Citrus Sinensis ID: 038599

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470---
MKSQKKWPAPSVMASGLLLALSFLGYIYHPLQSLAVAAVIFGLPAILIRSIASIKSLTFNINVLILMAVLIFCAFSKAATTGLLVKGGDYLEILAKVKMVALDKTGTVTRGEFTVTDFQSICDDVSLGTLLYWVSSIESKSSHPMAAALVDYARSLAIEPVPENVEDFQNFPGEGIFGKIHGNVIYIGNRRIGPRTGCSKDSIAEAKCTGGKTRGYVYLGATPVGTFSLSDSCRSGALEAIKDLKSLGIKSFILAGDSHAAALYAQDQLDHAFDMVYAELLPQHKEELVELLKKDGATAMVGDGINDAPALAAVDIGISMGISGSALAMESGHVILMSNDIRKIPKAIKLARKASTKLIQNVTLSVTVKGAVLVLAVAGYPLVWVAVLTDVGTCLVVILNSMLLLKNNLEEEGGFWKSKYGTFSLSCKKDEDKEALNVKNCRSRCCEATSAKDMASTSLQGQTGPNPCCFSSS
cccccccccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHccccccccccHHHccccccccEEEEHHHHHHHHHHHHHccEEEEcHHHHHHcccccEEEEcccccccccEEEEEEEEEccccccHHHHHHHHHHHHcccccHHHHHHHHHHHHcccccccccccccccccccEEEEEEccEEEEEEcccccccccccHHHHHHHHHccccEEEEEEEccEEEEEEEEcccccHHHHHHHHHHHHccccEEEcccccHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccEEEEcccccHHHHHHHccHHHHcccccHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccHHHHHcccccccccccccccccccccccccccccccccccc
cccHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHcHHHHHHHHHHHHHEEEEEEEEEccccEEEEEccHcccccEEEEcHHHHHHHccccEEEEEccccEcccccEEEEEEEccccccHHHHHHHHHHHHcccccHHHHHHHHHHHHcccccccccccHcccccccEEEEEEcccEEEEccHHHHHHccccHHHHHHHHHHccccEEEEEEcccEEEEEEEEccccHcHHHHHHHHHHcccEEEEEEcccHHHHHHHHHHHcccHHHEHHEcccHHHHHHHHHHHHcccEEEEccccccHHHHHHccEEEEEccccHHHHHHHHcEEEEcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccEEcccccHHHHHHcccccccccccccccccccccccccccccccccccccc
mksqkkwpapsvmASGLLLALSFLGYIYHPLQSLAVAAVIFGLPAILIRSIASIKSLTFNINVLILMAVLIFCAFSKAATTGLLVKGGDYLEILAKVKMVALdktgtvtrgeftvtdfqsicddvslGTLLYWVSSiesksshpMAAALVDYARSlaiepvpenvedfqnfpgegifgkIHGNVIYignrrigprtgcskdsiaeakctggktrgyvylgatpvgtfslsdsCRSGALEAIKDLKSLGIKSFILAGDSHAAALYAQDQLDHAFDMVYAELLPQHKEELVELLKKDgatamvgdgindapalAAVDIGISMGISGSALAMESGHVILMSNDIRKIPKAIKLARKASTKLIQNVTLSVTVKGAVLVLAVAGYPLVWVAVLTDVGTCLVVILNSMLLLKNNLeeeggfwkskygtfslsckkdedkealnvkncrsrcceatsakdmastslqgqtgpnpccfsss
mksqkkwpapsVMASGLLLALSFLGYIYHPLQSLAVAAVIFGLPAILIRSIASIKSLTFNINVLILMAVLIFCAFSKAATTGLLVKGGDYLEILAKVKMVALDKTgtvtrgeftvtdfqsicdDVSLGTLLYWVSSIESKSSHPMAAALVDYARSLAIEPVPENVEDFQNFPGEGIFGKIHGNVIYIGNRRIGPRTGCSKDSIAEAKCTGGKTRGYVYLGATPVGTFSLSDSCRSGALEAIKDLKSLGIKSFILAGDSHAAALYAQDQLDHAFDMVYAELLPQHKEELVELLKKDGATAMVGDGINDAPALAAVDIGISMGISGSALAMESGHVILMSNDIRKIPKAIKLARKASTKLIQNVTLSVTVKGAVLVLAVAGYPLVWVAVLTDVGTCLVVILNSMLLLKNNLEEEGGFWKSKYGTFSLSCKKDedkealnvkncrSRCCEATSAKDmastslqgqtgpnpccfsss
MKSQKKWPAPSVMasglllalsflgYIYHPLQSLAVAAVIFGLPAILIRSIASIKSLTFNINVLILMAVLIFCAFSKAATTGLLVKGGDYLEILAKVKMVALDKTGTVTRGEFTVTDFQSICDDVSLGTLLYWVSSIESKSSHPMAAALVDYARSLAIEPVPENVEDFQNFPGEGIFGKIHGNVIYIGNRRIGPRTGCSKDSIAEAKCTGGKTRGYVYLGATPVGTFSLSDSCRSGALEAIKDLKSLGIKSFILAGDSHAAALYAQDQLDHAFDMVYAELLPQHKEELVELLKKDGATAMVGDGINDAPALAAVDIGISMGISGSALAMESGHVILMSNDIRKIPKAIKLARKASTKLIQNVTLSvtvkgavlvlavagyplvWVAVLTDVGTCLVVIlnsmlllknnleeeGGFWKSKYGTFSLSCKKDEDKEALNVKNCRSRCCEATSAKDMASTSLQGQTGPNPCCFSSS
***********VMASGLLLALSFLGYIYHPLQSLAVAAVIFGLPAILIRSIASIKSLTFNINVLILMAVLIFCAFSKAATTGLLVKGGDYLEILAKVKMVALDKTGTVTRGEFTVTDFQSICDDVSLGTLLYWVSSIES***HPMAAALVDYARSLAIEPVPENVEDFQNFPGEGIFGKIHGNVIYIGNRRIGPRTGCSKDSIAEAKCTGGKTRGYVYLGATPVGTFSLSDSCRSGALEAIKDLKSLGIKSFILAGDSHAAALYAQDQLDHAFDMVYAELLPQHKEELVELLKKDGATAMVGDGINDAPALAAVDIGISMGISGSALAMESGHVILMSNDIRKIPKAIKLARKASTKLIQNVTLSVTVKGAVLVLAVAGYPLVWVAVLTDVGTCLVVILNSMLLLKNNLEEEGGFWKSKYGTFSLSCK********NVKNCR**C****************************
MKSQKKWPAPSVMASGLLLALSFLGYIYHPLQSLAVAAVIFGLPAILIRSIASIKSLTFNINVLILMAVLIFCAFSKAATTGLLVKGGDYLEILAKVKMVALDKTGTVTRGEFTVTDFQSICDDVSLGTLLYWVSSIESKSSHPMAAALVDYARSLAIEPVPENVEDFQNFPGEGIFGKIHGNVIYIGNRRIGPRTGCSKDSIAEAKCTGGKTRGYVYLGATPVGTFSLSDSCRSGALEAIKDLKSLGIKSFILAGDSHAAALYAQDQLDHAFDMVYAELLPQHKEELVELLKKDGATAMVGDGINDAPALAAVDIGISMGISGSALAMESGHVILMSNDIRKIPKAIKLARKASTKLIQNVTLSVTVKGAVLVLAVAGYPLVWVAVLTDVGTCLVVILNSMLL*********************************************************************
**********SVMASGLLLALSFLGYIYHPLQSLAVAAVIFGLPAILIRSIASIKSLTFNINVLILMAVLIFCAFSKAATTGLLVKGGDYLEILAKVKMVALDKTGTVTRGEFTVTDFQSICDDVSLGTLLYWVSSIESKSSHPMAAALVDYARSLAIEPVPENVEDFQNFPGEGIFGKIHGNVIYIGNRRIGPRTGCSKDSIAEAKCTGGKTRGYVYLGATPVGTFSLSDSCRSGALEAIKDLKSLGIKSFILAGDSHAAALYAQDQLDHAFDMVYAELLPQHKEELVELLKKDGATAMVGDGINDAPALAAVDIGISMGISGSALAMESGHVILMSNDIRKIPKAIKLARKASTKLIQNVTLSVTVKGAVLVLAVAGYPLVWVAVLTDVGTCLVVILNSMLLLKNNLEEEGGFWKSKYGTFSLSCKKDEDKEALNVKNCRSRCCEATSAKDMASTSLQGQTGPNPCCFSSS
MKSQKKWPAPSVMASGLLLALSFLGYIYHPLQSLAVAAVIFGLPAILIRSIASIKSLTFNINVLILMAVLIFCAFSKAATTGLLVKGGDYLEILAKVKMVALDKTGTVTRGEFTVTDFQSICDDVSLGTLLYWVSSIESKSSHPMAAALVDYARSLAIEPVPENVEDFQNFPGEGIFGKIHGNVIYIGNRRIGPRTGCSKDSIAEAKCTGGKTRGYVYLGATPVGTFSLSDSCRSGALEAIKDLKSLGIKSFILAGDSHAAALYAQDQLDHAFDMVYAELLPQHKEELVELLKKDGATAMVGDGINDAPALAAVDIGISMGISGSALAMESGHVILMSNDIRKIPKAIKLARKASTKLIQNVTLSVTVKGAVLVLAVAGYPLVWVAVLTDVGTCLVVILNSMLLLKNNLEEEG************************************************************
iiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiHHHHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHHiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiHHHHHHHHHHHHHHHHooooooHHHHHHHHHHHHHHHHHHHHiiiRRRRRRRRRRRRRRRRRRRRRRRRiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHoooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiHHHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKSQKKWPAPSVMASGLLLALSFLGYIYHPLQSLAVAAVIFGLPAILIRSIASIKSLTFNINVLILMAVLIFCAFSKAATTGLLVKGGDYLEILAKVKMVALDKTGTVTRGEFTVTDFQSICDDVSLGTLLYWVSSIESKSSHPMAAALVDYARSLAIEPVPENVEDFQNFPGEGIFGKIHGNVIYIGNRRIGPRTGCSKDSIAEAKCTGGKTRGYVYLGATPVGTFSLSDSCRSGALEAIKDLKSLGIKSFILAGDSHAAALYAQDQLDHAFDMVYAELLPQHKEELVELLKKDGATAMVGDGINDAPALAAVDIGISMGISGSALAMESGHVILMSNDIRKIPKAIKLARKASTKLIQNVTLSVTVKGAVLVLAVAGYPLVWVAVLTDVGTCLVVILNSMLLLKNNLEEEGGFWKSKYGTFSLSCKKDEDKEALNVKNCRSRCCEATSAKDMASTSLQGQTGPNPCCFSSS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query473 2.2.26 [Sep-21-2011]
Q9SZW4 951 Cadmium/zinc-transporting yes no 0.847 0.421 0.578 1e-134
O64474 1172 Putative cadmium/zinc-tra no no 0.784 0.316 0.557 1e-127
P0CW78760 Cadmium/zinc-transporting no no 0.830 0.517 0.521 1e-121
P0CW77542 Putative inactive cadmium no no 0.467 0.407 0.484 4e-60
Q6GIX1726 Probable cadmium-transpor yes no 0.805 0.524 0.334 2e-53
P37386804 Probable cadmium-transpor yes no 0.805 0.473 0.334 8e-53
Q60048711 Probable cadmium-transpor yes no 0.710 0.472 0.363 2e-52
P30336723 Probable cadmium-transpor no no 0.706 0.461 0.355 7e-52
P20021727 Probable cadmium-transpor yes no 0.809 0.526 0.318 4e-51
P58414707 Probable cadmium-transpor yes no 0.799 0.534 0.309 7e-47
>sp|Q9SZW4|HMA2_ARATH Cadmium/zinc-transporting ATPase HMA2 OS=Arabidopsis thaliana GN=HMA2 PE=2 SV=1 Back     alignment and function desciption
 Score =  478 bits (1230), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 239/413 (57%), Positives = 307/413 (74%), Gaps = 12/413 (2%)

Query: 69  VLIFCAFSKAATTGLLVKGGDYLEILAKVKMVALDKTGTVTRGEFTVTDFQSICDDVSLG 128
           V  FCA +KAAT+GLL+KG DYLE LAK+K+VA DKTGT+TRGEF V DFQS+ +D+SL 
Sbjct: 357 VATFCALTKAATSGLLIKGADYLETLAKIKIVAFDKTGTITRGEFIVMDFQSLSEDISLQ 416

Query: 129 TLLYWVSSIESKSSHPMAAALVDYARSLAIEPVPENVEDFQNFPGEGIFGKIHGNVIYIG 188
           +LLYWVSS ESKSSHPMAAA+VDYARS+++EP PE VED+QNFPGEGI+GKI G  +YIG
Sbjct: 417 SLLYWVSSTESKSSHPMAAAVVDYARSVSVEPKPEAVEDYQNFPGEGIYGKIDGKEVYIG 476

Query: 189 NRRIGPRTGCSKDSIAEAKCTGGKTRGYVYLGATPVGTFSLSDSCRSGALEAIKDLKSLG 248
           N+RI  R GC      +    GGKT GYVY+G T  G F+LSD+CRSG  +A+K+LKSLG
Sbjct: 477 NKRIASRAGCLSVPDIDVDTKGGKTIGYVYVGETLAGVFNLSDACRSGVAQAMKELKSLG 536

Query: 249 IKSFILAGDSHAAALYAQDQLDHAFDMVYAELLPQHKEELVELLKK-DGATAMVGDGIND 307
           IK  +L GD+HAAA++AQ+QL +A D+V AELLP+ K E+++ LK+ +G TAMVGDG+ND
Sbjct: 537 IKIAMLTGDNHAAAMHAQEQLGNAMDIVRAELLPEDKSEIIKQLKREEGPTAMVGDGLND 596

Query: 308 APALAAVDIGISMGISGSALAMESGHVILMSNDIRKIPKAIKLARKASTKLIQNVTLSVT 367
           APALA  DIGISMG+SGSALA E+G++ILMSNDIR+IP+AIKLA++A  K+++NV +S+T
Sbjct: 597 APALATADIGISMGVSGSALATETGNIILMSNDIRRIPQAIKLAKRAKRKVVENVVISIT 656

Query: 368 VKGAVLVLAVAGYPLVWVAVLTDVGTCLVVILNSMLLLKNNLEEEGGFWKSKYGTFSLSC 427
           +KGA+L LA AG+PL+W AVL DVGTCL+VILNSMLLL +  +     ++    +  L  
Sbjct: 657 MKGAILALAFAGHPLIWAAVLADVGTCLLVILNSMLLLSDKHKTGNKCYRESSSSSVLIA 716

