTH-type transcriptional regulator MGRA; multidrug resistance regulator, virulence determinant, transcriptional factors; 2.8A {Staphylococcus aureus} SCOP: a.4.5.28 | Back alignment and structure |
|---|
| >3eup_A Transcriptional regulator, TETR family; structural genomics, MCSG, protein structure initiative, midwest center for STRU genomics; 1.99A {Cytophaga hutchinsonii} | Back alignment and structure |
|---|
| >2w53_A Repressor, SMet; antibiotic resistance, multi-drug efflux pump, transcription regulation, transcriptional repressor, DNA binding; 2.00A {Stenotrophomonas maltophilia} PDB: 3p9t_A* | Back alignment and structure |
|---|
| >2obp_A Putative DNA-binding protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE; 1.70A {Ralstonia eutropha} SCOP: a.4.5.71 | Back alignment and structure |
|---|
| >2id6_A Transcriptional regulator, TETR family; 1.75A {Thermotoga maritima} SCOP: a.4.1.9 a.121.1.1 PDB: 3ih2_A 3ih3_A 3ih4_A 1zkg_A* 2iek_A* 1z77_A* | Back alignment and structure |
|---|
| >3g1o_A Transcriptional regulatory repressor protein (TETR-family) EThr; TERT family, transcriptional repressor, DNA-binding; HET: RF1; 1.85A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >3qao_A LMO0526 protein, MERR-like transcriptional regulator; structural genomics, the center for structural genomics of I diseases, csgid; 1.87A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >1p6r_A Penicillinase repressor; transcription regulation, DNA-binding, winged helix protein, bacterial resistance to antibiotics; NMR {Bacillus licheniformis} SCOP: a.4.5.39 PDB: 2p7c_B | Back alignment and structure |
|---|
| >3geu_A Intercellular adhesion protein R; TETR family, intercellular adhesion regulator, IDP00851, DNA repressor, transcription; HET: MSE; 1.90A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >1z7u_A Hypothetical protein EF0647; winged-helix-turn-helix, MARR, structural genomics, PSI, Pro structure initiative; 2.20A {Enterococcus faecalis} SCOP: a.4.5.69 | Back alignment and structure |
|---|
| >3pqk_A Biofilm growth-associated repressor; helix-turn-helix motif, winged-helix fold, transcriptional R DNA binding, transcription; 2.09A {Xylella fastidiosa} PDB: 3pqj_A | Back alignment and structure |
|---|
| >3rkx_A Biotin-[acetyl-COA-carboxylase] ligase; biotin protein ligase, 3 domains, enzyme DNA binding, biotin coupling domains; 2.10A {Staphylococcus aureus} PDB: 3rir_A* 3rkw_A 3rky_A* 3v7c_A* 3v7s_A* 3v8j_A 3v7r_A 3v8k_A* 3v8l_A* 4dq2_A* | Back alignment and structure |
|---|
| >3jsj_A Putative TETR-family transcriptional regulator; DNA-binding, transcription regulation; 2.10A {Streptomyces avermitilis ma-4680} | Back alignment and structure |
|---|
| >1t33_A Putative transcriptional repressor (TETR/ACRR FAM; structural genomics, TETR/CCRR FA helix turn helix DNA binding domain, PSI; 2.20A {Salmonella typhimurium} SCOP: a.4.1.9 a.121.1.1 | Back alignment and structure |
|---|
| >2xdn_A HTH-type transcriptional regulator TTGR; transcription regulation, TETR family; 2.20A {Pseudomonas putida} PDB: 2uxu_A* 2uxi_A* 2uxo_A* 2uxp_A* 2uxh_A* | Back alignment and structure |
|---|
| >2ras_A Transcriptional regulator, TETR family; bacterial regulatory proteins, DNA-binding, DNA binding 3-helical bundle fold; 1.80A {Novosphingobium aromaticivorans} | Back alignment and structure |
|---|
| >1bl0_A Protein (multiple antibiotic resistance protein), DNA (5'- D(*CP*CP*GP*AP*TP*GP*CP*CP*AP*CP*GP*TP*TP*TP*TP*GP*CP*TP*AP *AP*AP*TP* CP*C)-3')...; transcriptional activator; HET: DNA; 2.30A {Escherichia coli} SCOP: a.4.1.8 a.4.1.8 PDB: 1xs9_A | Back alignment and structure |
|---|
| >3szp_A Transcriptional regulator, LYSR family; winged helix-turn helix, DNA-binding, transcription factor; 2.20A {Vibrio cholerae} PDB: 3t1b_B | Back alignment and structure |
|---|
| >1o5l_A Transcriptional regulator, CRP family; TM1171, structural GE JCSG, PSI, protein structure initiative, joint center for S genomics; 2.30A {Thermotoga maritima} SCOP: b.82.3.2 | Back alignment and structure |
|---|
| >2oi8_A Putative regulatory protein SCO4313; TETR, structural genomics, PSI-2, P structure initiative; 2.50A {Streptomyces coelicolor} SCOP: a.4.1.9 a.121.1.1 | Back alignment and structure |
|---|
| >2hzt_A Putative HTH-type transcriptional regulator YTCD; DNA-binding protein, HTH-type transcription regulators, structural genomics, PSI-2; HET: CSU MSE; 2.00A {Bacillus subtilis} SCOP: a.4.5.69 | Back alignment and structure |
|---|
| >3bqy_A Putative TETR family transcriptional regulator; structural genomics, strept coelicolor, PSI-2, protein structure initiative; 1.95A {Streptomyces coelicolor A3} | Back alignment and structure |
|---|
| >2of7_A Putative TETR-family transcriptional regulator; APC7240, streptomyces coelicolor A3, structural genomics, PSI-2; 2.30A {Streptomyces coelicolor} | Back alignment and structure |
|---|
| >2iai_A Putative transcriptional regulator SCO3833; structural genomics, TETR, unknow function, PSI-2, protein structure initiative; 1.65A {Streptomyces coelicolor} | Back alignment and structure |
|---|
| >3f6o_A Probable transcriptional regulator, ARSR family protein; transcriptional regulator,RHA00566,MCSG, structural genomics, PSI-2; 1.90A {Rhodococcus SP} | Back alignment and structure |
|---|
| >2xrn_A HTH-type transcriptional regulator TTGV; DNA-binding protein, tetramer gene regulator, cooperative DN binding, multidrug binding protein; 2.90A {Pseudomonas putida} PDB: 2xro_A | Back alignment and structure |
|---|
| >3c07_A Putative TETR-family transcriptional regulator; APC6322, structural GEN PSI-2, protein structure initiative; 2.70A {Streptomyces coelicolor A3} SCOP: a.4.1.9 a.121.1.1 PDB: 2ofl_A* | Back alignment and structure |
|---|
| >4b8x_A SCO5413, possible MARR-transcriptional regulator; winged helix motif; HET: CME; 1.25A {Streptomyces coelicolor} | Back alignment and structure |
|---|
| >1sgm_A Putative HTH-type transcriptional regulator YXAF; structural genomics, PSI, protein structure initiative; 2.00A {Bacillus subtilis} SCOP: a.4.1.9 a.121.1.1 | Back alignment and structure |
|---|
| >1ixc_A CBNR, LYSR-type regulatory protein; long alpha helix connecting DNA binding and regulatory domai binding protein; 2.20A {Cupriavidus necator} SCOP: a.4.5.37 c.94.1.1 PDB: 1iz1_A | Back alignment and structure |
|---|
| >3cdl_A Transcriptional regulator AEFR; APC88582, TETR, pseudomonas syringae PV. tomato STR. DC3000, structural genomics, PSI-2; HET: MSE; 2.36A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >1r8e_A Multidrug-efflux transporter regulator; protein-DNA complex, MERR-family transcription activator, MU binding protein; HET: P4P; 2.40A {Bacillus subtilis} SCOP: a.6.1.3 d.60.1.1 PDB: 1exi_A* 1exj_A* 3iao_A 3q5p_A* 3d71_A* 3q3d_A* 3q1m_A* 3q2y_A* 3q5r_A* 3q5s_A* 3d70_A 3d6z_A* 3d6y_A* 1bow_A 2bow_A* | Back alignment and structure |
|---|
| >3hta_A EBRA repressor; TETR family, DNA binding protein, multidrug resistance, MULT binding protein, DNA-binding, transcription; 2.30A {Streptomyces lividans} PDB: 3hth_A* 3hti_A* 3htj_A* 3iuv_A | Back alignment and structure |
|---|
| >2f2e_A PA1607; transcription factor, helix-TRUN-helix, APC5613, structural genomics, PSI, protein structure initiative; HET: GLC; 1.85A {Pseudomonas aeruginosa} SCOP: a.4.5.69 | Back alignment and structure |
|---|
| >2esn_A Probable transcriptional regulator; PA0477, APC5828,transcription, PSI, protein struc initiative, MCSG; 2.10A {Pseudomonas aeruginosa} SCOP: a.4.5.37 c.94.1.1 | Back alignment and structure |
|---|
| >1y6u_A XIS, excisionase from transposon TN916; structure, DNA architectural protein, tyrosine recombinase, winged-helix protein; NMR {Enterococcus faecalis} | Back alignment and structure |
|---|
| >3hhg_A Transcriptional regulator, LYSR family; transcription factor, structur genomics, oxford protein production facility, OPPF; 3.20A {Neisseria meningitidis serogroup B} | Back alignment and structure |