Query: 428 KKDE-----DKEA-----LNVKNCRSRCC-EATSAKDMASTSLQGQTGPNPCC 469
           +K E     D EA     ++ K+C+  CC   T  K M           + CC
Sbjct: 717 EKLEGDAAGDMEAGLLPKISDKHCKPGCCGTKTQEKAMKPAKASSDHSHSGCC 769
Plays an important role in zinc transport and homeostasis. Could also be involved in cadmium detoxification.
Arabidopsis thaliana (taxid: 3702)
EC: 3EC: .EC: 6EC: .EC: 3EC: .EC: 5
>sp|O64474|HMA4_ARATH Putative cadmium/zinc-transporting ATPase HMA4 OS=Arabidopsis thaliana GN=HMA4 PE=1 SV=2 Back     alignment and function description
>sp|P0CW78|HMA3B_ARATH Cadmium/zinc-transporting ATPase HMA3 OS=Arabidopsis thaliana GN=HMA3 PE=1 SV=1 Back     alignment and function description
>sp|P0CW77|HMA3A_ARATH Putative inactive cadmium/zinc-transporting ATPase HMA3 OS=Arabidopsis thaliana GN=HMA3 PE=5 SV=1 Back     alignment and function description
>sp|Q6GIX1|CADA_STAAR Probable cadmium-transporting ATPase OS=Staphylococcus aureus (strain MRSA252) GN=cadA PE=3 SV=1 Back     alignment and function description
>sp|P37386|CADA2_STAAU Probable cadmium-transporting ATPase OS=Staphylococcus aureus GN=cadA PE=3 SV=1 Back     alignment and function description
>sp|Q60048|CADA_LISMN Probable cadmium-transporting ATPase OS=Listeria monocytogenes GN=cadA PE=1 SV=1 Back     alignment and function description
>sp|P30336|CADA_BACPE Probable cadmium-transporting ATPase OS=Bacillus pseudofirmus (strain OF4) GN=cadA PE=3 SV=2 Back     alignment and function description
>sp|P20021|CADA1_STAAU Probable cadmium-transporting ATPase OS=Staphylococcus aureus GN=cadA PE=3 SV=1 Back     alignment and function description
>sp|P58414|CADA_LISMO Probable cadmium-transporting ATPase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=cadA PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query473
255582930 962 heavy metal cation transport atpase, put 0.919 0.452 0.537 1e-133
297798966 944 predicted protein [Arabidopsis lyrata su 0.847 0.424 0.576 1e-133
15234620 951 Cd2+/Zn2+-exporting ATPase [Arabidopsis 0.847 0.421 0.578 1e-132
20384833 951 putative heavy-metal transporter [Arabid 0.847 0.421 0.576 1e-131
184160101 1161 Zn/Cd P(IB)-type ATPase [Arabidopsis hal 0.864 0.352 0.538 1e-130
184160086 1163 Zn/Cd P(IB)-type ATPase [Arabidopsis hal 0.864 0.351 0.536 1e-130
63056225 1161 P1B-type ATPase 4 [Arabidopsis halleri s 0.896 0.365 0.526 1e-130
78182999 1161 P1B-type ATPase 4 [Arabidopsis halleri] 0.864 0.352 0.536 1e-129
184160085 1161 Zn/Cd P(IB)-type ATPase [Arabidopsis hal 0.864 0.352 0.533 1e-129
356550732 1076 PREDICTED: cadmium/zinc-transporting ATP 0.746 0.328 0.626 1e-129
>gi|255582930|ref|XP_002532236.1| heavy metal cation transport atpase, putative [Ricinus communis] gi|223528070|gb|EEF30145.1| heavy metal cation transport atpase, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  480 bits (1236), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 248/461 (53%), Positives = 320/461 (69%), Gaps = 26/461 (5%)

Query: 34  LAVAAVIFGLPAILIRSIASI----------KSLTFNINVLILMA-----------VLIF 72
           +A  A ++  PA++I S++ +          ++  F + +++L++           V  F
Sbjct: 288 VAKMAKLYYTPAVIIISVSLVVVPLALRVHNRNRWFRLALVVLVSACPCALILSTPVATF 347

Query: 73  CAFSKAATTGLLVKGGDYLEILAKVKMVALDKTGTVTRGEFTVTDFQSICDDVSLGTLLY 132
           CA +KAAT+G+L+KGGD LE LAK+K++A DKTGT+T+GEF V DF S+C+D+SL TL+Y
Sbjct: 348 CALTKAATSGVLIKGGDSLETLAKIKVMAFDKTGTITKGEFVVVDFGSLCEDISLDTLVY 407

Query: 133 WVSSIESKSSHPMAAALVDYARSLAIEPVPENVEDFQNFPGEGIFGKIHGNVIYIGNRRI 192
           WVSSIESKSSHPMAAALVDYA+SL+IEP PENV +FQNFPGEGI GKI G  IYIGN++I
Sbjct: 408 WVSSIESKSSHPMAAALVDYAKSLSIEPNPENVVEFQNFPGEGIHGKIDGKEIYIGNKKI 467

Query: 193 GPRTGCSKDSIAEAKCTGGKTRGYVYLGATPVGTFSLSDSCRSGALEAIKDLKSLGIKSF 252
           G R G       E +  GGKT GYVY G TP+G FSLSD+CR+G  EA+  LKS+G+K+ 
Sbjct: 468 GLRAGYGTVPTLETEMKGGKTVGYVYSGGTPIGIFSLSDACRTGVAEAVTKLKSMGVKTA 527

Query: 253 ILAGDSHAAALYAQDQLDHAFDMVYAELLPQHKEELVELLKKDGATAMVGDGINDAPALA 312
           +L GDS AAA++AQ+QL HA ++V AELLP+ K  ++E  KK+G TAM+GDG+NDAPALA
Sbjct: 528 MLTGDSQAAAMHAQEQLGHALEVVKAELLPEDKARIIEEFKKEGTTAMIGDGVNDAPALA 587

Query: 313 AVDIGISMGISGSALAMESGHVILMSNDIRKIPKAIKLARKASTKLIQNVTLSVTVKGAV 372
             DIGISMGISGSALA E+G VILMSNDIRKIP  I LARKA  K+I+NV LS++ K A+
Sbjct: 588 TADIGISMGISGSALATETGDVILMSNDIRKIPDVISLARKAHRKVIENVILSMSTKSAI 647

Query: 373 LVLAVAGYPLVWVAVLTDVGTCLVVILNSMLLLKNNLEEEGGFWKSKYGTFSLSCKKDED 432
           L LA AG+PLVW AVL DVGTCL+VI NSMLLL+   +  G   KS   T + S K+D +
Sbjct: 648 LALAFAGHPLVWAAVLADVGTCLLVIFNSMLLLRGTHKHGGKCCKSSSATANTS-KRDNN 706

Query: 433 KEALNVKNCRSR----CCEATSAKDMASTSLQGQTGPNPCC 469
               +   C  R     C +  ++  AS      +   P C
Sbjct: 707 SSEHHHHCCSDRKVETSCNSHESRSCASRCQASDSSVKPSC 747

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|297798966|ref|XP_002867367.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297313203|gb|EFH43626.1| predicted protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|15234620|ref|NP_194740.1| Cd2+/Zn2+-exporting ATPase [Arabidopsis thaliana] gi|12229675|sp|Q9SZW4.1|HMA2_ARATH RecName: Full=Cadmium/zinc-transporting ATPase HMA2; AltName: Full=Cadmium/zinc-transporting ATPase 3; AltName: Full=Protein HEAVY METAL ATPASE 2 gi|4938487|emb|CAB43846.1| cadmium-transporting ATPase-like protein [Arabidopsis thaliana] gi|7269911|emb|CAB81004.1| cadmium-transporting ATPase-like protein [Arabidopsis thaliana] gi|332660322|gb|AEE85722.1| Cd2+/Zn2+-exporting ATPase [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|20384833|gb|AAL14248.1| putative heavy-metal transporter [Arabidopsis thaliana] gi|38050296|gb|AAR10767.1| potential Zn/Cd heavy metal transporter [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|184160101|gb|ACC68167.1| Zn/Cd P(IB)-type ATPase [Arabidopsis halleri subsp. halleri] Back     alignment and taxonomy information
>gi|184160086|gb|ACC68153.1| Zn/Cd P(IB)-type ATPase [Arabidopsis halleri subsp. halleri] Back     alignment and taxonomy information
>gi|63056225|gb|AAY29151.1| P1B-type ATPase 4 [Arabidopsis halleri subsp. gemmifera] Back     alignment and taxonomy information
>gi|78182999|gb|ABB29495.1| P1B-type ATPase 4 [Arabidopsis halleri] Back     alignment and taxonomy information
>gi|184160085|gb|ACC68152.1| Zn/Cd P(IB)-type ATPase [Arabidopsis halleri subsp. halleri] Back     alignment and taxonomy information
>gi|356550732|ref|XP_003543738.1| PREDICTED: cadmium/zinc-transporting ATPase 3-like [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query473
TAIR|locus:2126490 951 HMA2 "heavy metal atpase 2" [A 0.858 0.426 0.534 4e-121
TAIR|locus:2059083 1172 HMA4 "heavy metal atpase 4" [A 0.708 0.285 0.589 2.8e-119
TAIR|locus:2126500542 HMA3 "heavy metal atpase 3" [A 0.386 0.337 0.586 2.3e-55
TIGR_CMR|GSU_2147713 GSU_2147 "cadmium-translocatin 0.693 0.460 0.383 5.2e-49
UNIPROTKB|Q87UL7752 cadA-1 "Cadmium-translocating 0.693 0.436 0.345 1.1e-44
TIGR_CMR|CHY_0860686 CHY_0860 "cation-transporting 0.752 0.518 0.328 2.5e-43
TIGR_CMR|BA_0410641 BA_0410 "heavy metal-transport 0.596 0.439 0.371 4.4e-42
UNIPROTKB|P63689771 ctpG "Probable cation-transpor 0.672 0.412 0.340 5.1e-39
TIGR_CMR|SO_1689753 SO_1689 "cation transport ATPa 0.676 0.424 0.349 1.6e-38
TIGR_CMR|BA_0595788 BA_0595 "heavy metal-transport 0.761 0.456 0.307 1.8e-37
TAIR|locus:2126490 HMA2 "heavy metal atpase 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1091 (389.1 bits), Expect = 4.0e-121, Sum P(2) = 4.0e-121
 Identities = 224/419 (53%), Positives = 285/419 (68%)

Query:    64 LILMA-VLIFCAFSKAATTGLLVKGGDYLEILAKVKMVALDKTGTVTRGEFTVTDFQSIC 122
             LIL   V  FCA +KAAT+GLL+KG DYLE LAK+K+VA DKTGT+TRGEF V DFQS+ 
Sbjct:   351 LILSTPVATFCALTKAATSGLLIKGADYLETLAKIKIVAFDKTGTITRGEFIVMDFQSLS 410

Query:   123 DDVSLGTLLYWVSSIESKSSHPMAAALVDYARSLAIEPVPENVEDFQNFPGEGIFGKIHG 182
             +D+SL +LLYWVSS ESKSSHPMAAA+VDYARS+++EP PE VED+QNFPGEGI+GKI G
Sbjct:   411 EDISLQSLLYWVSSTESKSSHPMAAAVVDYARSVSVEPKPEAVEDYQNFPGEGIYGKIDG 470

Query:   183 NVIYIGNRRIGPRTGCSKDSIAEAKCTGGKTRGYVYLGATPVGTFSLSDSCRSGALEAIK 242
               +YIGN+RI  R GC      +    GGKT GYVY+G T  G F+LSD+CRSG  +A+K
Sbjct:   471 KEVYIGNKRIASRAGCLSVPDIDVDTKGGKTIGYVYVGETLAGVFNLSDACRSGVAQAMK 530

Query:   243 DLKSLGIKSFILAGDSHAAALYAQDQLDHAFDMVYAELLPQHKEELVELLKKD-GATAMV 301
             +LKSLGIK  +L GD+HAAA++AQ+QL +A D+V AELLP+ K E+++ LK++ G TAMV
Sbjct:   531 ELKSLGIKIAMLTGDNHAAAMHAQEQLGNAMDIVRAELLPEDKSEIIKQLKREEGPTAMV 590

Query:   302 GDGINDAPALAAVDIGISMGISGSALAMESGHVILMSNDIRKIPKAIKLARKASTKLIQN 361
             GDG+NDAPALA  DIGISMG+SGSALA E+G++ILMSNDIR+IP+AIKLA++A  K+++N
Sbjct:   591 GDGLNDAPALATADIGISMGVSGSALATETGNIILMSNDIRRIPQAIKLAKRAKRKVVEN 650

Query:   362 VTLSXXXXXXXXXXXXXXXXXXWVAVLTDVGTCLVVIXXXXXXXXXXXXXXGGFWKSKYG 421
             V +S                  W AVL DVGTCL+VI                 ++    
Sbjct:   651 VVISITMKGAILALAFAGHPLIWAAVLADVGTCLLVILNSMLLLSDKHKTGNKCYRESSS 710

Query:   422 TFSLSCKKDE-----DKEA-----LNVKNCRSRCCEA-TSAKDMASTSLQGQTGPNPCC 469
             +  L  +K E     D EA     ++ K+C+  CC   T  K M           + CC
Sbjct:   711 SSVLIAEKLEGDAAGDMEAGLLPKISDKHCKPGCCGTKTQEKAMKPAKASSDHSHSGCC 769
GO:0000166 "nucleotide binding" evidence=IEA
GO:0003824 "catalytic activity" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
GO:0006754 "ATP biosynthetic process" evidence=IEA
GO:0006812 "cation transport" evidence=IEA
GO:0008152 "metabolic process" evidence=IEA
GO:0015434 "cadmium-transporting ATPase activity" evidence=ISS
GO:0015662 "ATPase activity, coupled to transmembrane movement of ions, phosphorylative mechanism" evidence=IEA
GO:0016020 "membrane" evidence=IEA
GO:0016021 "integral to membrane" evidence=IEA
GO:0016818 "hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides" evidence=IEA
GO:0030001 "metal ion transport" evidence=IEA
GO:0046872 "metal ion binding" evidence=IEA
GO:0046873 "metal ion transmembrane transporter activity" evidence=IEA
GO:0005886 "plasma membrane" evidence=IDA
GO:0055069 "zinc ion homeostasis" evidence=IGI
TAIR|locus:2059083 HMA4 "heavy metal atpase 4" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2126500 HMA3 "heavy metal atpase 3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TIGR_CMR|GSU_2147 GSU_2147 "cadmium-translocating P-type ATPase" [Geobacter sulfurreducens PCA (taxid:243231)] Back     alignment and assigned GO terms
UNIPROTKB|Q87UL7 cadA-1 "Cadmium-translocating P-type ATPase" [Pseudomonas syringae pv. tomato str. DC3000 (taxid:223283)] Back     alignment and assigned GO terms
TIGR_CMR|CHY_0860 CHY_0860 "cation-transporting ATPase, E1-E2 family, selenocysteine-containing" [Carboxydothermus hydrogenoformans Z-2901 (taxid:246194)] Back     alignment and assigned GO terms
TIGR_CMR|BA_0410 BA_0410 "heavy metal-transporting ATPase" [Bacillus anthracis str. Ames (taxid:198094)] Back     alignment and assigned GO terms
UNIPROTKB|P63689 ctpG "Probable cation-transporting ATPase G" [Mycobacterium tuberculosis (taxid:1773)] Back     alignment and assigned GO terms
TIGR_CMR|SO_1689 SO_1689 "cation transport ATPase, E1-E2 family" [Shewanella oneidensis MR-1 (taxid:211586)] Back     alignment and assigned GO terms
TIGR_CMR|BA_0595 BA_0595 "heavy metal-transporting ATPase" [Bacillus anthracis str. Ames (taxid:198094)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.6.30.691

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query473
TIGR01512536 TIGR01512, ATPase-IB2_Cd, heavy metal-(Cd/Co/Hg/Pb 1e-107
TIGR01525556 TIGR01525, ATPase-IB_hvy, heavy metal translocatin 5e-99
COG2217713 COG2217, ZntA, Cation transport ATPase [Inorganic 3e-93
TIGR01511572 TIGR01511, ATPase-IB1_Cu, copper-(or silver)-trans 2e-69
PRK11033741 PRK11033, zntA, zinc/cadmium/mercury/lead-transpor 3e-59
TIGR01494543 TIGR01494, ATPase_P-type, ATPase, P-type (transpor 2e-42
PRK10671834 PRK10671, copA, copper exporting ATPase; Provision 1e-34
COG0474917 COG0474, MgtA, Cation transport ATPase [Inorganic 4e-22
TIGR01522884 TIGR01522, ATPase-IIA2_Ca, golgi membrane calcium- 1e-16
TIGR01517944 TIGR01517, ATPase-IIB_Ca, plasma-membrane calcium- 1e-15
TIGR01497675 TIGR01497, kdpB, K+-transporting ATPase, B subunit 2e-15
TIGR01116917 TIGR01116, ATPase-IIA1_Ca, sarco/endoplasmic retic 3e-15
COG2216681 COG2216, KdpB, High-affinity K+ transport system, 5e-15
pfam00702187 pfam00702, Hydrolase, haloacid dehalogenase-like h 2e-14
PRK14010673 PRK14010, PRK14010, potassium-transporting ATPase 2e-14
PRK10517902 PRK10517, PRK10517, magnesium-transporting ATPase 7e-14
TIGR01524867 TIGR01524, ATPase-IIIB_Mg, magnesium-translocating 2e-12
TIGR01106 997 TIGR01106, ATPase-IIC_X-K, sodium or proton efflux 2e-11
TIGR01523 1053 TIGR01523, ATPase-IID_K-Na, potassium and/or sodiu 4e-10
TIGR01647754 TIGR01647, ATPase-IIIA_H, plasma-membrane proton-e 4e-10
PRK15122903 PRK15122, PRK15122, magnesium-transporting ATPase; 4e-10
PRK01122679 PRK01122, PRK01122, potassium-transporting ATPase 7e-10
TIGR016571054 TIGR01657, P-ATPase-V, P-type ATPase of unknown pu 4e-08
COG0560212 COG0560, SerB, Phosphoserine phosphatase [Amino ac 2e-06
COG4087152 COG4087, COG4087, Soluble P-type ATPase [General f 6e-06
TIGR00338219 TIGR00338, serB, phosphoserine phosphatase SerB 6e-05
COG0546220 COG0546, Gph, Predicted phosphatases [General func 2e-04
cd01427139 cd01427, HAD_like, Haloacid dehalogenase-like hydr 0.001
>gnl|CDD|211664 TIGR01512, ATPase-IB2_Cd, heavy metal-(Cd/Co/Hg/Pb/Zn)-translocating P-type ATPase Back     alignment and domain information 
 Score =  328 bits (842), Expect = e-107
 Identities = 147/390 (37%), Positives = 214/390 (54%), Gaps = 28/390 (7%)

Query: 24  LGYIYHPLQSLAVAAVIFGLPAILIRSIASIKSLTFNI-----NVLILMAVLIFCAFSKA 78
               Y P+      A+      +        ++L   +      ++I        A S A
Sbjct: 168 FARYYTPVVLAIALAIWLVPGLLKRWPFWVYRALVLLVVASPCALVISAPAAYLSAISAA 227

Query: 79  ATTGLLVKGGDYLEILAKVKMVALDKTGTVTRGEFTVTDFQSICDDVSLGTLLYWVSSIE 138
           A  G+L+KGG  LE LAK+K VA DKTGT+T G   V D            +L   ++ E
Sbjct: 228 ARHGILIKGGAALEALAKIKTVAFDKTGTLTTGRPKVVDVVPA-------EVLRLAAAAE 280

Query: 139 SKSSHPMAAALVDYARSLAIEPVPENVEDFQNFPGEGIFGKIHGNVIYIGNRRIGPRTGC 198
             SSHP+A A+VDYAR        ENVE  +  PGEG+   + G  + IGN R       
Sbjct: 281 QASSHPLARAIVDYARKR------ENVESVEEVPGEGVRAVVDGGEVRIGNPRSLEAAVG 334

Query: 199 SKDSIAEAKCTGGKTRGYVYLGATPVGTFSLSDSCRSGALEAIKDLKSLGIKSF-ILAGD 257
           ++        + GKT  +V    T +G   LSD  R  A EAI +LK+LGI+   +L GD
Sbjct: 335 ARP------ESAGKTIVHVARDGTYLGYILLSDEPRPDAAEAIAELKALGIEKVVMLTGD 388

Query: 258 SHAAALYAQDQLDHAFDMVYAELLPQHKEELV-ELLKKDGATAMVGDGINDAPALAAVDI 316
             A A     +L    D V+AELLP+ K E+V EL +K G  AMVGDGINDAPALAA D+
Sbjct: 389 RRAVAERVAREL--GIDEVHAELLPEDKLEIVKELREKYGPVAMVGDGINDAPALAAADV 446

Query: 317 GISMGISGSALAMESGHVILMSNDIRKIPKAIKLARKASTKLIQNVTLSVTVKGAVLVLA 376
           GI+MG SGS +A+E+  V+L+++D+ ++P+AI+LAR+    + QNV +++ +   +++LA
Sbjct: 447 GIAMGASGSDVAIETADVVLLNDDLSRLPQAIRLARRTRRIVKQNVVIALGIILLLILLA 506

Query: 377 VAGYPLVWVAVLTDVGTCLVVILNSMLLLK 406
           + G   +W+AVL   G+ ++VILN++ LL+
Sbjct: 507 LFGVLPLWLAVLGHEGSTVLVILNALRLLR 536

This model describes the P-type ATPase primarily responsible for translocating cadmium ions (and other closely-related divalent heavy metals such as cobalt, mercury, lead and zinc) across biological membranes. These transporters are found in prokaryotes and plants. Experimentally characterized members of the seed alignment include: SP|P37617 from E. coli, SP|Q10866 from Mycobacterium tuberculosis and SP|Q59998 from Synechocystis PCC6803. The cadmium P-type ATPases have been characterized as Type IB based on a phylogenetic analysis which combines the copper-translocating ATPases with the cadmium-translocating species. This model and that describing the copper-ATPases (TIGR01511) are well separated, and thus we further type the copper-ATPases as IB1 and the cadmium-ATPases as IB2. Several sequences which have not been characterized experimentally fall just below trusted cutoff for both of these models (SP|Q9CCL1 from Mycobacterium leprae, GP|13816263 from Sulfolobus solfataricus, OMNI|NTL01CJ01098 from Campylobacter jejuni, OMNI|NTL01HS01687 from Halobacterium sp., GP|6899169 from Ureaplasma urealyticum and OMNI|HP1503 from Helicobacter pylori) [Transport and binding proteins, Cations and iron carrying compounds]. Length = 536
>gnl|CDD|233447 TIGR01525, ATPase-IB_hvy, heavy metal translocating P-type ATPase Back     alignment and domain information
>gnl|CDD|225127 COG2217, ZntA, Cation transport ATPase [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|233445 TIGR01511, ATPase-IB1_Cu, copper-(or silver)-translocating P-type ATPase Back     alignment and domain information
>gnl|CDD|236827 PRK11033, zntA, zinc/cadmium/mercury/lead-transporting ATPase; Provisional Back     alignment and domain information
>gnl|CDD|233438 TIGR01494, ATPase_P-type, ATPase, P-type (transporting), HAD superfamily, subfamily IC Back     alignment and domain information
>gnl|CDD|182635 PRK10671, copA, copper exporting ATPase; Provisional Back     alignment and domain information
>gnl|CDD|223550 COG0474, MgtA, Cation transport ATPase [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|130585 TIGR01522, ATPase-IIA2_Ca, golgi membrane calcium-translocating P-type ATPase Back     alignment and domain information
>gnl|CDD|188151 TIGR01517, ATPase-IIB_Ca, plasma-membrane calcium-translocating P-type ATPase Back     alignment and domain information
>gnl|CDD|130561 TIGR01497, kdpB, K+-transporting ATPase, B subunit Back     alignment and domain information
>gnl|CDD|233277 TIGR01116, ATPase-IIA1_Ca, sarco/endoplasmic reticulum calcium-translocating P-type ATPase Back     alignment and domain information
>gnl|CDD|225126 COG2216, KdpB, High-affinity K+ transport system, ATPase chain B [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|216069 pfam00702, Hydrolase, haloacid dehalogenase-like hydrolase Back     alignment and domain information
>gnl|CDD|184448 PRK14010, PRK14010, potassium-transporting ATPase subunit B; Provisional Back     alignment and domain information
>gnl|CDD|236705 PRK10517, PRK10517, magnesium-transporting ATPase MgtA; Provisional Back     alignment and domain information
>gnl|CDD|130587 TIGR01524, ATPase-IIIB_Mg, magnesium-translocating P-type ATPase Back     alignment and domain information
>gnl|CDD|130176 TIGR01106, ATPase-IIC_X-K, sodium or proton efflux -- potassium uptake antiporter, P-type ATPase, alpha subunit Back     alignment and domain information
>gnl|CDD|130586 TIGR01523, ATPase-IID_K-Na, potassium and/or sodium efflux P-type ATPase, fungal-type Back     alignment and domain information
>gnl|CDD|233506 TIGR01647, ATPase-IIIA_H, plasma-membrane proton-efflux P-type ATPase Back     alignment and domain information
>gnl|CDD|237914 PRK15122, PRK15122, magnesium-transporting ATPase; Provisional Back     alignment and domain information
>gnl|CDD|234905 PRK01122, PRK01122, potassium-transporting ATPase subunit B; Provisional Back     alignment and domain information
>gnl|CDD|233513 TIGR01657, P-ATPase-V, P-type ATPase of unknown pump specificity (type V) Back     alignment and domain information
>gnl|CDD|223634 COG0560, SerB, Phosphoserine phosphatase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|226572 COG4087, COG4087, Soluble P-type ATPase [General function prediction only] Back     alignment and domain information
>gnl|CDD|232927 TIGR00338, serB, phosphoserine phosphatase SerB Back     alignment and domain information
>gnl|CDD|223620 COG0546, Gph, Predicted phosphatases [General function prediction only] Back     alignment and domain information
>gnl|CDD|119389 cd01427, HAD_like, Haloacid dehalogenase-like hydrolases Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 473
COG2217713 ZntA Cation transport ATPase [Inorganic ion transp 100.0
KOG0207951 consensus Cation transport ATPase [Inorganic ion t 100.0
PRK11033741 zntA zinc/cadmium/mercury/lead-transporting ATPase 100.0
TIGR01647755 ATPase-IIIA_H plasma-membrane proton-efflux P-type 100.0
PRK10671834 copA copper exporting ATPase; Provisional 100.0
TIGR01525556 ATPase-IB_hvy heavy metal translocating P-type ATP 100.0
TIGR01512536 ATPase-IB2_Cd heavy metal-(Cd/Co/Hg/Pb/Zn)-translo 100.0
PRK14010673 potassium-transporting ATPase subunit B; Provision 100.0
PRK15122903 magnesium-transporting ATPase; Provisional 100.0
TIGR01524867 ATPase-IIIB_Mg magnesium-translocating P-type ATPa 100.0
PRK10517902 magnesium-transporting ATPase MgtA; Provisional 100.0
PRK01122679 potassium-transporting ATPase subunit B; Provision 100.0
TIGR01511562 ATPase-IB1_Cu copper-(or silver)-translocating P-t 100.0
TIGR01517941 ATPase-IIB_Ca plasma-membrane calcium-translocatin 100.0
COG0474917 MgtA Cation transport ATPase [Inorganic ion transp 100.0
TIGR01497675 kdpB K+-transporting ATPase, B subunit. One sequen 100.0
KOG0202 972 consensus Ca2+ transporting ATPase [Inorganic ion 100.0
TIGR01522884 ATPase-IIA2_Ca golgi membrane calcium-translocatin 100.0
TIGR01523 1053 ATPase-IID_K-Na potassium and/or sodium efflux P-t 100.0
KOG0204 1034 consensus Calcium transporting ATPase [Inorganic i 100.0
TIGR01106 997 ATPase-IIC_X-K sodium or proton efflux -- potassiu 100.0
TIGR01494499 ATPase_P-type ATPase, P-type (transporting), HAD s 100.0
TIGR016571054 P-ATPase-V P-type ATPase of unknown pump specifici 100.0
TIGR01116917 ATPase-IIA1_Ca sarco/endoplasmic reticulum calcium 100.0
KOG0208 1140 consensus Cation transport ATPase [Inorganic ion t 100.0
KOG0203 1019 consensus Na+/K+ ATPase, alpha subunit [Inorganic 100.0
COG2216681 KdpB High-affinity K+ transport system, ATPase cha 100.0
TIGR016521057 ATPase-Plipid phospholipid-translocating P-type AT 100.0
KOG0205 942 consensus Plasma membrane H+-transporting ATPase [ 100.0
KOG0209 1160 consensus P-type ATPase [Inorganic ion transport a 100.0
PLN03190 1178 aminophospholipid translocase; Provisional 100.0
PF00702215 Hydrolase: haloacid dehalogenase-like hydrolase; I 99.98
KOG02101051 consensus P-type ATPase [Inorganic ion transport a 99.95
KOG0206 1151 consensus P-type ATPase [General function predicti 99.9
COG4087152 Soluble P-type ATPase [General function prediction 99.7
TIGR02137203 HSK-PSP phosphoserine phosphatase/homoserine phosp 99.22
PRK11133322 serB phosphoserine phosphatase; Provisional 99.08
TIGR00338219 serB phosphoserine phosphatase SerB. Phosphoserine 99.02
TIGR01670154 YrbI-phosphatas 3-deoxy-D-manno-octulosonate 8-pho 99.0
PRK01158230 phosphoglycolate phosphatase; Provisional 98.95
PRK10513270 sugar phosphate phosphatase; Provisional 98.94
COG0561264 Cof Predicted hydrolases of the HAD superfamily [G 98.94
TIGR01487215 SPP-like sucrose-phosphate phosphatase-like hydrol 98.93
PRK09484183 3-deoxy-D-manno-octulosonate 8-phosphate phosphata 98.91
TIGR02726169 phenyl_P_delta phenylphosphate carboxylase, delta 98.88
PRK15126272 thiamin pyrimidine pyrophosphate hydrolase; Provis 98.87
PRK10976266 putative hydrolase; Provisional 98.86
COG0560212 SerB Phosphoserine phosphatase [Amino acid transpo 98.85
PRK13582205 thrH phosphoserine phosphatase; Provisional 98.83
PRK10530272 pyridoxal phosphate (PLP) phosphatase; Provisional 98.81
TIGR01482225 SPP-subfamily Sucrose-phosphate phosphatase subfam 98.81
COG1778170 Low specificity phosphatase (HAD superfamily) [Gen 98.78
KOG1615227 consensus Phosphoserine phosphatase [Amino acid tr 98.76
PF08282254 Hydrolase_3: haloacid dehalogenase-like hydrolase; 98.71
PLN02887580 hydrolase family protein 98.68
TIGR01491201 HAD-SF-IB-PSPlk HAD-superfamily, subfamily-IB PSPa 98.66
TIGR00099256 Cof-subfamily Cof subfamily of IIB subfamily of ha 98.6
PLN02954224 phosphoserine phosphatase 98.59
COG0546220 Gph Predicted phosphatases [General function predi 98.5
PF12710192 HAD: haloacid dehalogenase-like hydrolase; PDB: 3P 98.47
TIGR03333214 salvage_mtnX 2-hydroxy-3-keto-5-methylthiopentenyl 98.46
TIGR01488177 HAD-SF-IB Haloacid Dehalogenase superfamily, subfa 98.4
PRK03669271 mannosyl-3-phosphoglycerate phosphatase; Reviewed 98.39
PRK09552219 mtnX 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosp 98.39
PRK13222226 phosphoglycolate phosphatase; Provisional 98.38
PRK00192273 mannosyl-3-phosphoglycerate phosphatase; Reviewed 98.34
TIGR01489188 DKMTPPase-SF 2,3-diketo-5-methylthio-1-phosphopent 98.34
TIGR01490202 HAD-SF-IB-hyp1 HAD-superfamily subfamily IB hydrol 98.28
TIGR01454205 AHBA_synth_RP 3-amino-5-hydroxybenoic acid synthes 98.26
TIGR01486256 HAD-SF-IIB-MPGP mannosyl-3-phosphoglycerate phosph 98.25
PRK08238 479 hypothetical protein; Validated 98.19
PRK13288214 pyrophosphatase PpaX; Provisional 98.18
cd01427139 HAD_like Haloacid dehalogenase-like hydrolases. Th 98.1
TIGR01449213 PGP_bact 2-phosphoglycolate phosphatase, prokaryot 98.09
PRK06769173 hypothetical protein; Validated 98.08
TIGR02471236 sucr_syn_bact_C sucrose phosphate synthase, sucros 98.08
PRK13223272 phosphoglycolate phosphatase; Provisional 98.03
PRK13225273 phosphoglycolate phosphatase; Provisional 97.96
PRK10826222 2-deoxyglucose-6-phosphatase; Provisional 97.94
PRK13226229 phosphoglycolate phosphatase; Provisional 97.89
PRK10187266 trehalose-6-phosphate phosphatase; Provisional 97.85
TIGR01485249 SPP_plant-cyano sucrose-6F-phosphate phosphohydrol 97.83
PLN02770248 haloacid dehalogenase-like hydrolase family protei 97.75
PRK08942181 D,D-heptose 1,7-bisphosphate phosphatase; Validate 97.74
TIGR01422253 phosphonatase phosphonoacetaldehyde hydrolase. Thi 97.72
TIGR03351220 PhnX-like phosphonatase-like hydrolase. This clade 97.71
TIGR01672237 AphA HAD superfamily (subfamily IIIB) phosphatase, 97.64
PRK11009237 aphA acid phosphatase/phosphotransferase; Provisio 97.62
PRK06698459 bifunctional 5'-methylthioadenosine/S-adenosylhomo 97.62
TIGR01662132 HAD-SF-IIIA HAD-superfamily hydrolase, subfamily I 97.61
PLN03243260 haloacid dehalogenase-like hydrolase; Provisional 97.61
PRK12702302 mannosyl-3-phosphoglycerate phosphatase; Reviewed 97.59
TIGR02461225 osmo_MPG_phos mannosyl-3-phosphoglycerate phosphat 97.56
PRK13478267 phosphonoacetaldehyde hydrolase; Provisional 97.55
PRK11587218 putative phosphatase; Provisional 97.52
TIGR01548197 HAD-SF-IA-hyp1 haloacid dehalogenase superfamily, 97.49
TIGR01544277 HAD-SF-IE haloacid dehalogenase superfamily, subfa 97.48
TIGR01668170 YqeG_hyp_ppase HAD superfamily (subfamily IIIA) ph 97.47
KOG4383 1354 consensus Uncharacterized conserved protein [Funct 97.45
COG4030315 Uncharacterized protein conserved in archaea [Func 97.45
TIGR02253221 CTE7 HAD superfamily (subfamily IA) hydrolase, TIG 97.43
PLN02382413 probable sucrose-phosphatase 97.42
TIGR00213176 GmhB_yaeD D,D-heptose 1,7-bisphosphate phosphatase 97.39
PLN02575381 haloacid dehalogenase-like hydrolase 97.38
PRK11590211 hypothetical protein; Provisional 97.35
COG2179175 Predicted hydrolase of the HAD superfamily [Genera 97.34
TIGR01545210 YfhB_g-proteo haloacid dehalogenase superfamily, s 97.31
PRK14502694 bifunctional mannosyl-3-phosphoglycerate synthase/ 97.28
TIGR02463221 MPGP_rel mannosyl-3-phosphoglycerate phosphatase-r 97.26
PRK14988224 GMP/IMP nucleotidase; Provisional 97.26
PHA02530300 pseT polynucleotide kinase; Provisional 97.23
TIGR01428198 HAD_type_II 2-haloalkanoic acid dehalogenase, type 97.22
PLN02779286 haloacid dehalogenase-like hydrolase family protei 97.22
TIGR02254224 YjjG/YfnB HAD superfamily (subfamily IA) hydrolase 97.21
PRK14501726 putative bifunctional trehalose-6-phosphate syntha 97.2
PRK09449224 dUMP phosphatase; Provisional 97.18
TIGR01484204 HAD-SF-IIB HAD-superfamily hydrolase, subfamily II 97.18
TIGR01685174 MDP-1 magnesium-dependent phosphatase-1. This mode 97.1
TIGR01656147 Histidinol-ppas histidinol-phosphate phosphatase f 97.03
PF13419176 HAD_2: Haloacid dehalogenase-like hydrolase; PDB: 97.0
TIGR01990185 bPGM beta-phosphoglucomutase. The enzyme from L. l 96.97
PLN02940382 riboflavin kinase 96.97
COG4359220 Uncharacterized conserved protein [Function unknow 96.93
PF00122230 E1-E2_ATPase: E1-E2 ATPase p-type cation-transport 96.9
TIGR02009185 PGMB-YQAB-SF beta-phosphoglucomutase family hydrol 96.86
COG3769274 Predicted hydrolase (HAD superfamily) [General fun 96.85
TIGR01664166 DNA-3'-Pase DNA 3'-phosphatase. The central phosph 96.8
TIGR01509183 HAD-SF-IA-v3 haloacid dehalogenase superfamily, su 96.79
TIGR01261161 hisB_Nterm histidinol-phosphatase. This model desc 96.72
smart00775157 LNS2 LNS2 domain. This domain is found in Saccharo 96.66
PTZ00174247 phosphomannomutase; Provisional 96.59
PLN02811220 hydrolase 96.56
TIGR00685244 T6PP trehalose-phosphatase. At least 18 distinct s 96.51
PRK05446354 imidazole glycerol-phosphate dehydratase/histidino 96.51
smart00577148 CPDc catalytic domain of ctd-like phosphatases. 96.47
PLN02580384 trehalose-phosphatase 96.47
TIGR02252203 DREG-2 REG-2-like, HAD superfamily (subfamily IA) 96.44
TIGR01686320 FkbH FkbH-like domain. The C-terminal portion of t 96.37
TIGR01459242 HAD-SF-IIA-hyp4 HAD-superfamily class IIA hydrolas 96.34
TIGR01549154 HAD-SF-IA-v1 haloacid dehalogenase superfamily, su 96.32
TIGR01458257 HAD-SF-IIA-hyp3 HAD-superfamily subfamily IIA hydr 96.32
PF09419168 PGP_phosphatase: Mitochondrial PGP phosphatase; In 96.28
TIGR01691220 enolase-ppase 2,3-diketo-5-methylthio-1-phosphopen 96.19
TIGR01533266 lipo_e_P4 5'-nucleotidase, lipoprotein e(P4) famil 96.19
TIGR01675229 plant-AP plant acid phosphatase. This model explic 96.16
TIGR01681128 HAD-SF-IIIC HAD-superfamily phosphatase, subfamily 96.07
PLN02919 1057 haloacid dehalogenase-like hydrolase family protei 95.96
PRK10444248 UMP phosphatase; Provisional 95.92
PLN02205854 alpha,alpha-trehalose-phosphate synthase [UDP-form 95.79
PF05116247 S6PP: Sucrose-6F-phosphate phosphohydrolase; Inter 95.46
PF13344101 Hydrolase_6: Haloacid dehalogenase-like hydrolase; 95.45
PLN03017366 trehalose-phosphatase 95.42
PF06888234 Put_Phosphatase: Putative Phosphatase; InterPro: I 95.38
TIGR02247211 HAD-1A3-hyp Epoxide hydrolase N-terminal domain-li 95.37
PLN02645311 phosphoglycolate phosphatase 95.17
PHA02597197 30.2 hypothetical protein; Provisional 94.85
PRK09456199 ?-D-glucose-1-phosphatase; Provisional 94.85
TIGR01457249 HAD-SF-IIA-hyp2 HAD-superfamily subfamily IIA hydr 94.83
PRK10725188 fructose-1-P/6-phosphogluconate phosphatase; Provi 94.68
PRK10563221 6-phosphogluconate phosphatase; Provisional 94.56
TIGR01993184 Pyr-5-nucltdase pyrimidine 5'-nucleotidase. These 94.54
PF03767229 Acid_phosphat_B: HAD superfamily, subfamily IIIB ( 94.27
PRK10748238 flavin mononucleotide phosphatase; Provisional 94.12
TIGR01452279 PGP_euk phosphoglycolate/pyridoxal phosphate phosp 93.59
KOG3120256 consensus Predicted haloacid dehalogenase-like hyd 93.44
KOG3040262 consensus Predicted sugar phosphatase (HAD superfa 93.16
COG1011229 Predicted hydrolase (HAD superfamily) [General fun 92.21
PLN02151354 trehalose-phosphatase 92.12
TIGR01452279 PGP_euk phosphoglycolate/pyridoxal phosphate phosp 91.87
PF08235157 LNS2: LNS2 (Lipin/Ned1/Smp2); InterPro: IPR013209 91.78
COG0637221 Predicted phosphatase/phosphohexomutase [General f 91.09
TIGR02251162 HIF-SF_euk Dullard-like phosphatase domain. This d 90.94
TIGR01663526 PNK-3'Pase polynucleotide 5'-kinase 3'-phosphatase 90.64
TIGR01680275 Veg_Stor_Prot vegetative storage protein. The prot 90.12
COG0647269 NagD Predicted sugar phosphatases of the HAD super 89.86
TIGR01684301 viral_ppase viral phosphatase. These proteins also 89.58
TIGR01493175 HAD-SF-IA-v2 Haloacid dehalogenase superfamily, su 87.62
PLN02177 497 glycerol-3-phosphate acyltransferase 87.52
PF1324275 Hydrolase_like: HAD-hyrolase-like; PDB: 2P27_A 2OY 86.85
PF12689169 Acid_PPase: Acid Phosphatase; InterPro: IPR010036 85.53
COG3700237 AphA Acid phosphatase (class B) [General function 85.45
PHA03398303 viral phosphatase superfamily protein; Provisional 83.34
TIGR01460236 HAD-SF-IIA Haloacid Dehalogenase Superfamily Class 81.91
>COG2217 ZntA Cation transport ATPase [Inorganic ion transport and metabolism] Back     alignment and domain information 
Probab=100.00  E-value=3.2e-79  Score=658.00  Aligned_cols=382  Identities=36%  Similarity=0.537  Sum_probs=346.9