|---|
| >2xpw_A Tetracycline repressor protein class D; transcription, transcription regulator, helix-turn-helix, ME coordination; HET: OTC MES; 1.44A {Escherichia coli} PDB: 1bjy_A* 1bj0_A 1du7_A* 1ork_A* 2fj1_A* 1bjz_A* 2o7o_A* 2x6o_A* 2x9d_A* 2xps_A* 2xpt_A* 2vke_A* 2xpu_A* 2xpv_A* 2tct_A* 2xb5_A* 2trt_A* 2xrl_A* 1qpi_A* 1a6i_A ... | Back alignment and structure |
|---|
| >2opt_A Actii protein; helical protein, TETR family, APO-protein, transcriptional R transcription; 2.05A {Streptomyces coelicolor} PDB: 3b6a_A* 3b6c_A* | Back alignment and structure |
|---|
| >3hrs_A Metalloregulator SCAR; DTXR/MNTR family member, transcription; 2.70A {Streptococcus gordonii} PDB: 3hrt_A 3hru_A | Back alignment and structure |
|---|
| >2fbq_A Probable transcriptional regulator; PA3006, APC5893, structural genom protein structure initiative; 1.80A {Pseudomonas aeruginosa} SCOP: a.4.1.9 a.121.1.1 | Back alignment and structure |
|---|
| >3qp6_A CVIR transcriptional regulator; quorum sensing, agonist, antagonist, LUXR, acylated homoseri lactone, transcription factor; HET: HL6; 2.00A {Chromobacterium violaceum} PDB: 3qp5_A* | Back alignment and structure |
|---|
| >1l9z_H Sigma factor SIGA; helix-turn-helix, coiled-coil, transcription/DNA complex; 6.50A {Thermus aquaticus} SCOP: i.8.1.1 | Back alignment and structure |
|---|
| >2hyj_A Putative TETR-family transcriptional regulator; HTH DNA binding motif, structural genomics, PSI-2, Pro structure initiative; 2.19A {Streptomyces coelicolor} SCOP: a.4.1.9 a.121.1.1 | Back alignment and structure |
|---|
| >3boq_A Transcriptional regulator, MARR family; MARR famil structural genomics, PSI-2, protein structure initiative; 2.39A {Silicibacter pomeroyi dss-3} | Back alignment and structure |
|---|
| >2hxi_A Putative transcriptional regulator; structural genomics, APC6293, TET streptomyces coelicolor A3(2), PSI-2; 1.70A {Streptomyces coelicolor} | Back alignment and structure |
|---|
| >3u2r_A Regulatory protein MARR; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, helix-turn-helix; 2.20A {Planctomyces limnophilus} | Back alignment and structure |
|---|
| >1u3e_M HNH homing endonuclease; HNH catalytic motif, helix-turn-helix DNA binding domain, PR complex, DNA binding protein-DNA complex; 2.92A {Bacillus phage SPO1} SCOP: d.4.1.3 d.285.1.1 | Back alignment and structure |
|---|
| >4ich_A Transcriptional regulator; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, transcription RE; 1.95A {Saccharomonospora viridis} | Back alignment and structure |
|---|
| >2ijl_A AGR_C_4647P, molybdenum-binding transcriptional repressor; structural GE DNA-binding protein, PSI-2, PROT structure initiative; 2.30A {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >1iuf_A Centromere ABP1 protein; riken structural genomics/proteomics initiative, RSGI, structural genomics, DNA binding protein; NMR {Schizosaccharomyces pombe} SCOP: a.4.1.7 a.4.1.7 | Back alignment and structure |
|---|
| >3cta_A Riboflavin kinase; structural genomics, transferase, PSI-2, protein structure initiative; 2.20A {Thermoplasma acidophilum dsm 1728} SCOP: a.4.5.28 b.43.5.2 | Back alignment and structure |
|---|
| >2k4b_A Transcriptional regulator; DNA binding protein, winged helix; NMR {Lactococcus lactis subsp} | Back alignment and structure |
|---|
| >2g7g_A RHA04620, putative transcriptional regulator; helix-turn-helix, structural genomics, PSI, protein structur initiative; 2.01A {Rhodococcus SP} SCOP: a.4.1.9 a.121.1.1 | Back alignment and structure |
|---|
| >1sd4_A Penicillinase repressor; BLAI, MECI, methicillin, B-lactam, DNA binding PR; 2.00A {Staphylococcus aureus} SCOP: a.4.5.39 PDB: 1xsd_A | Back alignment and structure |
|---|
| >3fxq_A LYSR type regulator of TSAMBCD; transcriptional regulator, LTTR, TSAR, WHTH, DNA- transcription, transcription regulation; 1.85A {Comamonas testosteroni} PDB: 3fxr_A* 3fxu_A* 3fzj_A 3n6t_A 3n6u_A* | Back alignment and structure |
|---|
| >3aqt_A Bacterial regulatory proteins, TETR family; helix-turn-helix, all alpha, transcription, transcription RE transcription regulator; 2.50A {Corynebacterium glutamicum} PDB: 3aqs_A | Back alignment and structure |
|---|
| >1bia_A BIRA bifunctional protein; transcription regulation; 2.30A {Escherichia coli} SCOP: a.4.5.1 b.34.1.1 d.104.1.2 PDB: 1bib_A* 1hxd_A* 2ewn_A* | Back alignment and structure |
|---|
| >1l0o_C Sigma factor; bergerat fold, helix-turn-helix, protein binding; HET: ADP; 2.90A {Geobacillus stearothermophilus} SCOP: a.4.13.2 | Back alignment and structure |
|---|
| >1v4r_A Transcriptional repressor; helix-turn-helix, winged-helix, gene regulation; NMR {Streptomyces} SCOP: a.4.5.6 | Back alignment and structure |
|---|
| >1z0x_A Transcriptional regulator, TETR family; structural genomics, PSI, P structure initiative; 2.40A {Enterococcus faecalis} SCOP: a.4.1.9 a.121.1.1 | Back alignment and structure |
|---|
| >2b0l_A GTP-sensing transcriptional pleiotropic repressor; CODY, DNA-binding, nucleotide-binding, transcript regulation, winged HTH motif.; 2.90A {Bacillus subtilis} SCOP: a.4.5.66 | Back alignment and structure |
|---|
| >4hku_A LMO2814 protein, TETR transcriptional regulator; structural genomics, PSI-biology; 2.30A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >1rr7_A Middle operon regulator; MOR, transcription; 2.20A {Enterobacteria phage MU} SCOP: a.4.1.14 | Back alignment and structure |
|---|
| >2qko_A Possible transcriptional regulator, TETR family P; TETR family protein, structural genomics, P protein structure initiative; 2.35A {Rhodococcus SP} | Back alignment and structure |
|---|
| >1k78_A Paired box protein PAX5; paired domain, ETS domain, transcription factor, transcription/DNA complex; 2.25A {Homo sapiens} SCOP: a.4.1.5 a.4.1.5 PDB: 1mdm_A 6pax_A | Back alignment and structure |
|---|
| >2iu5_A DHAS, YCEG, HTH-type dhaklm operon transcriptional activator; synthase, TETR family; 1.6A {Lactococcus lactis subsp} SCOP: a.4.1.9 a.121.1.1 | Back alignment and structure |
|---|
| >2og0_A Excisionase; protein-DNA complex, DNA architectural protein, 'winged'HELI protein, phage excision; 1.90A {Enterobacteria phage lambda} SCOP: a.6.1.7 PDB: 1lx8_A 1rh6_A 2ief_A | Back alignment and structure |
|---|
| >3ni7_A Bacterial regulatory proteins, TETR family; transcriptional regulator, structural genomics, PSI-2, structure initiative; HET: MSE; 2.78A {Nitrosomonas europaea} | Back alignment and structure |
|---|
| >3him_A Probable transcriptional regulator; TETR, bacterial, RHA1, PSI-2, MCSG, structural midwest center for structural genomics; 2.20A {Rhodococcus jostii} | Back alignment and structure |
|---|
| >4ham_A LMO2241 protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, winged helix-turn-helix, four helix bundle; 1.91A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >2y2z_A SIM16, SIMR, putative repressor simreg2; transcription, simocyclinone regulator, TETR-family; 1.95A {Streptomyces antibioticus} PDB: 2y30_A* 2y31_A* 3zql_A | Back alignment and structure |
|---|
| >3nrg_A TETR family transcriptional regulator; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 2.56A {Chloroflexus aurantiacus} | Back alignment and structure |
|---|
| >2o0y_A Transcriptional regulator; ICLR-family, structural genomics, protein structure initiative, midwest center for structural genomics, MCSG; 2.00A {Rhodococcus SP} | Back alignment and structure |
|---|
| >3ccy_A Putative TETR-family transcriptional regulator; APC88698, structural G PSI-2, protein structure initiative; HET: MSE; 2.01A {Bordetella parapertussis 12822} | Back alignment and structure |
|---|
| >3tqn_A Transcriptional regulator, GNTR family; regulatory functions; 2.80A {Coxiella burnetii} | Back alignment and structure |
|---|