Q ss_pred             CccCchhHHHHHHHHHHHHHHHHhhhcchhHHHHHHHHHHhcchhhHHHHHHHhhhhhhHHHHHHHHH--HHHHHHHHHH
Q 038599            2 KSQKKWPAPSVMASGLLLALSFLGYIYHPLQSLAVAAVIFGLPAILIRSIASIKSLTFNINVLILMAV--LIFCAFSKAA   79 (473)
Q Consensus         2 ~~~~~~~~~~~i~~~i~~~~~~~~~~~~~~~~~~~~~v~~~~~p~~l~~~~t~~~~~~~~~~~l~~a~--a~~~a~~~la   79 (473)
                      ++++.|++|.+++++++.|+.+  +++.+..|...             ....+..|+++|||++++|+  ++..|+.+++
T Consensus       323 Dr~a~~fvp~vl~ia~l~f~~w--~~~~~~~~~~a-------------~~~a~avLVIaCPCALgLAtP~ai~~g~g~aA  387 (713)
T COG2217         323 DRVASYFVPVVLVIAALTFALW--PLFGGGDWETA-------------LYRALAVLVIACPCALGLATPTAILVGIGRAA  387 (713)
T ss_pred             HHHHHccHHHHHHHHHHHHHHH--HHhcCCcHHHH-------------HHHHHhheeeeCccHHHhHHHHHHHHHHHHHH
Confidence            4788999998888887766632  11221122111             11234567899999999986  8999999999


Q ss_pred             HCCceeeCchHhhhhcCccEEEEcCCCcCCCCceEEEEEEecCCCCCHHHHHHHHHhhhccCCChHHHHHHHHHHHcCCC
Q 038599           80 TTGLLVKGGDYLEILAKVKMVALDKTGTVTRGEFTVTDFQSICDDVSLGTLLYWVSSIESKSSHPMAAALVDYARSLAIE  159 (473)
Q Consensus        80 k~gilvk~~~~lE~lg~vd~i~fDKTGTLT~g~~~V~~i~~~~~~~~~~~ll~~~a~~e~~s~hpi~~Ai~~~a~~~~~~  159 (473)
                      |+|||+|++.++|+++++|+++||||||||+|+|+|.++...++  ++++++.+++++|..|+||+++||+++++.++. 
T Consensus       388 ~~GILiK~g~~LE~l~~v~tvvFDKTGTLT~G~p~v~~v~~~~~--~e~~~L~laAalE~~S~HPiA~AIv~~a~~~~~-  464 (713)
T COG2217         388 RRGILIKGGEALERLAKVDTVVFDKTGTLTEGKPEVTDVVALDG--DEDELLALAAALEQHSEHPLAKAIVKAAAERGL-  464 (713)
T ss_pred             hCceEEeChHHHHhhccCCEEEEeCCCCCcCCceEEEEEecCCC--CHHHHHHHHHHHHhcCCChHHHHHHHHHHhcCC-
Confidence            99999999999999999999999999999999999999998855  889999999999999999999999999988872 


Q ss_pred             CCCCCccccccccCCceeEEecCeEEEEccccccCCCCCCcc---hhHHHHhcCCceeeEeeeCCeEEEEEEecCccCCc
Q 038599          160 PVPENVEDFQNFPGEGIFGKIHGNVIYIGNRRIGPRTGCSKD---SIAEAKCTGGKTRGYVYLGATPVGTFSLSDSCRSG  236 (473)
Q Consensus       160 ~~~~~v~~~~~~~g~gv~~~v~g~~~~iG~~~~~~~~~~~~~---~~~~~~~~~G~~vi~va~d~~~lG~i~l~d~lr~~  236 (473)
                         ..+.+|++++|+|+++.++|+.+.+|+++++.+.+.+..   +..+.+.++|.++++++.|++++|+|.++|++||+
T Consensus       465 ---~~~~~~~~i~G~Gv~~~v~g~~v~vG~~~~~~~~~~~~~~~~~~~~~~~~~G~t~v~va~dg~~~g~i~~~D~~R~~  541 (713)
T COG2217         465 ---PDVEDFEEIPGRGVEAEVDGERVLVGNARLLGEEGIDLPLLSERIEALESEGKTVVFVAVDGKLVGVIALADELRPD  541 (713)
T ss_pred             ---CCccceeeeccCcEEEEECCEEEEEcCHHHHhhcCCCccchhhhHHHHHhcCCeEEEEEECCEEEEEEEEeCCCChh
Confidence               345569999999999999999999999999988775543   34577788999999999999999999999999999


Q ss_pred             hHHHHHHHHhCCCeEEEEcCCCHHHHHHHHHHcCCCccceehccChhhHHHHHHHHhhCC-cEEEEcCCcccHHHHHHCC
Q 038599          237 ALEAIKDLKSLGIKSFILAGDSHAAALYAQDQLDHAFDMVYAELLPQHKEELVELLKKDG-ATAMVGDGINDAPALAAVD  315 (473)
Q Consensus       237 a~~~I~~L~~~gi~v~mlTGD~~~~a~~~a~~~gi~~~~v~a~~~P~~K~~~v~~l~~~g-~v~mvGDG~ND~~al~~Ad  315 (473)
                      ++++|++||++|++++|+||||..+|+++|+++||+  +++++++||||.++|+.||++| +|+|||||+||+|||++||
T Consensus       542 a~~aI~~L~~~Gi~~~mLTGDn~~~A~~iA~~lGId--~v~AellPedK~~~V~~l~~~g~~VamVGDGINDAPALA~Ad  619 (713)
T COG2217         542 AKEAIAALKALGIKVVMLTGDNRRTAEAIAKELGID--EVRAELLPEDKAEIVRELQAEGRKVAMVGDGINDAPALAAAD  619 (713)
T ss_pred             HHHHHHHHHHCCCeEEEEcCCCHHHHHHHHHHcChH--hheccCCcHHHHHHHHHHHhcCCEEEEEeCCchhHHHHhhcC
Confidence            999999999999999999999999999999999998  9999999999999999999998 9999999999999999999


Q ss_pred             eeEEeCCCCCccccccccEEEecCCcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhHHHHHHHHHHHHHHH
Q 038599          316 IGISMGISGSALAMESGHVILMSNDIRKIPKAIKLARKASTKLIQNVTLSVTVKGAVLVLAVAGYPLVWVAVLTDVGTCL  395 (473)
Q Consensus       316 vgIa~g~~~~~~a~~~ad~vl~~~~l~~l~~~i~~~r~~~~~i~~n~~~~~~~n~~~~~la~~g~~~~~~a~l~~~~s~l  395 (473)
                      |||+|| +|+|+++++||++++++|++.++++++++|+++++|+||+.|++.||+++++++++|+.+||++.+.|.+|++
T Consensus       620 VGiAmG-~GtDvA~eaADvvL~~~dL~~v~~ai~lsr~t~~~IkqNl~~A~~yn~~~iplA~~g~l~p~~A~~am~~SSv  698 (713)
T COG2217         620 VGIAMG-SGTDVAIEAADVVLMRDDLSAVPEAIDLSRATRRIIKQNLFWAFGYNAIAIPLAAGGLLTPWIAALAMSGSSV  698 (713)
T ss_pred             eeEeec-CCcHHHHHhCCEEEecCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhcCHHHHHHHHcccHH
Confidence            999999 7999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHhHhhhcc
Q 038599          396 VVILNSMLLLKN  407 (473)
Q Consensus       396 ~v~~ns~~l~~~  407 (473)
                      +|++||+|+++.
T Consensus       699 ~VvlNaLRL~~~  710 (713)
T COG2217         699 LVVLNALRLLRS  710 (713)
T ss_pred             HHHHHHHHhhcc
Confidence            999999999885