| >2g9w_A Conserved hypothetical protein; DNA-binding domain, bacterial transcription repressor, DNA B protein; 1.80A {Mycobacterium tuberculosis} SCOP: a.4.5.39 | Back alignment and structure |
|---|
| >2g7u_A Transcriptional regulator; ICLR family, structural genomics, PSI, protein structure initiative, midwest center for struc genomics; 2.30A {Rhodococcus SP} | Back alignment and structure |
|---|
| >2g7l_A TETR-family transcriptional regulator; APC6062, protein structure initiativ midwest center for structural genomics, MCSG; 2.10A {Streptomyces coelicolor} SCOP: a.4.1.9 a.121.1.1 | Back alignment and structure |
|---|
| >3f6v_A Possible transcriptional regulator, ARSR family protein; probable transcriptional repressor ARSR family, structural genomics, PSI-2; 1.48A {Rhodococcus SP} | Back alignment and structure |
|---|
| >2np3_A Putative TETR-family regulator; transcriptional regulator, structural genomics, PSI-2, structure initiative; HET: MSE; 2.35A {Streptomyces coelicolor} SCOP: a.4.1.9 a.121.1.1 | Back alignment and structure |
|---|
| >2fd5_A Transcriptional regulator; DNA-binding protein, structural G PSI, protein structure initiative, midwest center for struc genomics, MCSG; 1.70A {Pseudomonas aeruginosa} SCOP: a.4.1.9 a.121.1.1 | Back alignment and structure |
|---|
| >3on2_A Probable transcriptional regulator; protein structure initiative, PSI-2, structural genomics, MI center for structural genomics, MCSG; HET: MSE PG6; 1.96A {Rhodococcus jostii} | Back alignment and structure |
|---|
| >3fiw_A Putative TETR-family transcriptional regulator; TETR-family transcriptional regulator streptomyces, structur genomics, PSI-2; 2.20A {Streptomyces coelicolor} | Back alignment and structure |
|---|
| >2vn2_A DNAD, chromosome replication initiation protein; DNA replication, primosome; 2.3A {Geobacillus kaustophilus HTA426} | Back alignment and structure |
|---|
| >3isp_A HTH-type transcriptional regulator RV1985C/MT2039; ROD shaped structure, DNA binding domain, regulatory domain, DNA-binding; 2.70A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >3lsj_A DEST; transcriptional repressor, TETR family, DNA-binding, transcription, transcription regulation; HET: PLM COA; 2.30A {Pseudomonas aeruginosa} PDB: 3lsp_A* 3lsr_A* | Back alignment and structure |
|---|
| >3neu_A LIN1836 protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG, unknown function; 1.58A {Listeria innocua} | Back alignment and structure |
|---|
| >2vpr_A Tetracycline resistance repressor protein; transcription, metal-binding, antibiotic resistance, transcr regulator; HET: TDC; 2.49A {Pasteurella multocida} | Back alignment and structure |
|---|
| >4ac0_A Tetracycline repressor protein class B from trans TN1 0; transcription; HET: MIY; 2.45A {Escherichia coli} | Back alignment and structure |
|---|
| >2fbk_A Transcriptional regulator, MARR family; winged-helix-turn-helix; 2.30A {Deinococcus radiodurans} SCOP: a.4.5.28 | Back alignment and structure |
|---|
| >2y75_A HTH-type transcriptional regulator CYMR; DNA binding protein; 2.00A {Bacillus subtilis} | Back alignment and structure |
|---|
| >2fsw_A PG_0823 protein; alpha-beta structure, helix-turn-helix, winged-helix-turn-HE structural genomics, PSI, protein structure initiative; HET: MSE; 2.16A {Porphyromonas gingivalis} SCOP: a.4.5.69 | Back alignment and structure |
|---|
| >3gbg_A TCP pilus virulence regulatory protein; cupin, helix-turn-helix, ARAC family, activator, DNA-binding transcription, transcription regulation; HET: PAM; 1.90A {Vibrio cholerae} | Back alignment and structure |
|---|
| >1fx7_A Iron-dependent repressor IDER; DTXR, iron-dependent regulator, signaling protein; 2.00A {Mycobacterium tuberculosis} SCOP: a.4.5.24 a.76.1.1 b.34.1.2 PDB: 1u8r_A | Back alignment and structure |
|---|
| >3mq0_A Transcriptional repressor of the blcabc operon; helix-turn-helix, GAF fold, transcription repressor; 1.79A {Agrobacterium tumefaciens} | Back alignment and structure |
|---|
| >3r4k_A Transcriptional regulator, ICLR family; DNA/RNA-binding 3-helical bundle, profilin-like, structural joint center for structural genomics, JCSG; 2.46A {Ruegeria SP} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 82 | ||||
| d1y7ya1 | 69 | a.35.1.3 (A:5-73) Restriction-modification control | 7e-10 | |
| d2b5aa1 | 77 | a.35.1.3 (A:1-77) Regulatory protein C.BclI {Bacil | 5e-08 | |
| d1utxa_ | 66 | a.35.1.3 (A:) Putative transcription regulator Cyl | 1e-07 | |
| d2r1jl1 | 66 | a.35.1.2 (L:3-68) P22 C2 repressor, DNA-binding do | 1e-06 | |
| d1y9qa1 | 79 | a.35.1.8 (A:4-82) Probable transcriptional regulat | 1e-06 | |
| d1b0na2 | 68 | a.35.1.3 (A:1-68) SinR repressor, DNA-binding doma | 3e-06 | |
| d2croa_ | 65 | a.35.1.2 (A:) cro 434 {Bacteriophage 434 [TaxId: 1 | 6e-05 | |
| d2ppxa1 | 62 | a.35.1.3 (A:30-91) Uncharacterized protein Atu1735 | 1e-04 | |
| d1r69a_ | 63 | a.35.1.2 (A:) 434 C1 repressor, DNA-binding domain | 6e-04 | |
| d2auwa1 | 67 | a.35.1.10 (A:88-154) Hypothetical protein NE0471 C | 8e-04 |
| >d1y7ya1 a.35.1.3 (A:5-73) Restriction-modification controller protein C.AhdI {Aeromonas hydrophila [TaxId: 644]} Length = 69 | Back information, alignment and structure |
|---|
class: All alpha proteins fold: lambda repressor-like DNA-binding domains superfamily: lambda repressor-like DNA-binding domains family: SinR domain-like domain: Restriction-modification controller protein C.AhdI species: Aeromonas hydrophila [TaxId: 644]
Score = 47.8 bits (114), Expect = 7e-10
Identities = 11/54 (20%), Positives = 23/54 (42%)
Query: 23 RQIQRARLGKKMSQPDLANQINQRPQVVSEYENGKAVPNQTVLAKMEKAIGVKL 76
++++ R K +SQ LA V E G+ + + K+ A+ ++
Sbjct: 12 QRLRELRTAKGLSQETLAFLSGLDRSYVGGVERGQRNVSLVNILKLATALDIEP 65
|
| >d2b5aa1 a.35.1.3 (A:1-77) Regulatory protein C.BclI {Bacillus caldolyticus [TaxId: 1394]} Length = 77 | Back information, alignment and structure |
|---|
| >d1utxa_ a.35.1.3 (A:) Putative transcription regulator CylR2 {Enterococcus faecalis [TaxId: 1351]} Length = 66 | Back information, alignment and structure |
|---|
| >d2r1jl1 a.35.1.2 (L:3-68) P22 C2 repressor, DNA-binding domain {Salmonella bacteriophage P22 [TaxId: 10754]} Length = 66 | Back information, alignment and structure |
|---|
| >d1y9qa1 a.35.1.8 (A:4-82) Probable transcriptional regulator VC1968, N-terminal domain {Vibrio cholerae [TaxId: 666]} Length = 79 | Back information, alignment and structure |
|---|
| >d1b0na2 a.35.1.3 (A:1-68) SinR repressor, DNA-binding domain {Bacillus subtilis [TaxId: 1423]} Length = 68 | Back information, alignment and structure |
|---|
| >d2croa_ a.35.1.2 (A:) cro 434 {Bacteriophage 434 [TaxId: 10712]} Length = 65 | Back information, alignment and structure |
|---|
| >d2ppxa1 a.35.1.3 (A:30-91) Uncharacterized protein Atu1735 {Agrobacterium tumefaciens [TaxId: 358]} Length = 62 | Back information, alignment and structure |
|---|
| >d1r69a_ a.35.1.2 (A:) 434 C1 repressor, DNA-binding domain {Bacteriophage 434 [TaxId: 10712]} Length = 63 | Back information, alignment and structure |
|---|
| >d2auwa1 a.35.1.10 (A:88-154) Hypothetical protein NE0471 C-terminal domain {Nitrosomonas europaea [TaxId: 915]} Length = 67 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 82 | |||
| d1y7ya1 | 69 | Restriction-modification controller protein C.AhdI | 99.81 | |
| d2r1jl1 | 66 | P22 C2 repressor, DNA-binding domain {Salmonella b | 99.79 | |
| d1x57a1 | 78 | Endothelial differentiation-related factor 1, EDF1 | 99.78 | |
| d1b0na2 | 68 | SinR repressor, DNA-binding domain {Bacillus subti | 99.78 | |
| d1y9qa1 | 79 | Probable transcriptional regulator VC1968, N-termi | 99.78 | |
| d1utxa_ | 66 | Putative transcription regulator CylR2 {Enterococc | 99.78 | |
| d2b5aa1 | 77 | Regulatory protein C.BclI {Bacillus caldolyticus [ | 99.77 | |
| d2croa_ | 65 | cro 434 {Bacteriophage 434 [TaxId: 10712]} | 99.77 | |
| d1r69a_ | 63 | 434 C1 repressor, DNA-binding domain {Bacteriophag | 99.75 | |
| d2icta1 | 87 | Antitoxin HigA {Escherichia coli [TaxId: 562]} | 99.75 | |
| d1lmb3_ | 87 | lambda C1 repressor, DNA-binding domain {Bacteriop | 99.74 | |
| d2a6ca1 | 69 | HTH-motif protein NE1354 {Nitrosomonas europaea [T | 99.72 | |
| d2o38a1 | 89 | Hypothetical protein RPA3824 {Rhodopseudomonas pal | 99.68 | |
| d2ofya1 | 82 | Putative transcriptional regulator RHA1_ro04071 {R | 99.67 | |
| d2ppxa1 | 62 | Uncharacterized protein Atu1735 {Agrobacterium tum | 99.62 | |
| d2auwa1 | 67 | Hypothetical protein NE0471 C-terminal domain {Nit | 99.47 | |
| d2bnma1 | 71 | Hydroxypropylphosphonic acid epoxidase Fom4, N-ter | 98.63 | |
| d2hsga1 | 57 | Glucose-resistance amylase regulator CcpA, N-termi | 98.53 | |
| d1efaa1 | 59 | Lac repressor (LacR), N-terminal domain {Escherich | 98.45 | |
| d1qpza1 | 57 | Purine repressor (PurR), N-terminal domain {Escher | 98.4 | |
| d1dwka1 | 86 | Cyanase N-terminal domain {Escherichia coli [TaxId | 98.26 | |
| d1uxda_ | 59 | Fructose repressor (FruR), N-terminal domain {Esch | 98.23 | |
| d1ic8a2 | 94 | Hepatocyte nuclear factor 1a (LFB1/HNF1) {Human (H | 98.04 | |
| d1nera_ | 74 | Ner {Bacteriophage mu [TaxId: 10677]} | 97.92 | |
| d1ijwc_ | 47 | HIN recombinase (DNA-binding domain) {Synthetic} | 97.88 | |
| d2awia1 | 65 | PrgX {Enterococcus faecalis [TaxId: 1351]} | 97.61 | |
| d1e3oc2 | 75 | Oct-1 {Human (Homo sapiens) [TaxId: 9606]} | 97.52 | |
| d1au7a2 | 72 | Pit-1 {Rat (Rattus norvegicus) [TaxId: 10116]} | 97.32 | |
| d1gdta1 | 43 | gamma,delta resolvase (C-terminal domain) {Escheri | 97.31 | |
| d1hlva1 | 66 | DNA-binding domain of centromere binding protein B | 97.3 | |
| d2jn6a1 | 89 | Uncharacterized protein Cgl2762 {Corynebacterium g | 97.23 | |
| d1s4ka_ | 120 | Putative cytoplasmic protein YdiL {Salmonella typh | 97.17 | |
| d1vz0a1 | 93 | Putative partitioning protein ParB/Spo0J {Thermus | 97.08 | |
| d1z05a1 | 71 | Transcriptional regulator VC2007 N-terminal domain | 97.03 | |
| d1z6ra1 | 70 | Mlc protein N-terminal domain {Escherichia coli [T | 96.83 | |
| d1biaa1 | 63 | Biotin repressor, N-terminal domain {Escherichia c | 96.71 | |
| d2csfa1 | 88 | DNA-binding protein SATB2 {Human (Homo sapiens) [T | 96.67 | |
| d1j5ya1 | 65 | Putative transcriptional regulator TM1602, N-termi | 96.61 | |
| d1umqa_ | 60 | Photosynthetic apparatus regulatory protein PprA ( | 96.59 | |
| d1r71a_ | 114 | Transcriptional repressor protein KorB DNA-binding | 96.59 | |
| d1i5za1 | 69 | Catabolite gene activator protein (CAP), C-termina | 96.58 | |
| d2cfxa1 | 63 | Transcriptional regulator LrpC {Bacillus subtilis | 96.51 | |
| d2hoea1 | 62 | N-acetylglucosamine kinase {Thermotoga maritima [T | 96.36 | |
| d3e5ua1 | 80 | Chlorophenol reduction protein CprK {Desulfitobact | 96.31 | |
| d2o4aa1 | 83 | DNA-binding protein SATB1 {Human (Homo sapiens) [T | 96.3 | |
| d2gaua1 | 81 | Transcriptional regulator PG0396, C-terminal domai | 96.26 | |
| d2cg4a1 | 63 | Regulatory protein AsnC {Escherichia coli [TaxId: | 96.24 | |
| d1p4wa_ | 87 | Transcriptional regulator RcsB {Erwinia amylovora | 96.23 | |
| d2ox6a1 | 162 | Hypothetical protein SO3848 {Shewanella oneidensis | 96.21 | |
| d1k78a1 | 63 | Pax-5 {Human (Homo sapiens) [TaxId: 9606]} | 96.17 | |
| d1i1ga1 | 60 | LprA {Archaeon Pyrococcus furiosus [TaxId: 2261]} | 96.15 | |
| d1zyba1 | 73 | Probable transcription regulator BT4300, C-termina | 96.14 | |
| d2cyya1 | 60 | Putative transcriptional regulator PH1519 {Archaeo | 96.11 | |
| d1rp3a2 | 71 | Sigma factor sigma-28 (FliA) {Aquifex aeolicus [Ta | 96.08 | |
| d2ao9a1 | 120 | Phage protein BC1890 {Bacillus cereus [TaxId: 1396 | 96.06 | |
| d1a04a1 | 67 | Nitrate/nitrite response regulator (NarL) {Escheri | 96.01 | |
| d1ft9a1 | 80 | CO-sensing protein CooA, C-terminal domain {Rhodos | 96.0 | |
| d1etxa_ | 89 | FIS protein {Escherichia coli [TaxId: 562]} | 95.96 | |
| d1s7ea2 | 80 | Hepatocyte nuclear factor 6 {Mouse (Mus musculus) | 95.9 | |
| d2zcwa1 | 82 | Transcriptional regulator TTHA1359, C-terminal dom | 95.87 | |
| d1fsea_ | 67 | Germination protein GerE {Bacillus subtilis [TaxId | 95.65 | |
| d1l3la1 | 65 | Quorum-sensing transcription factor TraR, C-termin | 95.62 | |
| d2bgca1 | 100 | Listeriolysin regulatory protein PrfA, C-terminal | 95.54 | |
| d1rzsa_ | 61 | cro p22 {Bacteriophage p22 [TaxId: 10754]} | 95.53 | |
| d1v7ba1 | 74 | Transcriptional regulator Cgl2612 {Corynebacterium | 95.44 | |
| d2d1ha1 | 109 | Hypothetical transcriptional regulator ST1889 {Sul | 95.42 | |
| d2g7ga1 | 65 | Putative transcriptional regulator Rha04620 {Rhodo | 95.41 | |
| d1q06a_ | 127 | Transcriptional regulator CueR {Escherichia coli [ | 95.37 | |
| d1or7a1 | 68 | SigmaE factor (RpoE) {Escherichia coli [TaxId: 562 | 95.33 | |
| d1g2ha_ | 61 | Transcriptional regulator TyrR, C-terminal domain | 95.3 | |
| d1ku3a_ | 61 | Sigma70 (SigA, RpoD) {Thermus aquaticus [TaxId: 27 | 95.15 | |
| d2o3fa1 | 83 | Putative transcriptional regulator YbbH {Bacillus | 95.15 | |
| d1r8da_ | 109 | Multidrug transporter activator MtaN {Bacillus sub | 95.14 | |
| d1jt6a1 | 71 | Multidrug binding protein QacR {Staphylococcus aur | 95.13 | |
| d1z0xa1 | 68 | Transcriptional regulator EF0787 {Enterococcus fae | 95.13 | |
| d1j9ia_ | 68 | Terminase gpNU1 subunit domain {Bacteriophage lamb | 95.11 | |
| d2fbqa1 | 79 | Transcriptional regulator PsrA {Pseudomonas aerugi | 95.09 | |
| d1pdnc_ | 123 | Paired protein (prd) {Fruit fly (Drosophila melano | 95.08 | |
| d3ctaa1 | 85 | Ta1064 (RFK), N-terminal domain {Thermoplasma acid | 95.08 | |
| d2g7sa1 | 74 | Putative transcriptional regulator Atu0279 {Agroba | 95.06 | |
| d1ntca_ | 91 | DNA-binding domain of NTRC {Salmonella typhimurium | 95.03 | |
| d2i10a1 | 69 | Putative transcriptional regulator RHA1_ro09068 {R | 95.0 | |
| d2vkva1 | 62 | Tetracyclin repressor (Tet-repressor, TetR) {Esche | 94.97 | |
| d1t56a1 | 73 | Ethr repressor {Mycobacterium tuberculosis [TaxId: | 94.96 | |
| d1s7oa_ | 106 | Hypothetical protein SPy1201 {Streptococcus pyogen | 94.91 | |
| d2a61a1 | 139 | Transcriptional regulator TM0710 {Thermotoga marit | 94.89 | |
| d1jhga_ | 101 | Trp repressor, TrpR {Escherichia coli [TaxId: 562] | 94.89 | |
| d1mkma1 | 75 | Transcriptional regulator IclR, N-terminal domain | 94.88 | |
| d1x2la1 | 87 | Homeobox protein Cux-2, CUTL2 {Human (Homo sapiens | 94.88 | |
| d1wh8a_ | 111 | Homeobox protein Cux-2, CUTL2 {Human (Homo sapiens | 94.88 | |
| d2gena1 | 70 | Probable transcriptional regulator PA1836 {Pseudom | 94.85 | |
| d2p7vb1 | 68 | Sigma70 (SigA, RpoD) {Escherichia coli [TaxId: 562 | 94.83 | |
| d2np5a1 | 69 | Transcriptional regulator RHA1_ro04179 {Rhodococcu | 94.82 | |
| d2gfna1 | 77 | Probable transcriptional regulator RHA1_ro04631 {R | 94.8 | |
| d2d6ya1 | 68 | Putative regulator SCO4008 {Streptomyces coelicolo | 94.73 | |
| d1yioa1 | 70 | Response regulatory protein StyR, C-terminal domai | 94.73 | |
| d1sfxa_ | 109 | Hypothetical protein AF2008 {Archaeoglobus fulgidu | 94.65 | |
| d2id6a1 | 75 | Transcriptional regulator TM1030 {Thermotoga marit | 94.62 | |
| d2fx0a1 | 73 | Hemolysin II regulatory protein, HlyIIR {Bacillus | 94.5 | |
| d2o7ta1 | 78 | Transcriptional regulator Cgl1640/Cg1846 {Coryneba | 94.48 | |
| d1r8ea1 | 118 | Transcription activator BmrR {Bacillus subtilis [T | 94.48 | |
| d2ev0a1 | 61 | Manganese transport regulator MntR {Bacillus subti | 94.39 | |
| d2id3a1 | 68 | Putative transcriptional regulator SCO5951 {Strept | 94.32 | |
| d1pb6a1 | 72 | Hypothetical transcriptional regulator YcdC {Esche | 94.23 | |
| d2fq4a1 | 69 | Transcriptional regulator BC3163 {Bacillus cereus | 94.23 | |
| d1vi0a1 | 72 | Hypothetical transcriptional regulator YsiA {Bacil | 94.14 | |
| d2oi8a1 | 79 | Putative regulatory protein Sco4313 {Streptomyces | 94.13 | |
| d1xsva_ | 106 | Hypothetical protein SAV1236 {Staphylococcus aureu | 94.12 | |