>KOG0207 consensus Cation transport ATPase [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK11033 zntA zinc/cadmium/mercury/lead-transporting ATPase; Provisional Back     alignment and domain information
>TIGR01647 ATPase-IIIA_H plasma-membrane proton-efflux P-type ATPase Back     alignment and domain information
>PRK10671 copA copper exporting ATPase; Provisional Back     alignment and domain information
>TIGR01525 ATPase-IB_hvy heavy metal translocating P-type ATPase Back     alignment and domain information
>TIGR01512 ATPase-IB2_Cd heavy metal-(Cd/Co/Hg/Pb/Zn)-translocating P-type ATPase Back     alignment and domain information
>PRK14010 potassium-transporting ATPase subunit B; Provisional Back     alignment and domain information
>PRK15122 magnesium-transporting ATPase; Provisional Back     alignment and domain information
>TIGR01524 ATPase-IIIB_Mg magnesium-translocating P-type ATPase Back     alignment and domain information
>PRK10517 magnesium-transporting ATPase MgtA; Provisional Back     alignment and domain information
>PRK01122 potassium-transporting ATPase subunit B; Provisional Back     alignment and domain information
>TIGR01511 ATPase-IB1_Cu copper-(or silver)-translocating P-type ATPase Back     alignment and domain information
>TIGR01517 ATPase-IIB_Ca plasma-membrane calcium-translocating P-type ATPase Back     alignment and domain information
>COG0474 MgtA Cation transport ATPase [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR01497 kdpB K+-transporting ATPase, B subunit Back     alignment and domain information
>KOG0202 consensus Ca2+ transporting ATPase [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR01522 ATPase-IIA2_Ca golgi membrane calcium-translocating P-type ATPase Back     alignment and domain information
>TIGR01523 ATPase-IID_K-Na potassium and/or sodium efflux P-type ATPase, fungal-type Back     alignment and domain information
>KOG0204 consensus Calcium transporting ATPase [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR01106 ATPase-IIC_X-K sodium or proton efflux -- potassium uptake antiporter, P-type ATPase, alpha subunit Back     alignment and domain information
>TIGR01494 ATPase_P-type ATPase, P-type (transporting), HAD superfamily, subfamily IC Back     alignment and domain information
>TIGR01657 P-ATPase-V P-type ATPase of unknown pump specificity (type V) Back     alignment and domain information
>TIGR01116 ATPase-IIA1_Ca sarco/endoplasmic reticulum calcium-translocating P-type ATPase Back     alignment and domain information
>KOG0208 consensus Cation transport ATPase [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG0203 consensus Na+/K+ ATPase, alpha subunit [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG2216 KdpB High-affinity K+ transport system, ATPase chain B [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR01652 ATPase-Plipid phospholipid-translocating P-type ATPase, flippase Back     alignment and domain information
>KOG0205 consensus Plasma membrane H+-transporting ATPase [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG0209 consensus P-type ATPase [Inorganic ion transport and metabolism] Back     alignment and domain information
>PLN03190 aminophospholipid translocase; Provisional Back     alignment and domain information
>PF00702 Hydrolase: haloacid dehalogenase-like hydrolase; InterPro: IPR005834 This group of hydrolase enzymes is structurally different from the alpha/beta hydrolase family (abhydrolase) Back     alignment and domain information
>KOG0210 consensus P-type ATPase [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG0206 consensus P-type ATPase [General function prediction only] Back     alignment and domain information
>COG4087 Soluble P-type ATPase [General function prediction only] Back     alignment and domain information
>TIGR02137 HSK-PSP phosphoserine phosphatase/homoserine phosphotransferase bifunctional protein Back     alignment and domain information
>PRK11133 serB phosphoserine phosphatase; Provisional Back     alignment and domain information
>TIGR00338 serB phosphoserine phosphatase SerB Back     alignment and domain information
>TIGR01670 YrbI-phosphatas 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase, YrbI family Back     alignment and domain information
>PRK01158 phosphoglycolate phosphatase; Provisional Back     alignment and domain information
>PRK10513 sugar phosphate phosphatase; Provisional Back     alignment and domain information
>COG0561 Cof Predicted hydrolases of the HAD superfamily [General function prediction only] Back     alignment and domain information
>TIGR01487 SPP-like sucrose-phosphate phosphatase-like hydrolase, Archaeal Back     alignment and domain information
>PRK09484 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase; Provisional Back     alignment and domain information
>TIGR02726 phenyl_P_delta phenylphosphate carboxylase, delta subunit Back     alignment and domain information
>PRK15126 thiamin pyrimidine pyrophosphate hydrolase; Provisional Back     alignment and domain information
>PRK10976 putative hydrolase; Provisional Back     alignment and domain information
>COG0560 SerB Phosphoserine phosphatase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK13582 thrH phosphoserine phosphatase; Provisional Back     alignment and domain information
>PRK10530 pyridoxal phosphate (PLP) phosphatase; Provisional Back     alignment and domain information
>TIGR01482 SPP-subfamily Sucrose-phosphate phosphatase subfamily Back     alignment and domain information
>COG1778 Low specificity phosphatase (HAD superfamily) [General function prediction only] Back     alignment and domain information
>KOG1615 consensus Phosphoserine phosphatase [Amino acid transport and metabolism] Back     alignment and domain information
>PF08282 Hydrolase_3: haloacid dehalogenase-like hydrolase; InterPro: IPR013200 The Haloacid Dehydrogenase (HAD) superfamily includes phosphatases, phosphonatases, P-type ATPases, beta-phosphoglucomutases, phosphomannomutases, and dehalogenases, which are involved in a variety of cellular processes ranging from amino acid biosynthesis to detoxification [] Back     alignment and domain information
>PLN02887 hydrolase family protein Back     alignment and domain information
>TIGR01491 HAD-SF-IB-PSPlk HAD-superfamily, subfamily-IB PSPase-like hydrolase, archaeal Back     alignment and domain information
>TIGR00099 Cof-subfamily Cof subfamily of IIB subfamily of haloacid dehalogenase superfamily Back     alignment and domain information
>PLN02954 phosphoserine phosphatase Back     alignment and domain information
>COG0546 Gph Predicted phosphatases [General function prediction only] Back     alignment and domain information
>PF12710 HAD: haloacid dehalogenase-like hydrolase; PDB: 3P96_A 3N28_A 3FVV_A 1RKU_A 1RKV_A 1Y8A_A 2FEA_B 3KD3_B Back     alignment and domain information
>TIGR03333 salvage_mtnX 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase Back     alignment and domain information
>TIGR01488 HAD-SF-IB Haloacid Dehalogenase superfamily, subfamily IB, phosphoserine phosphatase-like Back     alignment and domain information
>PRK03669 mannosyl-3-phosphoglycerate phosphatase; Reviewed Back     alignment and domain information
>PRK09552 mtnX 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase; Reviewed Back     alignment and domain information
>PRK13222 phosphoglycolate phosphatase; Provisional Back     alignment and domain information
>PRK00192 mannosyl-3-phosphoglycerate phosphatase; Reviewed Back     alignment and domain information
>TIGR01489 DKMTPPase-SF 2,3-diketo-5-methylthio-1-phosphopentane phosphatase Back     alignment and domain information
>TIGR01490 HAD-SF-IB-hyp1 HAD-superfamily subfamily IB hydrolase, TIGR01490 Back     alignment and domain information
>TIGR01454 AHBA_synth_RP 3-amino-5-hydroxybenoic acid synthesis related protein Back     alignment and domain information
>TIGR01486 HAD-SF-IIB-MPGP mannosyl-3-phosphoglycerate phosphatase family Back     alignment and domain information
>PRK08238 hypothetical protein; Validated Back     alignment and domain information
>PRK13288 pyrophosphatase PpaX; Provisional Back     alignment and domain information
>cd01427 HAD_like Haloacid dehalogenase-like hydrolases Back     alignment and domain information
>TIGR01449 PGP_bact 2-phosphoglycolate phosphatase, prokaryotic Back     alignment and domain information
>PRK06769 hypothetical protein; Validated Back     alignment and domain information
>TIGR02471 sucr_syn_bact_C sucrose phosphate synthase, sucrose phosphatase-like domain, bacterial Back     alignment and domain information
>PRK13223 phosphoglycolate phosphatase; Provisional Back     alignment and domain information
>PRK13225 phosphoglycolate phosphatase; Provisional Back     alignment and domain information
>PRK10826 2-deoxyglucose-6-phosphatase; Provisional Back     alignment and domain information
>PRK13226 phosphoglycolate phosphatase; Provisional Back     alignment and domain information
>PRK10187 trehalose-6-phosphate phosphatase; Provisional Back     alignment and domain information
>TIGR01485 SPP_plant-cyano sucrose-6F-phosphate phosphohydrolase Back     alignment and domain information
>PLN02770 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>PRK08942 D,D-heptose 1,7-bisphosphate phosphatase; Validated Back     alignment and domain information
>TIGR01422 phosphonatase phosphonoacetaldehyde hydrolase Back     alignment and domain information
>TIGR03351 PhnX-like phosphonatase-like hydrolase Back     alignment and domain information
>TIGR01672 AphA HAD superfamily (subfamily IIIB) phosphatase, TIGR01672 Back     alignment and domain information
>PRK11009 aphA acid phosphatase/phosphotransferase; Provisional Back     alignment and domain information
>PRK06698 bifunctional 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase/phosphatase; Validated Back     alignment and domain information
>TIGR01662 HAD-SF-IIIA HAD-superfamily hydrolase, subfamily IIIA Back     alignment and domain information
>PLN03243 haloacid dehalogenase-like hydrolase; Provisional Back     alignment and domain information
>PRK12702 mannosyl-3-phosphoglycerate phosphatase; Reviewed Back     alignment and domain information
>TIGR02461 osmo_MPG_phos mannosyl-3-phosphoglycerate phosphatase Back     alignment and domain information
>PRK13478 phosphonoacetaldehyde hydrolase; Provisional Back     alignment and domain information
>PRK11587 putative phosphatase; Provisional Back     alignment and domain information
>TIGR01548 HAD-SF-IA-hyp1 haloacid dehalogenase superfamily, subfamily IA hydrolase, TIGR01548 Back     alignment and domain information
>TIGR01544 HAD-SF-IE haloacid dehalogenase superfamily, subfamily IE hydrolase, TIGR01544 Back     alignment and domain information
>TIGR01668 YqeG_hyp_ppase HAD superfamily (subfamily IIIA) phosphatase, TIGR01668 Back     alignment and domain information
>KOG4383 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG4030 Uncharacterized protein conserved in archaea [Function unknown] Back     alignment and domain information
>TIGR02253 CTE7 HAD superfamily (subfamily IA) hydrolase, TIGR02253 Back     alignment and domain information
>PLN02382 probable sucrose-phosphatase Back     alignment and domain information
>TIGR00213 GmhB_yaeD D,D-heptose 1,7-bisphosphate phosphatase Back     alignment and domain information
>PLN02575 haloacid dehalogenase-like hydrolase Back     alignment and domain information
>PRK11590 hypothetical protein; Provisional Back     alignment and domain information
>COG2179 Predicted hydrolase of the HAD superfamily [General function prediction only] Back     alignment and domain information
>TIGR01545 YfhB_g-proteo haloacid dehalogenase superfamily, subfamily IF hydrolase, YfhB Back     alignment and domain information
>PRK14502 bifunctional mannosyl-3-phosphoglycerate synthase/mannosyl-3 phosphoglycerate phosphatase; Provisional Back     alignment and domain information
>TIGR02463 MPGP_rel mannosyl-3-phosphoglycerate phosphatase-related protein Back     alignment and domain information
>PRK14988 GMP/IMP nucleotidase; Provisional Back     alignment and domain information
>PHA02530 pseT polynucleotide kinase; Provisional Back     alignment and domain information
>TIGR01428 HAD_type_II 2-haloalkanoic acid dehalogenase, type II Back     alignment and domain information
>PLN02779 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>TIGR02254 YjjG/YfnB HAD superfamily (subfamily IA) hydrolase, TIGR02254 Back     alignment and domain information
>PRK14501 putative bifunctional trehalose-6-phosphate synthase/HAD hydrolase subfamily IIB; Provisional Back     alignment and domain information
>PRK09449 dUMP phosphatase; Provisional Back     alignment and domain information
>TIGR01484 HAD-SF-IIB HAD-superfamily hydrolase, subfamily IIB Back     alignment and domain information
>TIGR01685 MDP-1 magnesium-dependent phosphatase-1 Back     alignment and domain information
>TIGR01656 Histidinol-ppas histidinol-phosphate phosphatase family domain Back     alignment and domain information
>PF13419 HAD_2: Haloacid dehalogenase-like hydrolase; PDB: 2FI1_A 2I6X_A 3SD7_A 4F71_A 4DFD_B 4F72_B 4DCC_A 3DDH_A 3KZX_A 2B0C_A Back     alignment and domain information
>TIGR01990 bPGM beta-phosphoglucomutase Back     alignment and domain information
>PLN02940 riboflavin kinase Back     alignment and domain information
>COG4359 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF00122 E1-E2_ATPase: E1-E2 ATPase p-type cation-transporting ATPase superfamily signature H+-transporting ATPase (proton pump) signature sodium/potassium-transporting ATPase signature; InterPro: IPR008250 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane Back     alignment and domain information
>TIGR02009 PGMB-YQAB-SF beta-phosphoglucomutase family hydrolase Back     alignment and domain information
>COG3769 Predicted hydrolase (HAD superfamily) [General function prediction only] Back     alignment and domain information
>TIGR01664 DNA-3'-Pase DNA 3'-phosphatase Back     alignment and domain information
>TIGR01509 HAD-SF-IA-v3 haloacid dehalogenase superfamily, subfamily IA, variant 3 with third motif having DD or ED Back     alignment and domain information
>TIGR01261 hisB_Nterm histidinol-phosphatase Back     alignment and domain information
>smart00775 LNS2 LNS2 domain Back     alignment and domain information
>PTZ00174 phosphomannomutase; Provisional Back     alignment and domain information
>PLN02811 hydrolase Back     alignment and domain information
>TIGR00685 T6PP trehalose-phosphatase Back     alignment and domain information
>PRK05446 imidazole glycerol-phosphate dehydratase/histidinol phosphatase; Provisional Back     alignment and domain information
>smart00577 CPDc catalytic domain of ctd-like phosphatases Back     alignment and domain information
>PLN02580 trehalose-phosphatase Back     alignment and domain information
>TIGR02252 DREG-2 REG-2-like, HAD superfamily (subfamily IA) hydrolase Back     alignment and domain information
>TIGR01686 FkbH FkbH-like domain Back     alignment and domain information
>TIGR01459 HAD-SF-IIA-hyp4 HAD-superfamily class IIA hydrolase, TIGR01459 Back     alignment and domain information
>TIGR01549 HAD-SF-IA-v1 haloacid dehalogenase superfamily, subfamily IA, variant 1 with third motif having Dx(3-4)D or Dx(3-4)E Back     alignment and domain information
>TIGR01458 HAD-SF-IIA-hyp3 HAD-superfamily subfamily IIA hydrolase, TIGR01458 Back     alignment and domain information
>PF09419 PGP_phosphatase: Mitochondrial PGP phosphatase; InterPro: IPR010021 This group of hypothetical proteins is a part of the IIIA subfamily of the haloacid dehalogenase (HAD) superfamily of hydrolases Back     alignment and domain information
>TIGR01691 enolase-ppase 2,3-diketo-5-methylthio-1-phosphopentane phosphatase Back     alignment and domain information
>TIGR01533 lipo_e_P4 5'-nucleotidase, lipoprotein e(P4) family Back     alignment and domain information
>TIGR01675 plant-AP plant acid phosphatase Back     alignment and domain information
>TIGR01681 HAD-SF-IIIC HAD-superfamily phosphatase, subfamily IIIC Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>PRK10444 UMP phosphatase; Provisional Back     alignment and domain information
>PLN02205 alpha,alpha-trehalose-phosphate synthase [UDP-forming] Back     alignment and domain information
>PF05116 S6PP: Sucrose-6F-phosphate phosphohydrolase; InterPro: IPR006380 This family of sequences represent sucrose phosphate phosphohydrolase (SPP) from plants and cyanobacteria [] Back     alignment and domain information
>PF13344 Hydrolase_6: Haloacid dehalogenase-like hydrolase; PDB: 2HO4_B 1YV9_A 1WVI_B 3EPR_A 2P27_A 2OYC_A 2CFT_A 2P69_A 2CFS_A 2CFR_A Back     alignment and domain information
>PLN03017 trehalose-phosphatase Back     alignment and domain information
>PF06888 Put_Phosphatase: Putative Phosphatase; InterPro: IPR016965 This group represents phosphatases related to PHOSPHO1 and PHOSPHO2 [] Back     alignment and domain information
>TIGR02247 HAD-1A3-hyp Epoxide hydrolase N-terminal domain-like phosphatase Back     alignment and domain information
>PLN02645 phosphoglycolate phosphatase Back     alignment and domain information
>PHA02597 30 Back     alignment and domain information
>PRK09456 ?-D-glucose-1-phosphatase; Provisional Back     alignment and domain information
>TIGR01457 HAD-SF-IIA-hyp2 HAD-superfamily subfamily IIA hydrolase, TIGR01457 Back     alignment and domain information
>PRK10725 fructose-1-P/6-phosphogluconate phosphatase; Provisional Back     alignment and domain information
>PRK10563 6-phosphogluconate phosphatase; Provisional Back     alignment and domain information
>TIGR01993 Pyr-5-nucltdase pyrimidine 5'-nucleotidase Back     alignment and domain information
>PF03767 Acid_phosphat_B: HAD superfamily, subfamily IIIB (Acid phosphatase); InterPro: IPR005519 This family of class B acid phosphatases also contains a number of vegetative storage proteins (VPS25) Back     alignment and domain information
>PRK10748 flavin mononucleotide phosphatase; Provisional Back     alignment and domain information
>TIGR01452 PGP_euk phosphoglycolate/pyridoxal phosphate phosphatase family Back     alignment and domain information
>KOG3120 consensus Predicted haloacid dehalogenase-like hydrolase [General function prediction only] Back     alignment and domain information
>KOG3040 consensus Predicted sugar phosphatase (HAD superfamily) [General function prediction only] Back     alignment and domain information
>COG1011 Predicted hydrolase (HAD superfamily) [General function prediction only] Back     alignment and domain information
>PLN02151 trehalose-phosphatase Back     alignment and domain information
>TIGR01452 PGP_euk phosphoglycolate/pyridoxal phosphate phosphatase family Back     alignment and domain information
>PF08235 LNS2: LNS2 (Lipin/Ned1/Smp2); InterPro: IPR013209 This domain is found in Saccharomyces cerevisiae (Baker's yeast) protein SMP2, proteins with an N-terminal lipin domain (IPR007651 from INTERPRO) and phosphatidylinositol transfer proteins [] Back     alignment and domain information
>COG0637 Predicted phosphatase/phosphohexomutase [General function prediction only] Back     alignment and domain information
>TIGR02251 HIF-SF_euk Dullard-like phosphatase domain Back     alignment and domain information
>TIGR01663 PNK-3'Pase polynucleotide 5'-kinase 3'-phosphatase Back     alignment and domain information
>TIGR01680 Veg_Stor_Prot vegetative storage protein Back     alignment and domain information
>COG0647 NagD Predicted sugar phosphatases of the HAD superfamily [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR01684 viral_ppase viral phosphatase Back     alignment and domain information
>TIGR01493 HAD-SF-IA-v2 Haloacid dehalogenase superfamily, subfamily IA, variant 2 with 3rd motif like haloacid dehalogenase Back     alignment and domain information
>PLN02177 glycerol-3-phosphate acyltransferase Back     alignment and domain information
>PF13242 Hydrolase_like: HAD-hyrolase-like; PDB: 2P27_A 2OYC_A 2CFT_A 2P69_A 2CFS_A 2CFR_A 2HX1_D 2X4D_A 3HLT_C 3L1U_B Back     alignment and domain information
>PF12689 Acid_PPase: Acid Phosphatase; InterPro: IPR010036 This entry represents two closely related clades of sequences from eukaryotes and archaea Back     alignment and domain information
>COG3700 AphA Acid phosphatase (class B) [General function prediction only] Back     alignment and domain information
>PHA03398 viral phosphatase superfamily protein; Provisional Back     alignment and domain information
>TIGR01460 HAD-SF-IIA Haloacid Dehalogenase Superfamily Class (subfamily) IIA Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query473
3j09_A723 High Resolution Helical Reconstruction Of The Bacte 1e-41
3j08_A645 High Resolution Helical Reconstruction Of The Bacte 2e-41
3a1c_A287 Crystal Structure Of The P- And N-Domains Of Copa, 4e-38
3sky_A274 2.1a Crystal Structure Of The Phosphate Bound Atp B 7e-38
3skx_A280 Crystal Structure Of The Atp Binding Domain Of Arch 2e-37
3a1e_A287 Crystal Structure Of The P- And N-Domains Of His462 2e-37
2b8e_A273 Copa Atp Binding Domain Length = 273 3e-35
3rfu_A736 Crystal Structure Of A Copper-Transporting Pib-Type 2e-33
2iye_A263 Structure Of Catalytic Cpx-atpase Domain Copb-b Len 9e-27
2yj4_A263 Conformational Changes In The Catalytic Domain Of T 3e-26
2yj3_A263 Conformational Changes In The Catalytic Domain Of T 3e-26
2voy_I128 Cryoem Model Of Copa, The Copper Transporting Atpas 5e-14
3tlm_A 992 Crystal Structure Of Endoplasmic Reticulum Ca2+-Atp 3e-11
2zxe_A 1028 Crystal Structure Of The Sodium - Potassium Pump In 8e-11
3ba6_A 994 Structure Of The Ca2e1p Phosphoenzyme Intermediate 1e-10
2dqs_A 995 Crystal Structure Of The Calcium Pump With Amppcp I 1e-10
1kju_A 994 Ca2+-Atpase In The E2 State Length = 994 1e-10
1mhs_A 920 Model Of Neurospora Crassa Proton Atpase Length = 9 1e-10
3ixz_A 1034 Pig Gastric H+K+-Atpase Complexed With Aluminium Fl 5e-10
3n23_A 992 Crystal Structure Of The High Affinity Complex Betw 2e-09
3b8e_A 998 Crystal Structure Of The Sodium-Potassium Pump Leng 2e-09
3b8c_A 885 Crystal Structure Of A Plasma Membrane Proton Pump 6e-06
>pdb|3J09|A Chain A, High Resolution Helical Reconstruction Of The Bacterial P-Type Atpase Copper Transporter Copa Length = 723 Back     alignment and structure 
Iteration: 1