| d2hkua1 | 70 | Putative transcriptional regulator RHA1_ro03468 {R | 94.07 | |
| d2hyja1 | 75 | Putative transcriptional regulator SCO4940 {Strept | 94.03 | |
| d3c07a1 | 75 | Putative transcriptional regulator SCO4850 {Strept | 94.01 | |
| d1ui5a1 | 71 | A-factor receptor homolog CprB {Streptomyces coeli | 94.01 | |
| d1zs4a1 | 78 | Regulatory protein cII {Bacteriophage lambda [TaxI | 93.94 | |
| d1rkta1 | 81 | Hypothetical transcriptional regulator YfiR {Bacil | 93.8 | |
| d1nr3a_ | 122 | DNA-binding protein Tfx {Archaeon Methanobacterium | 93.76 | |
| d3broa1 | 135 | Transcriptional regulator OEOE1854 {Oenococcus oen | 93.71 | |
| d1lnwa_ | 141 | MexR repressor {Pseudomonas aeruginosa [TaxId: 287 | 93.69 | |
| d1d1la_ | 61 | cro lambda repressor {Bacteriophage lambda [TaxId: | 93.67 | |
| d2etha1 | 140 | Putative transcriptional regulator TM0816 {Thermot | 93.65 | |
| d1bl0a1 | 54 | MarA {Escherichia coli [TaxId: 562]} | 93.62 | |
| d1wh6a_ | 101 | Homeobox protein Cux-2, CUTL2 {Human (Homo sapiens | 93.55 | |
| d1lj9a_ | 144 | Transcriptional regulator SlyA {Enterococcus faeca | 93.54 | |
| d2g3ba1 | 72 | Putative transcriptional regulator {Rhodococcus sp | 93.49 | |
| d1ttya_ | 87 | Sigma70 (SigA, RpoD) {Thermotoga maritima [TaxId: | 93.29 | |
| d2isya1 | 63 | Iron-dependent regulator IdeR {Mycobacterium tuber | 93.29 | |
| d1zk8a1 | 72 | Transcriptional regulator BC5000 {Bacillus cereus | 93.17 | |
| d2g7la1 | 68 | Putative transcriptional regulator SCO7704 {Strept | 93.07 | |
| d1z91a1 | 137 | Organic hydroperoxide resistance transcriptional r | 92.87 | |
| d1jgsa_ | 138 | Multiple antibiotic resistance repressor, MarR {Es | 92.73 | |
| d1ub9a_ | 100 | Hypothetical protein PH1061 {Archaeon Pyrococcus h | 92.55 | |
| d2hr3a1 | 145 | Probable transcriptional regulator PA3067 {Pseudom | 92.36 | |
| d2fbia1 | 136 | Probable transcriptional regulator PA4135 {Pseudom | 92.12 | |
| d1s3ja_ | 143 | Putative transcriptional regulator YusO {Bacillus | 92.08 | |
| d1ixca1 | 89 | LysR-type regulatory protein CbnR {Ralstonia eutro | 92.06 | |
| d1tc3c_ | 51 | Transposase tc3a1-65 {Caenorhabditis elegans [TaxI | 91.9 | |
| d2np3a1 | 65 | Putative transcriptional regulator SCO0857 {Strept | 91.56 | |
| d1d5ya1 | 54 | Rob transcription factor, N-terminal domain {Esche | 91.55 | |
| d1u2wa1 | 108 | Cadmium efflux system accessory protein CadC {Stap | 91.41 | |
| d2fbha1 | 137 | Transcriptional regulator PA3341 {Pseudomonas aeru | 91.29 | |
| d1sgma1 | 73 | Putative transcriptional regulator YxaF {Bacillus | 91.18 | |
| d2fxaa1 | 162 | Protease production regulatory protein Hpr {Bacill | 91.04 | |
| d1ku9a_ | 151 | DNA-binding protein Mj223 {Archaeon Methanococcus | 90.96 | |
| d1jhfa1 | 71 | LexA repressor, N-terminal DNA-binding domain {Esc | 90.93 | |
| d2esna1 | 89 | Probable LysR-type transcriptional regulator PA047 | 90.8 | |
| d2bv6a1 | 136 | Transcriptional regulator MgrA {Staphylococcus aur | 90.79 | |
| d2fd5a1 | 76 | Probable transcriptional regulator PA3133 {Pseudom | 90.71 | |
| d2iu5a1 | 71 | Transcriptional activator DhaS {Lactococcus lactis | 90.61 | |
| d1t33a1 | 88 | Putative transcriptional repressor YbiH {Salmonell | 90.28 | |
| d1hw1a1 | 74 | Fatty acid responsive transcription factor FadR, N | 89.96 | |
| d1wh7a_ | 80 | ZF-HD homeobox protein At4g24660 {Thale cress (Ara | 89.89 | |
| d1s7ea1 | 50 | Hepatocyte nuclear factor 6 {Mouse (Mus musculus) | 89.87 | |
| d1r1ua_ | 94 | Metal-sensing transcriptional repressor CzrA {Stap | 89.79 | |
| d1r1ta_ | 98 | SmtB repressor {Cyanobacteria (Synechococcus), pcc | 89.66 | |
| d3deua1 | 140 | Transcriptional regulator SlyA {Salmonella typhimu | 89.24 | |
| d2frha1 | 115 | Pleiotropic regulator of virulence genes, SarA {St | 88.85 | |
| d1ig7a_ | 58 | Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10 | 88.59 | |
| d1le8a_ | 53 | Mating type protein A1 Homeodomain {Baker's yeast | 88.54 | |
| d1bl0a2 | 62 | MarA {Escherichia coli [TaxId: 562]} | 88.53 | |
| d1b9ma1 | 127 | N-terminal domain of molybdate-dependent transcrip | 88.2 | |
| d2cqxa1 | 59 | LAG1 longevity assurance homolog 5, LASS5 {Mouse ( | 87.81 | |
| d3bwga1 | 78 | Transcriptional regulator YydK {Bacillus subtilis | 87.79 | |
| d1ulya_ | 190 | Hypothetical protein PH1932 {Pyrococcus horikoshii | 87.62 | |
| d2dt5a1 | 74 | Transcriptional repressor Rex, N-terminal domain { | 87.57 | |
| d1p4xa2 | 125 | Staphylococcal accessory regulator A homolog, SarS | 87.54 | |
| d1vnda_ | 77 | VND/NK-2 protein {Fruit fly (Drosophila melanogast | 87.35 | |
| d1rr7a_ | 94 | Middle operon regulator, Mor {Bacteriophage Mu [Ta | 87.08 | |
| d1rp3a1 | 77 | Sigma factor sigma-28 (FliA) {Aquifex aeolicus [Ta | 87.07 | |
| d1p7ia_ | 53 | Engrailed Homeodomain {Drosophila melanogaster [Ta | 86.71 | |
| d2hs5a1 | 69 | Putative transcriptional regulator RHA1_ro03477 {R | 86.71 | |
| d1hsja1 | 115 | Staphylococcal accessory regulator A homolog, SarR | 86.67 | |
| d1jgga_ | 57 | Even-skipped homeodomain {Fruit fly (Drosophila me | 86.51 | |
| d1zq3p1 | 67 | Homeotic bicoid protein {Fruit fly (Drosophila mel | 86.03 | |
| d1aisb1 | 98 | Transcription factor IIB (TFIIB), core domain {Arc | 85.68 | |
| d1x2ma1 | 52 | Lag1 longevity assurance homolog 6, LASS6 {Mouse ( | 85.61 | |
| d1e3oc1 | 57 | Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId | 85.3 | |
| d2craa1 | 58 | Homeobox protein hox-b13 {Human (Homo sapiens) [Ta | 84.67 | |
| d1au7a1 | 58 | Pit-1 POU homeodomain {Rat (Rattus norvegicus) [Ta | 84.65 | |
| d1bw5a_ | 66 | Insulin gene enhancer protein isl-1 {Rat (Rattus n | 84.65 | |
| d2e1oa1 | 57 | Homeobox protein prh {Human (Homo sapiens) [TaxId: | 84.37 | |
| d1b72a_ | 88 | Homeobox protein hox-b1 {Human (Homo sapiens) [Tax | 84.05 | |
| d1sfua_ | 70 | 34L {Yaba-like disease virus, YLDV [TaxId: 132475] | 83.91 | |
| d1wi3a_ | 71 | DNA-binding protein SATB2 {Human (Homo sapiens) [T | 83.81 | |
| d1fjla_ | 65 | Paired protein {Fruit fly (Drosophila melanogaster | 83.78 | |
| d1vola1 | 95 | Transcription factor IIB (TFIIB), core domain {Hum | 83.57 | |
| d1x2na1 | 62 | Homeobox protein pknox1 {Human (Homo sapiens) [Tax | 83.47 | |
| d2cuea1 | 68 | Paired box protein pax6 {Human (Homo sapiens) [Tax | 83.26 | |
| d2p4wa1 | 194 | Transcriptional regulatory protein PF1790 {Pyrococ | 83.22 | |
| d1pufb_ | 73 | pbx1 {Human (Homo sapiens) [TaxId: 9606]} | 83.09 | |
| d1k61a_ | 60 | mat alpha2 Homeodomain {Baker's yeast (Saccharomyc | 82.88 | |
| d1ftta_ | 68 | Thyroid transcription factor 1 homeodomain {Rat (R | 82.56 | |
| d9anta_ | 56 | Antennapedia Homeodomain {Drosophila melanogaster | 82.37 | |
| d1yz8p1 | 60 | Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: | 82.32 | |
| d1ocpa_ | 67 | Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId | 81.78 | |
| d1xd7a_ | 127 | Hypothetical protein ywnA {Bacillus subtilis [TaxI | 81.22 | |
| d2fbka1 | 172 | Transcriptional regulator DR1159 {Deinococcus radi | 80.67 | |
| d2ecba1 | 76 | Zinc fingers and homeoboxes protein 1, ZHX1 {Human | 80.54 | |
| d1v4ra1 | 100 | Transcriptional repressor TraR, N-terminal domain | 80.02 |
| >d1y7ya1 a.35.1.3 (A:5-73) Restriction-modification controller protein C.AhdI {Aeromonas hydrophila [TaxId: 644]} | Back information, alignment and structure |
|---|
class: All alpha proteins fold: lambda repressor-like DNA-binding domains superfamily: lambda repressor-like DNA-binding domains family: SinR domain-like domain: Restriction-modification controller protein C.AhdI species: Aeromonas hydrophila [TaxId: 644]
Probab=99.81 E-value=4.9e-20 Score=97.43 Aligned_cols=57 Identities=21% Similarity=0.229 Sum_probs=56.0
Q ss_pred HHHHHHHHHhCCCCHHHHHHHhCCCHHHHHHHHcCCCCCCHHHHHHHHHHhCCCCcc
Q 038591 22 PRQIQRARLGKKMSQPDLANQINQRPQVVSEYENGKAVPNQTVLAKMEKAIGVKLRV 78 (82)
Q Consensus 22 ~~~lk~~r~~~g~s~~elA~~~gis~~~i~~~e~g~~~p~~~~~~~la~~lgv~~~e 78 (82)
|.+|+.+|+..||||.+||+.+|+|+++|++||+|...|+.+.+.+||++|||++++