 Score =  167 bits (423), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 127/361 (35%), Positives = 188/361 (52%), Gaps = 42/361 (11%)
Query: 30  PLQSLAVAAVIFGLPAILIRSIASI--------KSLTFNINVLILMAVLIF---CAFS-- 76
           P+Q LA   V + +P +L+ +I++           L F    LI  AVL+    CAF   
Sbjct: 316 PIQRLADKVVAYFIPTVLLVAISAFIYWYFIAHAPLLFAFTTLI--AVLVVACPCAFGLA 373
Query: 77  ----------KAATTGLLVKGGDYLEILAKVKMVALDKTGTVTRGEFTVTDFQSICDDVS 126
                     K A  G+L+K  D LE+  KV  V  DKTGT+T+G+  VTD   +  D  
Sbjct: 374 TPTALTVGMGKGAELGILIKNADALEVAEKVTAVIFDKTGTLTKGKPEVTDLVPLNGDER 433
Query: 127 LGTLLYWVSSIESKSSHPMAAALVDYARSLAIE-PVPENVEDFQNFPGEGIFGKIHGNVI 185
              LL   +  E +S HP+A A+V  A    IE   PE VE      GEG+      + I
Sbjct: 434 --ELLRLAAIAERRSEHPIAEAIVKKALEHGIELGEPEKVE---VIAGEGVVA----DGI 484
Query: 186 YIGNRRIGPRTGCSKDSIAEAKCTG----GKTRGYVYLGATPVGTFSLSDSCRSGALEAI 241
            +GN+R+    G +  +  E          KT   V       G  ++SD+ +  A  A+
Sbjct: 485 LVGNKRLMEDFGVAVSNEVELALEKLEREAKTAVIVARNGRVEGIIAVSDTLKESAKPAV 544
Query: 242 KDLKSLGIKSFILAGDSHAAALYAQDQLDHAFDMVYAELLPQHKEELVELLKKDGATAMV 301
           ++LK +GIK  ++ GD+  +A     +L+   D+V AE+LP  K E V+ L+     A V
Sbjct: 545 QELKRMGIKVGMITGDNWRSAEAISRELN--LDLVIAEVLPHQKSEEVKKLQAKEVVAFV 602
Query: 302 GDGINDAPALAAVDIGISMGISGSALAMESGHVILMSNDIRKIPKAIKLARKASTKLIQN 361
           GDGINDAPALA  D+GI++G SGS +A+ESG ++L+ +D+R +  AI+L+RK  +K+ QN
Sbjct: 603 GDGINDAPALAQADLGIAVG-SGSDVAVESGDIVLIRDDLRDVVAAIQLSRKTMSKIKQN 661
Query: 362 V 362
           +
Sbjct: 662 I 662
>pdb|3J08|A Chain A, High Resolution Helical Reconstruction Of The Bacterial P-Type Atpase Copper Transporter Copa Length = 645 Back     alignment and structure
>pdb|3A1C|A Chain A, Crystal Structure Of The P- And N-Domains Of Copa, A Copper- Transporting P-Type Atpase, Bound With Amppcp-Mg Length = 287 Back     alignment and structure
>pdb|3SKY|A Chain A, 2.1a Crystal Structure Of The Phosphate Bound Atp Binding Domain Of Archaeoglobus Fulgidus Copb Length = 274 Back     alignment and structure
>pdb|3SKX|A Chain A, Crystal Structure Of The Atp Binding Domain Of Archaeoglobus Fulgidus Copb Length = 280 Back     alignment and structure
>pdb|3A1E|A Chain A, Crystal Structure Of The P- And N-Domains Of His462gln Mutant Copa, A Copper-Transporting P-Type Atpase, Bound With Amppcp-Mg Length = 287 Back     alignment and structure
>pdb|2B8E|A Chain A, Copa Atp Binding Domain Length = 273 Back     alignment and structure
>pdb|3RFU|A Chain A, Crystal Structure Of A Copper-Transporting Pib-Type Atpase Length = 736 Back     alignment and structure
>pdb|2IYE|A Chain A, Structure Of Catalytic Cpx-atpase Domain Copb-b Length = 263 Back     alignment and structure
>pdb|2YJ4|A Chain A, Conformational Changes In The Catalytic Domain Of The Cpx- Atpase Copb-B Upon Nucleotide Binding Length = 263 Back     alignment and structure
>pdb|2YJ3|A Chain A, Conformational Changes In The Catalytic Domain Of The Cpx- Atpase Copb-B Upon Nucleotide Binding Length = 263 Back     alignment and structure
>pdb|2VOY|I Chain I, Cryoem Model Of Copa, The Copper Transporting Atpase From Archaeoglobus Fulgidus Length = 128 Back     alignment and structure
>pdb|3TLM|A Chain A, Crystal Structure Of Endoplasmic Reticulum Ca2+-Atpase (Serca) From Bovine Muscle Length = 992 Back     alignment and structure
>pdb|2ZXE|A Chain A, Crystal Structure Of The Sodium - Potassium Pump In The E2.2k+.Pi State Length = 1028 Back     alignment and structure
>pdb|3BA6|A Chain A, Structure Of The Ca2e1p Phosphoenzyme Intermediate Of The Serca Ca2+-Atpase Length = 994 Back     alignment and structure
>pdb|2DQS|A Chain A, Crystal Structure Of The Calcium Pump With Amppcp In The Absence Of Calcium Length = 995 Back     alignment and structure
>pdb|1KJU|A Chain A, Ca2+-Atpase In The E2 State Length = 994 Back     alignment and structure
>pdb|1MHS|A Chain A, Model Of Neurospora Crassa Proton Atpase Length = 920 Back     alignment and structure
>pdb|3IXZ|A Chain A, Pig Gastric H+K+-Atpase Complexed With Aluminium Fluoride Length = 1034 Back     alignment and structure
>pdb|3N23|A Chain A, Crystal Structure Of The High Affinity Complex Between Ouabain And The E2p Form Of The Sodium-Potassium Pump Length = 992 Back     alignment and structure
>pdb|3B8E|A Chain A, Crystal Structure Of The Sodium-Potassium Pump Length = 998 Back     alignment and structure
>pdb|3B8C|A Chain A, Crystal Structure Of A Plasma Membrane Proton Pump Length = 885 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query473
3skx_A280 Copper-exporting P-type ATPase B; P1B-ATPase, ATP 8e-83
2yj3_A263 Copper-transporting ATPase; hydrolase, P-type ATPa 2e-81
3a1c_A287 Probable copper-exporting P-type ATPase A; ATP-bin 1e-77
3rfu_A736 Copper efflux ATPase; alpha helical, CPC, CXXC, AT 6e-76
3j09_A723 COPA, copper-exporting P-type ATPase A; copper tra 8e-75
3j08_A645 COPA, copper-exporting P-type ATPase A; copper tra 2e-74
3b8c_A 885 ATPase 2, plasma membrane-type; P-type ATPase, pro 2e-21
1mhs_A 920 Proton pump, plasma membrane ATPase; ION transport 9e-21
3ixz_A 1034 Potassium-transporting ATPase alpha; ION pump, H+, 2e-16
2zxe_A 1028 Na, K-ATPase alpha subunit; membrane protein, ION 4e-16
2kmv_A185 Copper-transporting ATPase 1; menkes, nucleotide b 3e-15
2arf_A165 Wilson disease ATPase; P-type ATPase,ATP7B, copper 2e-14
3ar4_A 995 Sarcoplasmic/endoplasmic reticulum calcium ATPase; 2e-13
1svj_A156 Potassium-transporting ATPase B chain; alpha-beta 4e-07
1nnl_A225 L-3-phosphoserine phosphatase; PSP, HPSP, phospho- 6e-06
4eze_A317 Haloacid dehalogenase-like hydrolase; magnesium bi 8e-06
3m1y_A217 Phosphoserine phosphatase (SERB); NYSGXRC, PSI II, 3e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-05
2fea_A236 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate 1e-04
1rku_A206 Homoserine kinase; phosphoserine phosphatase, phos 2e-04
1l7m_A211 Phosphoserine phosphatase; rossmann fold, four-hel 2e-04
3n28_A335 Phosphoserine phosphatase; HAD family hydrolase, s 3e-04
>3skx_A Copper-exporting P-type ATPase B; P1B-ATPase, ATP binding domain, copper(II) transporter, MEMB protein, hydrolase; 1.59A {Archaeoglobus fulgidus} PDB: 3sky_A* Length = 280 Back     alignment and structure
 Score =  256 bits (656), Expect = 8e-83
 Identities = 94/277 (33%), Positives = 151/277 (54%), Gaps = 7/277 (2%)

Query: 85  VKGGDYLEILAKVKMVALDKTGTVTRGEFTVTDFQSICDDVSLGTLLYWVSSIESKSSHP 144
           ++     E    ++ V  DKTGT+T G F VTD   +  + S   LL   +S+E++S HP
Sbjct: 1   MRDRQAFERAKDLQAVIFDKTGTLTEGRFGVTDI--VGFNHSEDELLQIAASLEARSEHP 58

Query: 145 MAAALVDYARSLAIEPVPENVEDFQNFPGEGIFGKIHGNVIYIGNRRIGPRTGCSKDSIA 204
           +AAA+V+ A           VE+F+  PG+G+ G ++G    + +       G   D   
Sbjct: 59  IAAAIVEEAEKRGFGLTE--VEEFRAIPGKGVEGIVNGRRYMVVSPGYIRELGIKTDESV 116

Query: 205 EAKCTGGKTRGYVYLGATPVGTFSLSDSCRSGALEAIKDLKSLGIKSFILAGDSHAAALY 264
           E     GKT  ++       G  +L+D  R  + EAI  LK++GIK  +L GD+   A +
Sbjct: 117 EKLKQQGKTVVFILKNGEVSGVIALADRIRPESREAISKLKAIGIKCMMLTGDNRFVAKW 176

Query: 265 AQDQLDHAFDMVYAELLPQHKEELVELLKKDGATAMVGDGINDAPALAAVDIGISMGISG 324
             ++L    D  +AE+LP  K E V+ +++   TAMVGDG+NDAPALA  D+GI++G +G
Sbjct: 177 VAEELG--LDDYFAEVLPHEKAEKVKEVQQKYVTAMVGDGVNDAPALAQADVGIAIG-AG 233

Query: 325 SALAMESGHVILMSNDIRKIPKAIKLARKASTKLIQN 361
           + +A+E+  ++L+ ND R +   ++L+RK  +K    
Sbjct: 234 TDVAVETADIVLVRNDPRDVAAIVELSRKTYSKFHGL 270
>2yj3_A Copper-transporting ATPase; hydrolase, P-type ATPase, COPB, heavy metal translocation; 2.20A {Sulfolobus solfataricus} PDB: 2iye_A 2yj6_A* 2yj5_A* 2yj4_A* Length = 263 Back     alignment and structure
>3a1c_A Probable copper-exporting P-type ATPase A; ATP-binding, cell membrane, copper transport, hydrolase, ION transport, magnesium, membrane; HET: ACP; 1.85A {Archaeoglobus fulgidus} PDB: 3a1d_A* 3a1e_A* 2b8e_A 2voy_J 2voy_I Length = 287 Back     alignment and structure
>3rfu_A Copper efflux ATPase; alpha helical, CPC, CXXC, ATP-binding, hydrolase, ION transp magnesium, Cu+, membrane, metal-binding; 3.20A {Legionella pneumophila subsp} Length = 736 Back     alignment and structure
>3j09_A COPA, copper-exporting P-type ATPase A; copper transporter, adenosine triphosph archaeal proteins, cation transport proteins; 10.00A {Archaeoglobus fulgidus} Length = 723 Back     alignment and structure
>3j08_A COPA, copper-exporting P-type ATPase A; copper transporter, adenosine triphosph archaeal proteins, cation transport proteins; 10.00A {Archaeoglobus fulgidus} Length = 645 Back     alignment and structure
>3b8c_A ATPase 2, plasma membrane-type; P-type ATPase, proton pump, ATP-binding, hydrogen ION transport, hydrolase, ION transport; HET: ACP; 3.60A {Arabidopsis thaliana} Length = 885 Back     alignment and structure
>1mhs_A Proton pump, plasma membrane ATPase; ION transport, membrane protein, P-type ATPase, active transport, cryo-electron microscopy; 8.00A {Neurospora crassa} SCOP: i.18.1.1 Length = 920 Back     alignment and structure
>3ixz_A Potassium-transporting ATPase alpha; ION pump, H+, K+-ATPase, P-type ATPase, membrane protein, hydrolase, aluminium fluoride, ATP-binding; 6.50A {Sus scrofa} PDB: 2xzb_A 1iwc_A 1iwf_A Length = 1034 Back     alignment and structure
>2zxe_A Na, K-ATPase alpha subunit; membrane protein, ION pump, ATPase, K+ binding, haloacid dehydrogenease superfamily, phosphate analogue; HET: CLR NAG NDG; 2.40A {Squalus acanthias} PDB: 3a3y_A* 3b8e_A* 3kdp_A* 3n2f_A* 3n23_A* 1mo7_A 1mo8_A* 1q3i_A Length = 1028 Back     alignment and structure
>2kmv_A Copper-transporting ATPase 1; menkes, nucleotide binding protein, alternative splicing, ATP-binding, cell membrane, cytoplasm, disease mutation; NMR {Homo sapiens} PDB: 2kmx_A* Length = 185 Back     alignment and structure
>2arf_A Wilson disease ATPase; P-type ATPase,ATP7B, copper transport, nucleotide binding, ATP binding, hydrolase; NMR {Homo sapiens} PDB: 2koy_A Length = 165 Back     alignment and structure
>3ar4_A Sarcoplasmic/endoplasmic reticulum calcium ATPase; P-type ATPase, hydrolase, calcium transport, calcium binding binding; HET: ATP TG1 PTY; 2.15A {Oryctolagus cuniculus} PDB: 2ear_A* 2eas_A* 2eat_A* 2eau_A* 2dqs_A* 2zbe_A 2zbf_A* 2zbg_A* 3ar2_A* 2zbd_A* 3ar3_A* 3ar5_A* 3ar6_A* 3ar7_A* 3ar8_A* 3ar9_A* 3n5k_A* 1kju_A 1iwo_A 1t5s_A* ... Length = 995 Back     alignment and structure
>1svj_A Potassium-transporting ATPase B chain; alpha-beta sandwich, hydrolase; NMR {Escherichia coli} SCOP: d.220.1.1 PDB: 1u7q_A 2a00_A* 2a29_A* Length = 156 Back     alignment and structure
>1nnl_A L-3-phosphoserine phosphatase; PSP, HPSP, phospho-aspartyl, hydrolase; 1.53A {Homo sapiens} SCOP: c.108.1.4 PDB: 1l8l_A* 1l8o_A Length = 225 Back     alignment and structure
>4eze_A Haloacid dehalogenase-like hydrolase; magnesium binding site, enzyme function initiativ; 2.27A {Salmonella enterica subsp} Length = 317 Back     alignment and structure
>3m1y_A Phosphoserine phosphatase (SERB); NYSGXRC, PSI II, phophoserine phosphatase, protein structure initiative, structural genomics; 2.40A {Helicobacter pylori} Length = 217 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2fea_A 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase; 2633731, structural genomics, joint center for structural GE JCSG; HET: MSE; 2.00A {Bacillus subtilis} SCOP: c.108.1.20 Length = 236 Back     alignment and structure
>1rku_A Homoserine kinase; phosphoserine phosphatase, phosphoserine:homoserine phosphotransferase, THRH, phosphoserine phosphoryl donor; 1.47A {Pseudomonas aeruginosa} SCOP: c.108.1.11 PDB: 1rkv_A Length = 206 Back     alignment and structure
>1l7m_A Phosphoserine phosphatase; rossmann fold, four-helix bundle, B-hairpin, structural genomics, BSGC structure funded by NIH; 1.48A {Methanocaldococcus jannaschii} SCOP: c.108.1.4 PDB: 1f5s_A 1l7n_A 1l7p_A* 1l7o_A* 1j97_A* Length = 211 Back     alignment and structure
>3n28_A Phosphoserine phosphatase; HAD family hydrolase, structural genomics, PSI, protein STRU initiative, nysgrc; 2.30A {Vibrio cholerae} Length = 335 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query473
3rfu_A736 Copper efflux ATPase; alpha helical, CPC, CXXC, AT 100.0
3j09_A723 COPA, copper-exporting P-type ATPase A; copper tra 100.0
3j08_A645 COPA, copper-exporting P-type ATPase A; copper tra 100.0
1mhs_A 920 Proton pump, plasma membrane ATPase; ION transport 100.0
3b8c_A 885 ATPase 2, plasma membrane-type; P-type ATPase, pro 100.0
2zxe_A 1028 Na, K-ATPase alpha subunit; membrane protein, ION 100.0
3ixz_A 1034 Potassium-transporting ATPase alpha; ION pump, H+, 100.0
3ar4_A 995 Sarcoplasmic/endoplasmic reticulum calcium ATPase; 100.0
2yj3_A263 Copper-transporting ATPase; hydrolase, P-type ATPa 100.0
3skx_A280 Copper-exporting P-type ATPase B; P1B-ATPase, ATP 100.0
3a1c_A287 Probable copper-exporting P-type ATPase A; ATP-bin 100.0
4fe3_A297 Cytosolic 5'-nucleotidase 3; substrate complex, HA 99.88
1svj_A156 Potassium-transporting ATPase B chain; alpha-beta 99.72
2kmv_A185 Copper-transporting ATPase 1; menkes, nucleotide b 99.72
3mn1_A189 Probable YRBI family phosphatase; structural genom 99.69
2arf_A165 Wilson disease ATPase; P-type ATPase,ATP7B, copper 99.62
3n28_A335 Phosphoserine phosphatase; HAD family hydrolase, s 99.45
3mmz_A176 Putative HAD family hydrolase; structural genomics 99.42
3ij5_A211 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; 99.42
1k1e_A180 Deoxy-D-mannose-octulosonate 8-phosphate phosphat; 99.38
3n1u_A191 Hydrolase, HAD superfamily, subfamily III A; struc 99.36
3n07_A195 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; 99.32
3ewi_A168 N-acylneuraminate cytidylyltransferase; beta barre 99.24
1l6r_A227 Hypothetical protein TA0175; structural genomics, 99.13
3e8m_A164 Acylneuraminate cytidylyltransferase; 2-keto-3-deo 99.09
2r8e_A188 3-deoxy-D-manno-octulosonate 8-phosphate phosphata 99.08
3p96_A415 Phosphoserine phosphatase SERB; ssgcid, structural 99.05
3m1y_A217 Phosphoserine phosphatase (SERB); NYSGXRC, PSI II, 98.96
4eze_A317 Haloacid dehalogenase-like hydrolase; magnesium bi 98.9
1l7m_A211 Phosphoserine phosphatase; rossmann fold, four-hel 98.9
2p9j_A162 Hypothetical protein AQ2171; secsg, riken, PSI, st 98.89
4ap9_A201 Phosphoserine phosphatase; hydrolase, haloacid deh 98.84
4dw8_A279 Haloacid dehalogenase-like hydrolase; HAD, putativ 98.83
3m9l_A205 Hydrolase, haloacid dehalogenase-like family; HAD 98.8
3kd3_A219 Phosphoserine phosphohydrolase-like protein; csgid 98.78
3dnp_A290 Stress response protein YHAX; structural PSI-2, pr 98.77
3dao_A283 Putative phosphatse; structural genomics, joint ce 98.76
3pgv_A285 Haloacid dehalogenase-like hydrolase; structural g 98.76
4ex6_A237 ALNB; modified rossman fold, phosphatase, magnesiu 98.71
1rku_A206 Homoserine kinase; phosphoserine phosphatase, phos 98.7
3mpo_A279 Predicted hydrolase of the HAD superfamily; SGX, P 98.7
1y8a_A332 Hypothetical protein AF1437; structural genomics, 98.66
1nnl_A225 L-3-phosphoserine phosphatase; PSP, HPSP, phospho- 98.66
3mc1_A226 Predicted phosphatase, HAD family; PSI2, NYSGXRC, 98.61
2pib_A216 Phosphorylated carbohydrates phosphatase TM_1254; 98.57
2pq0_A258 Hypothetical conserved protein GK1056; hyopthetica 98.57
3r4c_A268 Hydrolase, haloacid dehalogenase-like hydrolase; h 98.55
3fvv_A232 Uncharacterized protein; unknown function, structu 98.53
3umb_A233 Dehalogenase-like hydrolase; 2.20A {Ralstonia sola 98.52
3s6j_A233 Hydrolase, haloacid dehalogenase-like family; stru 98.51
1te2_A226 Putative phosphatase; structural genomics, phospha 98.51
1rkq_A282 Hypothetical protein YIDA; two domain structure wi 98.5
3fzq_A274 Putative hydrolase; YP_001086940.1, putative haloa 98.5
2nyv_A222 Pgpase, PGP, phosphoglycolate phosphatase; structu 98.5
3l7y_A304 Putative uncharacterized protein SMU.1108C; hydrol 98.49
1swv_A267 Phosphonoacetaldehyde hydrolase; HAD enzyme superf 98.48
1wr8_A231 Phosphoglycolate phosphatase; alpha / beta core do 98.48
2hsz_A243 Novel predicted phosphatase; structural genomics, 98.48
3um9_A230 Haloacid dehalogenase, type II; haloacid dehalogen 98.47
2om6_A235 Probable phosphoserine phosphatase; rossmann fold, 98.47
3e58_A214 Putative beta-phosphoglucomutase; structu genomics 98.47
3d6j_A225 Putative haloacid dehalogenase-like hydrolase; str 98.46
4gxt_A385 A conserved functionally unknown protein; structur 98.46
3sd7_A240 Putative phosphatase; structural genomics, haloaci 98.44
3nas_A233 Beta-PGM, beta-phosphoglucomutase; PSI, structural 98.44
3l8h_A179 Putative haloacid dehalogenase-like hydrolase; HAD 98.43
2go7_A207 Hydrolase, haloacid dehalogenase-like family; stru 98.43
2gmw_A211 D,D-heptose 1,7-bisphosphate phosphatase; Zn-bindi 98.41
3u26_A234 PF00702 domain protein; structural genomics, PSI-b 98.39
2no4_A240 (S)-2-haloacid dehalogenase IVA; HAD superfamily, 98.38
2hcf_A234 Hydrolase, haloacid dehalogenase-like family; NP_6 98.36
2wf7_A221 Beta-PGM, beta-phosphoglucomutase; transition stat 98.35
1zrn_A232 L-2-haloacid dehalogenase; hydrolase; 1.83A {Pseud 98.34
3qxg_A243 Inorganic pyrophosphatase; hydrolase, magnesium bi 98.34
1rlm_A271 Phosphatase; HAD family, rossman fold, hydrolase; 98.33
3dv9_A247 Beta-phosphoglucomutase; structural genomics, APC6 98.32
3kzx_A231 HAD-superfamily hydrolase, subfamily IA, variant; 98.28
4eek_A259 Beta-phosphoglucomutase-related protein; hydrolase 98.27
1nf2_A268 Phosphatase; structural proteomics, HAD NEW fold, 98.27
3nuq_A282 Protein SSM1, putative nucleotide phosphatase; sup 98.26
3ib6_A189 Uncharacterized protein; structural genomics, unkn 98.25
2hdo_A209 Phosphoglycolate phosphatase; NP_784602.1, structu 98.25
2hoq_A241 Putative HAD-hydrolase PH1655; haloacid dehalogena 98.24
2fea_A236 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate 98.23
3ddh_A234 Putative haloacid dehalogenase-like family hydrol; 98.22
3qnm_A240 Haloacid dehalogenase-like hydrolase; structural g 98.22
3iru_A277 Phoshonoacetaldehyde hydrolase like protein; phosp 98.2
3ed5_A238 YFNB; APC60080, bacillus subtilis subsp. subtilis 98.2
1qq5_A253 Protein (L-2-haloacid dehalogenase); hydrolase; 1. 98.19
2w43_A201 Hypothetical 2-haloalkanoic acid dehalogenase; hyd 98.19
3umc_A254 Haloacid dehalogenase; HY; 2.15A {Pseudomonas aeru 98.18
3umg_A254 Haloacid dehalogenase; defluorinase, hydrolase; 2. 98.13
3smv_A240 S-(-)-azetidine-2-carboxylate hydrolase; haloacid 98.13
2zos_A249 MPGP, mannosyl-3-phosphoglycerate phosphatase; hal 98.13
2wm8_A187 MDP-1, magnesium-dependent phosphatase 1; haloacid 98.11
3gyg_A289 NTD biosynthesis operon putative hydrolase NTDB; P 98.11
3k1z_A263 Haloacid dehalogenase-like hydrolase domain-conta 98.09
2ah5_A210 COG0546: predicted phosphatases; MCSG, structural 98.08
1xvi_A275 MPGP, YEDP, putative mannosyl-3-phosphoglycerate p 98.08
2fdr_A229 Conserved hypothetical protein; SAD, structural ge 98.08
2hi0_A240 Putative phosphoglycolate phosphatase; YP_619066.1 98.06
3l5k_A250 Protein GS1, haloacid dehalogenase-like hydrolase 98.01
2qlt_A275 (DL)-glycerol-3-phosphatase 1; APC7326, RHR2P, sac 97.94
2o2x_A218 Hypothetical protein; structural genomics, joint c 97.93
2pke_A251 Haloacid delahogenase-like family hydrolase; NP_63 97.93
3kbb_A216 Phosphorylated carbohydrates phosphatase TM_1254; 97.92
2fi1_A190 Hydrolase, haloacid dehalogenase-like family; stru 97.9
3qgm_A268 P-nitrophenyl phosphatase (PHO2); structural genom 97.89
2pr7_A137 Haloacid dehalogenase/epoxide hydrolase family; NP 97.88
2gfh_A260 Haloacid dehalogenase-like hydrolase domain conta; 97.77
2oda_A196 Hypothetical protein pspto_2114; haloacid dehaloge 97.73
3vay_A230 HAD-superfamily hydrolase; rossmann fold, haloacid 97.7
3cnh_A200 Hydrolase family protein; NP_295428.1, predicted h 97.7
3pdw_A266 Uncharacterized hydrolase YUTF; structural genomic 97.68
2i6x_A211 Hydrolase, haloacid dehalogenase-like family; HAD 97.66
1u02_A239 Trehalose-6-phosphate phosphatase related protein; 97.63
1qyi_A384 ZR25, hypothetical protein; structural genomics, P 97.61
2b30_A301 Pvivax hypothetical protein; SGPP, structural geno 97.52
1nrw_A288 Hypothetical protein, haloacid dehalogenase-like h 97.5
3nvb_A387 Uncharacterized protein; protein FKBH, protein fkb 97.39
4dcc_A229 Putative haloacid dehalogenase-like hydrolase; mag 97.36
1s2o_A244 SPP, sucrose-phosphatase; phosphohydrolase, HAD su 97.36
2b0c_A206 Putative phosphatase; alpha-D-glucose-1-phosphate, 97.33
3ocu_A262 Lipoprotein E; hydrolase, outer membrane; HET: NMN 97.3
3epr_A264 Hydrolase, haloacid dehalogenase-like family; stru 97.28
2rbk_A261 Putative uncharacterized protein; HAD-like phospha 97.27
3pct_A260 Class C acid phosphatase; hydrolase, outer membran 97.22
3zx4_A259 MPGP, mannosyl-3-phosphoglycerate phosphatase; hyd 97.17
4gib_A250 Beta-phosphoglucomutase; rossmann fold, HAD-like, 97.15
4as2_A327 Phosphorylcholine phosphatase; hydrolase, HAD supe 97.14
2p11_A231 Hypothetical protein; putative haloacid dehalogena 97.13
2fpr_A176 Histidine biosynthesis bifunctional protein HISB; 97.1
1vjr_A271 4-nitrophenylphosphatase; TM1742, structural genom 96.99
1yns_A261 E-1 enzyme; hydrolase fold; HET: HPO; 1.70A {Homo 96.95
2x4d_A271 HLHPP, phospholysine phosphohistidine inorganic py 96.95
2zg6_A220 Putative uncharacterized protein ST2620, probable 96.92
3gwi_A170 Magnesium-transporting ATPase, P-type 1; P-type AT 96.81
1ltq_A301 Polynucleotide kinase; phosphatase, alpha/beta, P- 96.73
2c4n_A250 Protein NAGD; nucleotide phosphatase, HAD superfam 96.61
4g9b_A243 Beta-PGM, beta-phosphoglucomutase; HAD, putative p 96.41
2i33_A258 Acid phosphatase; HAD superfamily, hydrolase; 1.57 96.41
2g80_A253 Protein UTR4; YEL038W, UTR4 protein (unknown trans 95.82
2fue_A262 PMM 1, PMMH-22, phosphomannomutase 1; enzyme-produ 95.81
2ho4_A259 Haloacid dehalogenase-like hydrolase domain contai 95.44
2b82_A211 APHA, class B acid phosphatase; DDDD acid phosphat 95.37
2amy_A246 PMM 2, phosphomannomutase 2; HS.459855, HS.313504, 95.27
3zvl_A416 Bifunctional polynucleotide phosphatase/kinase; hy 95.26
2i7d_A193 5'(3')-deoxyribonucleotidase, cytosolic type; hydr 94.69
3i28_A 555 Epoxide hydrolase 2; aromatic hydrocarbons catabol 94.63
1yv9_A264 Hydrolase, haloacid dehalogenase family; hypotheti 93.98
2oyc_A306 PLP phosphatase, pyridoxal phosphate phosphatase; 93.67
1q92_A197 5(3)-deoxyribonucleotidase; alpha-beta rossman fol 92.64
2hhl_A195 CTD small phosphatase-like protein; CTD phosphatas 92.17
2ght_A181 Carboxy-terminal domain RNA polymerase II polypept 91.92
2obb_A142 Hypothetical protein; structural genomics, PSI-2, 91.78
3bwv_A180 Putative 5'(3')-deoxyribonucleotidase; NP_764060.1 91.73
1nrw_A288 Hypothetical protein, haloacid dehalogenase-like h 91.52
1zjj_A263 Hypothetical protein PH1952; alpha/beta hydrolase 90.84
1zjj_A263 Hypothetical protein PH1952; alpha/beta hydrolase 90.72
3f9r_A246 Phosphomannomutase; trypanosome glycobiology struc 89.3
3kc2_A352 Uncharacterized protein YKR070W; HAD-like, mitocho 87.23
2b30_A301 Pvivax hypothetical protein; SGPP, structural geno 85.78
2hx1_A284 Predicted sugar phosphatases of the HAD superfamil 81.45
2rbk_A261 Putative uncharacterized protein; HAD-like phospha 80.09
>3rfu_A Copper efflux ATPase; alpha helical, CPC, CXXC, ATP-binding, hydrolase, ION transp magnesium, Cu+, membrane, metal-binding; 3.20A {Legionella pneumophila subsp} Back     alignment and structure
Probab=100.00  E-value=2e-68  Score=585.83  Aligned_cols=385  Identities=29%  Similarity=0.438  Sum_probs=339.0