T Consensus 11 g~~ik~~R~~~gltq~~lA~~~gis~~~i~~~E~g~~~p~~~~l~~ia~~l~v~~~~ 67 (69)
T d1y7ya1 11 GQRLRELRTAKGLSQETLAFLSGLDRSYVGGVERGQRNVSLVNILKLATALDIEPRE 67 (69)
T ss_dssp HHHHHHHHHHTTCCHHHHHHHHTCCHHHHHHHHTTCSCCBHHHHHHHHHHTTSCGGG
T ss_pred HHHHHHHHHHcCCCHHHHHhHhCCCHHHHHHHHCCCCCCCHHHHHHHHHHhCcCHHH
Confidence 899999999999999999999999999999999999999999999999999999987
|
| >d2r1jl1 a.35.1.2 (L:3-68) P22 C2 repressor, DNA-binding domain {Salmonella bacteriophage P22 [TaxId: 10754]} | Back information, alignment and structure |
|---|
| >d1x57a1 a.35.1.12 (A:8-85) Endothelial differentiation-related factor 1, EDF1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1b0na2 a.35.1.3 (A:1-68) SinR repressor, DNA-binding domain {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1y9qa1 a.35.1.8 (A:4-82) Probable transcriptional regulator VC1968, N-terminal domain {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d1utxa_ a.35.1.3 (A:) Putative transcription regulator CylR2 {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d2b5aa1 a.35.1.3 (A:1-77) Regulatory protein C.BclI {Bacillus caldolyticus [TaxId: 1394]} | Back information, alignment and structure |
|---|
| >d2croa_ a.35.1.2 (A:) cro 434 {Bacteriophage 434 [TaxId: 10712]} | Back information, alignment and structure |
|---|
| >d1r69a_ a.35.1.2 (A:) 434 C1 repressor, DNA-binding domain {Bacteriophage 434 [TaxId: 10712]} | Back information, alignment and structure |
|---|
| >d2icta1 a.35.1.3 (A:8-94) Antitoxin HigA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1lmb3_ a.35.1.2 (3:) lambda C1 repressor, DNA-binding domain {Bacteriophage lambda [TaxId: 10710]} | Back information, alignment and structure |
|---|
| >d2a6ca1 a.35.1.13 (A:1-69) HTH-motif protein NE1354 {Nitrosomonas europaea [TaxId: 915]} | Back information, alignment and structure |
|---|
| >d2o38a1 a.35.1.13 (A:28-116) Hypothetical protein RPA3824 {Rhodopseudomonas palustris [TaxId: 1076]} | Back information, alignment and structure |
|---|
| >d2ofya1 a.35.1.3 (A:3-84) Putative transcriptional regulator RHA1_ro04071 {Rhodococcus sp. RHA1 [TaxId: 101510]} | Back information, alignment and structure |
|---|
| >d2ppxa1 a.35.1.3 (A:30-91) Uncharacterized protein Atu1735 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d2auwa1 a.35.1.10 (A:88-154) Hypothetical protein NE0471 C-terminal domain {Nitrosomonas europaea [TaxId: 915]} | Back information, alignment and structure |
|---|
| >d2bnma1 a.35.1.3 (A:6-76) Hydroxypropylphosphonic acid epoxidase Fom4, N-terminal domain {Streptomyces wedmorensis [TaxId: 43759]} | Back information, alignment and structure |
|---|
| >d2hsga1 a.35.1.5 (A:2-58) Glucose-resistance amylase regulator CcpA, N-terminal domain {Bacillus megaterium [TaxId: 1404]} | Back information, alignment and structure |
|---|
| >d1efaa1 a.35.1.5 (A:2-60) Lac repressor (LacR), N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1qpza1 a.35.1.5 (A:2-58) Purine repressor (PurR), N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1dwka1 a.35.1.4 (A:1-86) Cyanase N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1uxda_ a.35.1.5 (A:) Fructose repressor (FruR), N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ic8a2 a.35.1.1 (A:87-180) Hepatocyte nuclear factor 1a (LFB1/HNF1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nera_ a.35.1.2 (A:) Ner {Bacteriophage mu [TaxId: 10677]} | Back information, alignment and structure |
|---|
| >d1ijwc_ a.4.1.2 (C:) HIN recombinase (DNA-binding domain) {Synthetic} | Back information, alignment and structure |
|---|
| >d2awia1 a.35.1.11 (A:2-66) PrgX {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d1e3oc2 a.35.1.1 (C:1-75) Oct-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1au7a2 a.35.1.1 (A:5-76) Pit-1 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1gdta1 a.4.1.2 (A:141-183) gamma,delta resolvase (C-terminal domain) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1hlva1 a.4.1.7 (A:1-66) DNA-binding domain of centromere binding protein B (CENP-B) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2jn6a1 a.4.1.19 (A:1-89) Uncharacterized protein Cgl2762 {Corynebacterium glutamicum [TaxId: 1718]} | Back information, alignment and structure |
|---|
| >d1s4ka_ a.35.1.6 (A:) Putative cytoplasmic protein YdiL {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1vz0a1 a.4.14.1 (A:116-208) Putative partitioning protein ParB/Spo0J {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1z05a1 a.4.5.63 (A:10-80) Transcriptional regulator VC2007 N-terminal domain {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d1z6ra1 a.4.5.63 (A:12-81) Mlc protein N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1biaa1 a.4.5.1 (A:1-63) Biotin repressor, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2csfa1 a.35.1.7 (A:8-95) DNA-binding protein SATB2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1j5ya1 a.4.5.1 (A:3-67) Putative transcriptional regulator TM1602, N-terminal domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1umqa_ a.4.1.12 (A:) Photosynthetic apparatus regulatory protein PprA (RegA), DNA-binding domain {Rhodobacter sphaeroides [TaxId: 1063]} | Back information, alignment and structure |
|---|
| >d1r71a_ a.4.14.1 (A:) Transcriptional repressor protein KorB DNA-binding domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1i5za1 a.4.5.4 (A:138-206) Catabolite gene activator protein (CAP), C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2cfxa1 a.4.5.32 (A:1-63) Transcriptional regulator LrpC {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2hoea1 a.4.5.63 (A:10-71) N-acetylglucosamine kinase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d3e5ua1 a.4.5.4 (A:148-227) Chlorophenol reduction protein CprK {Desulfitobacterium hafniense [TaxId: 49338]} | Back information, alignment and structure |
|---|
| >d2o4aa1 a.35.1.7 (A:370-452) DNA-binding protein SATB1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2gaua1 a.4.5.4 (A:152-232) Transcriptional regulator PG0396, C-terminal domain {Porphyromonas gingivalis [TaxId: 837]} | Back information, alignment and structure |
|---|
| >d2cg4a1 a.4.5.32 (A:4-66) Regulatory protein AsnC {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1p4wa_ a.4.6.2 (A:) Transcriptional regulator RcsB {Erwinia amylovora [TaxId: 552]} | Back information, alignment and structure |
|---|
| >d2ox6a1 a.35.1.6 (A:5-166) Hypothetical protein SO3848 {Shewanella oneidensis [TaxId: 70863]} | Back information, alignment and structure |
|---|
| >d1k78a1 a.4.1.5 (A:19-81) Pax-5 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1i1ga1 a.4.5.32 (A:2-61) LprA {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1zyba1 a.4.5.4 (A:148-220) Probable transcription regulator BT4300, C-terminal domain {Bacteroides thetaiotaomicron [TaxId: 818]} | Back information, alignment and structure |
|---|
| >d2cyya1 a.4.5.32 (A:5-64) Putative transcriptional regulator PH1519 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1rp3a2 a.4.13.2 (A:164-234) Sigma factor sigma-28 (FliA) {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d2ao9a1 a.4.1.17 (A:13-132) Phage protein BC1890 {Bacillus cereus [TaxId: 1396]} | Back information, alignment and structure |
|---|
| >d1a04a1 a.4.6.2 (A:150-216) Nitrate/nitrite response regulator (NarL) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ft9a1 a.4.5.4 (A:134-213) CO-sensing protein CooA, C-terminal domain {Rhodospirillum rubrum [TaxId: 1085]} | Back information, alignment and structure |
|---|
| >d1etxa_ a.4.1.12 (A:) FIS protein {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1s7ea2 a.35.1.7 (A:6-85) Hepatocyte nuclear factor 6 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1fsea_ a.4.6.2 (A:) Germination protein GerE {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1l3la1 a.4.6.2 (A:170-234) Quorum-sensing transcription factor TraR, C-terminal domain {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d2bgca1 a.4.5.4 (A:138-237) Listeriolysin regulatory protein PrfA, C-terminal domain {Bacteria (Listeria monocytogenes) [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1rzsa_ a.35.1.2 (A:) cro p22 {Bacteriophage p22 [TaxId: 10754]} | Back information, alignment and structure |
|---|
| >d1v7ba1 a.4.1.9 (A:1-74) Transcriptional regulator Cgl2612 {Corynebacterium glutamicum [TaxId: 1718]} | Back information, alignment and structure |
|---|
| >d2d1ha1 a.4.5.50 (A:1-109) Hypothetical transcriptional regulator ST1889 {Sulfolobus tokodaii [TaxId: 111955]} | Back information, alignment and structure |
|---|
| >d2g7ga1 a.4.1.9 (A:9-73) Putative transcriptional regulator Rha04620 {Rhodococcus sp. rha1 [TaxId: 101510]} | Back information, alignment and structure |
|---|
| >d1q06a_ a.6.1.3 (A:) Transcriptional regulator CueR {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1or7a1 a.4.13.2 (A:120-187) SigmaE factor (RpoE) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1g2ha_ a.4.1.12 (A:) Transcriptional regulator TyrR, C-terminal domain {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1ku3a_ a.4.13.2 (A:) Sigma70 (SigA, RpoD) {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d2o3fa1 a.4.1.20 (A:1-83) Putative transcriptional regulator YbbH {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1r8da_ a.6.1.3 (A:) Multidrug transporter activator MtaN {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1jt6a1 a.4.1.9 (A:2-72) Multidrug binding protein QacR {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1z0xa1 a.4.1.9 (A:4-71) Transcriptional regulator EF0787 {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d1j9ia_ a.6.1.5 (A:) Terminase gpNU1 subunit domain {Bacteriophage lambda [TaxId: 10710]} | Back information, alignment and structure |
|---|
| >d2fbqa1 a.4.1.9 (A:2-80) Transcriptional regulator PsrA {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1pdnc_ a.4.1.5 (C:) Paired protein (prd) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d3ctaa1 a.4.5.28 (A:5-89) Ta1064 (RFK), N-terminal domain {Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d2g7sa1 a.4.1.9 (A:3-76) Putative transcriptional regulator Atu0279 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1ntca_ a.4.1.12 (A:) DNA-binding domain of NTRC {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d2i10a1 a.4.1.9 (A:10-78) Putative transcriptional regulator RHA1_ro09068 {Rhodococcus sp. [TaxId: 1831]} | Back information, alignment and structure |
|---|
| >d2vkva1 a.4.1.9 (A:6-67) Tetracyclin repressor (Tet-repressor, TetR) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1t56a1 a.4.1.9 (A:22-94) Ethr repressor {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1s7oa_ a.4.13.3 (A:) Hypothetical protein SPy1201 {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d2a61a1 a.4.5.28 (A:5-143) Transcriptional regulator TM0710 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1jhga_ a.4.12.1 (A:) Trp repressor, TrpR {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1mkma1 a.4.5.33 (A:1-75) Transcriptional regulator IclR, N-terminal domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1x2la1 a.35.1.7 (A:9-95) Homeobox protein Cux-2, CUTL2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wh8a_ a.35.1.7 (A:) Homeobox protein Cux-2, CUTL2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2gena1 a.4.1.9 (A:6-75) Probable transcriptional regulator PA1836 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d2p7vb1 a.4.13.2 (B:546-613) Sigma70 (SigA, RpoD) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2np5a1 a.4.1.9 (A:9-77) Transcriptional regulator RHA1_ro04179 {Rhodococcus sp. [TaxId: 1831]} | Back information, alignment and structure |
|---|
| >d2gfna1 a.4.1.9 (A:4-80) Probable transcriptional regulator RHA1_ro04631 {Rhodococcus sp. rha1 [TaxId: 101510]} | Back information, alignment and structure |
|---|
| >d2d6ya1 a.4.1.9 (A:7-74) Putative regulator SCO4008 {Streptomyces coelicolor [TaxId: 1902]} | Back information, alignment and structure |
|---|
| >d1yioa1 a.4.6.2 (A:131-200) Response regulatory protein StyR, C-terminal domain {Pseudomonas fluorescens [TaxId: 294]} | Back information, alignment and structure |
|---|
| >d1sfxa_ a.4.5.50 (A:) Hypothetical protein AF2008 {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d2id6a1 a.4.1.9 (A:1-75) Transcriptional regulator TM1030 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2fx0a1 a.4.1.9 (A:4-76) Hemolysin II regulatory protein, HlyIIR {Bacillus cereus [TaxId: 1396]} | Back information, alignment and structure |
|---|
| >d2o7ta1 a.4.1.9 (A:1-78) Transcriptional regulator Cgl1640/Cg1846 {Corynebacterium glutamicum [TaxId: 1718]} | Back information, alignment and structure |
|---|
| >d1r8ea1 a.6.1.3 (A:3-120) Transcription activator BmrR {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2ev0a1 a.4.5.24 (A:2-62) Manganese transport regulator MntR {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2id3a1 a.4.1.9 (A:13-80) Putative transcriptional regulator SCO5951 {Streptomyces coelicolor [TaxId: 1902]} | Back information, alignment and structure |
|---|
| >d1pb6a1 a.4.1.9 (A:14-85) Hypothetical transcriptional regulator YcdC {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2fq4a1 a.4.1.9 (A:9-77) Transcriptional regulator BC3163 {Bacillus cereus [TaxId: 1396]} | Back information, alignment and structure |
|---|
| >d1vi0a1 a.4.1.9 (A:6-77) Hypothetical transcriptional regulator YsiA {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2oi8a1 a.4.1.9 (A:8-86) Putative regulatory protein Sco4313 {Streptomyces coelicolor [TaxId: 1902]} | Back information, alignment and structure |
|---|
| >d1xsva_ a.4.13.3 (A:) Hypothetical protein SAV1236 {Staphylococcus aureus, strain Mu50 / ATCC 700699 [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d2hkua1 a.4.1.9 (A:18-87) Putative transcriptional regulator RHA1_ro03468 {Rhodococcus sp. RHA1 [TaxId: 101510]} | Back information, alignment and structure |
|---|
| >d2hyja1 a.4.1.9 (A:8-82) Putative transcriptional regulator SCO4940 {Streptomyces coelicolor [TaxId: 1902]} | Back information, alignment and structure |
|---|
| >d3c07a1 a.4.1.9 (A:15-89) Putative transcriptional regulator SCO4850 {Streptomyces coelicolor [TaxId: 1902]} | Back information, alignment and structure |
|---|
| >d1ui5a1 a.4.1.9 (A:5-75) A-factor receptor homolog CprB {Streptomyces coelicolor [TaxId: 1902]} | Back information, alignment and structure |
|---|
| >d1zs4a1 a.35.1.9 (A:4-81) Regulatory protein cII {Bacteriophage lambda [TaxId: 10710]} | Back information, alignment and structure |
|---|
| >d1rkta1 a.4.1.9 (A:2-82) Hypothetical transcriptional regulator YfiR {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1nr3a_ d.236.1.1 (A:) DNA-binding protein Tfx {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d3broa1 a.4.5.28 (A:3-137) Transcriptional regulator OEOE1854 {Oenococcus oeni [TaxId: 1247]} | Back information, alignment and structure |
|---|
| >d1lnwa_ a.4.5.28 (A:) MexR repressor {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1d1la_ a.35.1.2 (A:) cro lambda repressor {Bacteriophage lambda [TaxId: 10710]} | Back information, alignment and structure |
|---|
| >d2etha1 a.4.5.28 (A:1-140) Putative transcriptional regulator TM0816 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1bl0a1 a.4.1.8 (A:9-62) MarA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1wh6a_ a.35.1.7 (A:) Homeobox protein Cux-2, CUTL2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lj9a_ a.4.5.28 (A:) Transcriptional regulator SlyA {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d2g3ba1 a.4.1.9 (A:2-73) Putative transcriptional regulator {Rhodococcus sp. rha1 [TaxId: 101510]} | Back information, alignment and structure |
|---|
| >d1ttya_ a.4.13.2 (A:) Sigma70 (SigA, RpoD) {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2isya1 a.4.5.24 (A:2-64) Iron-dependent regulator IdeR {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1zk8a1 a.4.1.9 (A:6-77) Transcriptional regulator BC5000 {Bacillus cereus [TaxId: 1396]} | Back information, alignment and structure |
|---|
| >d2g7la1 a.4.1.9 (A:16-83) Putative transcriptional regulator SCO7704 {Streptomyces coelicolor [TaxId: 1902]} | Back information, alignment and structure |
|---|
| >d1z91a1 a.4.5.28 (A:8-144) Organic hydroperoxide resistance transcriptional regulator OhrR {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1jgsa_ a.4.5.28 (A:) Multiple antibiotic resistance repressor, MarR {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ub9a_ a.4.5.28 (A:) Hypothetical protein PH1061 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d2hr3a1 a.4.5.28 (A:2-146) Probable transcriptional regulator PA3067 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d2fbia1 a.4.5.28 (A:5-140) Probable transcriptional regulator PA4135 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1s3ja_ a.4.5.28 (A:) Putative transcriptional regulator YusO {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1ixca1 a.4.5.37 (A:1-89) LysR-type regulatory protein CbnR {Ralstonia eutropha [TaxId: 106590]} | Back information, alignment and structure |
|---|
| >d1tc3c_ a.4.1.2 (C:) Transposase tc3a1-65 {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d2np3a1 a.4.1.9 (A:35-99) Putative transcriptional regulator SCO0857 {Streptomyces coelicolor [TaxId: 1902]} | Back information, alignment and structure |
|---|
| >d1d5ya1 a.4.1.8 (A:3-56) Rob transcription factor, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1u2wa1 a.4.5.5 (A:12-119) Cadmium efflux system accessory protein CadC {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d2fbha1 a.4.5.28 (A:8-144) Transcriptional regulator PA3341 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1sgma1 a.4.1.9 (A:5-77) Putative transcriptional regulator YxaF {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2fxaa1 a.4.5.28 (A:6-167) Protease production regulatory protein Hpr {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1ku9a_ a.4.5.36 (A:) DNA-binding protein Mj223 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1jhfa1 a.4.5.2 (A:2-72) LexA repressor, N-terminal DNA-binding domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2esna1 a.4.5.37 (A:3-91) Probable LysR-type transcriptional regulator PA0477 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d2bv6a1 a.4.5.28 (A:5-140) Transcriptional regulator MgrA {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d2fd5a1 a.4.1.9 (A:1-76) Probable transcriptional regulator PA3133 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d2iu5a1 a.4.1.9 (A:1-71) Transcriptional activator DhaS {Lactococcus lactis [TaxId: 1358]} | Back information, alignment and structure |
|---|
| >d1t33a1 a.4.1.9 (A:1-88) Putative transcriptional repressor YbiH {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1hw1a1 a.4.5.6 (A:5-78) Fatty acid responsive transcription factor FadR, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1wh7a_ a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1s7ea1 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1r1ua_ a.4.5.5 (A:) Metal-sensing transcriptional repressor CzrA {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1r1ta_ a.4.5.5 (A:) SmtB repressor {Cyanobacteria (Synechococcus), pcc7942 [TaxId: 1129]} | Back information, alignment and structure |
|---|
| >d3deua1 a.4.5.28 (A:2-141) Transcriptional regulator SlyA {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d2frha1 a.4.5.28 (A:102-216) Pleiotropic regulator of virulence genes, SarA {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1ig7a_ a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1le8a_ a.4.1.1 (A:) Mating type protein A1 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1bl0a2 a.4.1.8 (A:63-124) MarA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2cqxa1 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 5, LASS5 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d3bwga1 a.4.5.6 (A:5-82) Transcriptional regulator YydK {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1ulya_ a.4.5.58 (A:) Hypothetical protein PH1932 {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d2dt5a1 a.4.5.38 (A:4-77) Transcriptional repressor Rex, N-terminal domain {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d1p4xa2 a.4.5.28 (A:126-250) Staphylococcal accessory regulator A homolog, SarS {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1vnda_ a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1rr7a_ a.4.1.14 (A:) Middle operon regulator, Mor {Bacteriophage Mu [TaxId: 10677]} | Back information, alignment and structure |
|---|
| >d1rp3a1 a.4.13.1 (A:87-163) Sigma factor sigma-28 (FliA) {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1p7ia_ a.4.1.1 (A:) Engrailed Homeodomain {Drosophila melanogaster [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d2hs5a1 a.4.5.6 (A:25-93) Putative transcriptional regulator RHA1_ro03477 {Rhodococcus sp. RHA1 [TaxId: 101510]} | Back information, alignment and structure |
|---|
| >d1hsja1 a.4.5.28 (A:373-487) Staphylococcal accessory regulator A homolog, SarR {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1jgga_ a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1zq3p1 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1aisb1 a.74.1.2 (B:1108-1205) Transcription factor IIB (TFIIB), core domain {Archaeon Pyrococcus woesei [TaxId: 2262]} | Back information, alignment and structure |
|---|
| >d1x2ma1 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 6, LASS6 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1e3oc1 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2craa1 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1au7a1 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1bw5a_ a.4.1.1 (A:) Insulin gene enhancer protein isl-1 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2e1oa1 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1b72a_ a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1sfua_ a.4.5.19 (A:) 34L {Yaba-like disease virus, YLDV [TaxId: 132475]} | Back information, alignment and structure |
|---|
| >d1wi3a_ a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fjla_ a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1vola1 a.74.1.2 (A:113-207) Transcription factor IIB (TFIIB), core domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x2na1 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cuea1 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2p4wa1 a.4.5.64 (A:1-194) Transcriptional regulatory protein PF1790 {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1pufb_ a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1k61a_ a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ftta_ a.4.1.1 (A:) Thyroid transcription factor 1 homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d9anta_ a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila melanogaster [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1yz8p1 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ocpa_ a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1xd7a_ a.4.5.55 (A:) Hypothetical protein ywnA {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2fbka1 a.4.5.28 (A:8-179) Transcriptional regulator DR1159 {Deinococcus radiodurans [TaxId: 1299]} | Back information, alignment and structure |
|---|
| >d2ecba1 a.4.1.1 (A:8-83) Zinc fingers and homeoboxes protein 1, ZHX1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v4ra1 a.4.5.6 (A:1-100) Transcriptional repressor TraR, N-terminal domain {Streptomyces sp. [TaxId: 1931]} | Back information, alignment and structure |
|---|