Q ss_pred             CccCchhHHHHHHHHHHHHHHHHhhhcch---hHHHHHHHHHHhcchhhHHHHHHHhhhhhhHHHHHHHHHHHHHHHHHH
Q 038599            2 KSQKKWPAPSVMASGLLLALSFLGYIYHP---LQSLAVAAVIFGLPAILIRSIASIKSLTFNINVLILMAVLIFCAFSKA   78 (473)
Q Consensus         2 ~~~~~~~~~~~i~~~i~~~~~~~~~~~~~---~~~~~~~~v~~~~~p~~l~~~~t~~~~~~~~~~~l~~a~a~~~a~~~l   78 (473)
                      +++++|+.|++++++++.++.+..+...+   ..+...+++++...|..|+...++               +++.++.++
T Consensus       337 d~~a~~~v~~vl~ia~~~~~~w~~~~~~~~~~~~l~~ai~vlviacPcaL~la~p~---------------a~~~~~~~~  401 (736)
T 3rfu_A          337 DTVSGWFVPAVILVAVLSFIVWALLGPQPALSYGLIAAVSVLIIACPCALGLATPM---------------SIMVGVGKG  401 (736)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHCSSSSTTHHHHHHHHHHHHHCCSTHHHHHHH---------------HHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHhCCCchHHHHHHHHHHhHHHhhhhHHHHHHHH---------------HHHHHHHHH
Confidence            45678888888888887666543321111   111233333333344444433332               889999999


Q ss_pred             HHCCceeeCchHhhhhcCccEEEEcCCCcCCCCceEEEEEEecCCCCCHHHHHHHHHhhhccCCChHHHHHHHHHHHcCC
Q 038599           79 ATTGLLVKGGDYLEILAKVKMVALDKTGTVTRGEFTVTDFQSICDDVSLGTLLYWVSSIESKSSHPMAAALVDYARSLAI  158 (473)
Q Consensus        79 ak~gilvk~~~~lE~lg~vd~i~fDKTGTLT~g~~~V~~i~~~~~~~~~~~ll~~~a~~e~~s~hpi~~Ai~~~a~~~~~  158 (473)
                      +|+|+++|+++++|++|++|+||||||||||+|+|+|.++. . ++.+.++++.+++++|..++||+++|+++++++.++
T Consensus       402 a~~gilvk~~~alE~l~~v~~i~fDKTGTLT~g~~~v~~i~-~-~~~~~~~~l~~aa~le~~s~hPla~Aiv~~a~~~~~  479 (736)
T 3rfu_A          402 AQSGVLIKNAEALERMEKVNTLVVDKTGTLTEGHPKLTRIV-T-DDFVEDNALALAAALEHQSEHPLANAIVHAAKEKGL  479 (736)
T ss_dssp             HHTTEEESCHHHHHHHTSCCEEEECCBTTTBCSSCEEEEEE-E-SSSCHHHHHHHHHHHHHSSCCHHHHHHHHHHHTTCC
T ss_pred             hhcceeechHHHHHHhcCCCEEEEeCCCCCcCCceEEEEEE-e-cCCCHHHHHHHHHHHhhcCCChHHHHHHHHHHhcCC
Confidence            99999999999999999999999999999999999999998 3 567888999999999999999999999999998887


Q ss_pred             CCCCCCccccccccCCceeEEecCeEEEEccccccCCCCCCcch---hHHHHhcCCceeeEeeeCCeEEEEEEecCccCC
Q 038599          159 EPVPENVEDFQNFPGEGIFGKIHGNVIYIGNRRIGPRTGCSKDS---IAEAKCTGGKTRGYVYLGATPVGTFSLSDSCRS  235 (473)
Q Consensus       159 ~~~~~~v~~~~~~~g~gv~~~v~g~~~~iG~~~~~~~~~~~~~~---~~~~~~~~G~~vi~va~d~~~lG~i~l~d~lr~  235 (473)
                      ..  ..+.+|+..+|+|+.+.++|+.+.+|+++++.+.+.+..+   ..+++.++|++++++++|++++|++.++|++|+
T Consensus       480 ~~--~~~~~f~~~~g~gv~~~~~g~~~~~G~~~~~~~~~~~~~~~~~~~~~~~~~G~~vl~va~d~~~~G~i~i~D~i~~  557 (736)
T 3rfu_A          480 SL--GSVEAFEAPTGKGVVGQVDGHHVAIGNARLMQEHGGDNAPLFEKADELRGKGASVMFMAVDGKTVALLVVEDPIKS  557 (736)
T ss_dssp             CC--CCCSCCCCCTTTEEEECSSSSCEEEESHHHHHHHCCCCHHHHHHHHHHHHTTCEEEEEEETTEEEEEEEEECCBCS
T ss_pred             Cc--cCcccccccCCceEEEEECCEEEEEcCHHHHHHcCCChhHHHHHHHHHHhcCCeEEEEEECCEEEEEEEeeccchh
Confidence            65  4678899999999999999999999999998776665432   356788999999999999999999999999999


Q ss_pred             chHHHHHHHHhCCCeEEEEcCCCHHHHHHHHHHcCCCccceehccChhhHHHHHHHHhhCC-cEEEEcCCcccHHHHHHC
Q 038599          236 GALEAIKDLKSLGIKSFILAGDSHAAALYAQDQLDHAFDMVYAELLPQHKEELVELLKKDG-ATAMVGDGINDAPALAAV  314 (473)
Q Consensus       236 ~a~~~I~~L~~~gi~v~mlTGD~~~~a~~~a~~~gi~~~~v~a~~~P~~K~~~v~~l~~~g-~v~mvGDG~ND~~al~~A  314 (473)
                      +++++|++||++|++++|+|||+..++..+++++||+  .++++++|++|.++|+.||++| .|+|+|||.||+|||++|
T Consensus       558 ~~~~aI~~L~~~Gi~v~mlTGd~~~~a~~ia~~lgi~--~v~a~~~P~~K~~~v~~l~~~g~~V~~vGDG~ND~paL~~A  635 (736)
T 3rfu_A          558 STPETILELQQSGIEIVMLTGDSKRTAEAVAGTLGIK--KVVAEIMPEDKSRIVSELKDKGLIVAMAGDGVNDAPALAKA  635 (736)
T ss_dssp             SHHHHHHHHHHHTCEEEEECSSCHHHHHHHHHHHTCC--CEECSCCHHHHHHHHHHHHHHSCCEEEEECSSTTHHHHHHS
T ss_pred             hHHHHHHHHHHCCCeEEEECCCCHHHHHHHHHHcCCC--EEEEecCHHHHHHHHHHHHhcCCEEEEEECChHhHHHHHhC
Confidence            9999999999999999999999999999999999998  8999999999999999999998 999999999999999999


Q ss_pred             CeeEEeCCCCCccccccccEEEecCCcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH------Hhh-HHHHHHH
Q 038599          315 DIGISMGISGSALAMESGHVILMSNDIRKIPKAIKLARKASTKLIQNVTLSVTVKGAVLVLAV------AGY-PLVWVAV  387 (473)
Q Consensus       315 dvgIa~g~~~~~~a~~~ad~vl~~~~l~~l~~~i~~~r~~~~~i~~n~~~~~~~n~~~~~la~------~g~-~~~~~a~  387 (473)
                      |+||+|| ++++.++++||++++++|+.++++++++||++++++++|+.|++.||++++++++      +|+ .+||++.
T Consensus       636 dvGIAmg-~g~d~a~~~AD~vl~~~~~~~i~~ai~~sr~t~~~i~qnl~~a~~yN~~~iplAag~l~p~~G~~l~P~~aa  714 (736)
T 3rfu_A          636 DIGIAMG-TGTDVAIESAGVTLLHGDLRGIAKARRLSESTMSNIRQNLFFAFIYNVLGVPLAAGVLYPLTGLLLSPMIAA  714 (736)
T ss_dssp             SEEEEES-SSCSHHHHHCSEEECSCCSTTHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTSSTTTSSCCCCHHHHH
T ss_pred             CEEEEeC-CccHHHHHhCCEEEccCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhccchhhHHHHH
Confidence            9999999 8999999999999999999999999999999999999999999999999999998      565 4899999


Q ss_pred             HHHHHHHHHHHHHhHhhhccc
Q 038599          388 LTDVGTCLVVILNSMLLLKNN  408 (473)
Q Consensus       388 l~~~~s~l~v~~ns~~l~~~~  408 (473)
                      ++|.+|+++|++||+|+++++
T Consensus       715 ~~m~~Ssv~Vv~nslrl~~~~  735 (736)
T 3rfu_A          715 AAMALSSVSVIINALRLKRVT  735 (736)
T ss_dssp             HHHHHHHHHHHHHHHTCCCTT
T ss_pred             HHHHhhHHHHHHHHHHhcccC
Confidence            999999999999999997654
>3j09_A COPA, copper-exporting P-type ATPase A; copper transporter, adenosine triphosph archaeal proteins, cation transport proteins; 10.00A {Archaeoglobus fulgidus} Back     alignment and structure
>3j08_A COPA, copper-exporting P-type ATPase A; copper transporter, adenosine triphosph archaeal proteins, cation transport proteins; 10.00A {Archaeoglobus fulgidus} Back     alignment and structure
>1mhs_A Proton pump, plasma membrane ATPase; ION transport, membrane protein, P-type ATPase, active transport, cryo-electron microscopy; 8.00A {Neurospora crassa} SCOP: i.18.1.1 Back     alignment and structure
>3b8c_A ATPase 2, plasma membrane-type; P-type ATPase, proton pump, ATP-binding, hydrogen ION transport, hydrolase, ION transport; HET: ACP; 3.60A {Arabidopsis thaliana} Back     alignment and structure
>2zxe_A Na, K-ATPase alpha subunit; membrane protein, ION pump, ATPase, K+ binding, haloacid dehydrogenease superfamily, phosphate analogue; HET: CLR NAG NDG; 2.40A {Squalus acanthias} PDB: 3a3y_A* 3b8e_A* 3kdp_A* 3n2f_A* 3n23_A* 1mo7_A 1mo8_A* 1q3i_A Back     alignment and structure
>3ixz_A Potassium-transporting ATPase alpha; ION pump, H+, K+-ATPase, P-type ATPase, membrane protein, hydrolase, aluminium fluoride, ATP-binding; 6.50A {Sus scrofa} PDB: 2yn9_A 2xzb_A 1iwc_A 1iwf_A Back     alignment and structure
>3ar4_A Sarcoplasmic/endoplasmic reticulum calcium ATPase; P-type ATPase, hydrolase, calcium transport, calcium binding binding; HET: ATP TG1 PTY; 2.15A {Oryctolagus cuniculus} PDB: 2ear_A* 2eas_A* 2eat_A* 2eau_A* 2dqs_A* 2zbe_A 2zbf_A* 2zbg_A* 3ar2_A* 2zbd_A* 3ar3_A* 3ar5_A* 3ar6_A* 3ar7_A* 3ar8_A* 3ar9_A* 3n5k_A* 1kju_A 1iwo_A 1t5s_A* ... Back     alignment and structure
>2yj3_A Copper-transporting ATPase; hydrolase, P-type ATPase, COPB, heavy metal translocation; 2.20A {Sulfolobus solfataricus} PDB: 2iye_A 2yj6_A* 2yj5_A* 2yj4_A* Back     alignment and structure
>3skx_A Copper-exporting P-type ATPase B; P1B-ATPase, ATP binding domain, copper(II) transporter, MEMB protein, hydrolase; 1.59A {Archaeoglobus fulgidus} PDB: 3sky_A* Back     alignment and structure
>3a1c_A Probable copper-exporting P-type ATPase A; ATP-binding, cell membrane, copper transport, hydrolase, ION transport, magnesium, membrane; HET: ACP; 1.85A {Archaeoglobus fulgidus} PDB: 3a1d_A* 3a1e_A* 2b8e_A 2voy_J 2voy_I Back     alignment and structure
>4fe3_A Cytosolic 5'-nucleotidase 3; substrate complex, HAD-like, protein binding; HET: U5P; 1.74A {Mus musculus} PDB: 2g09_A* 2bdu_A* 2g08_A 2g06_A* 2g0a_A* 2q4t_A* 2g07_A* 2jga_A 2vkq_A 2cn1_A Back     alignment and structure
>1svj_A Potassium-transporting ATPase B chain; alpha-beta sandwich, hydrolase; NMR {Escherichia coli} SCOP: d.220.1.1 PDB: 1u7q_A 2a00_A* 2a29_A* Back     alignment and structure
>2kmv_A Copper-transporting ATPase 1; menkes, nucleotide binding protein, alternative splicing, ATP-binding, cell membrane, cytoplasm, disease mutation; NMR {Homo sapiens} PDB: 2kmx_A* Back     alignment and structure
>3mn1_A Probable YRBI family phosphatase; structural genomics, PSI, protein structure initiative, NYSG phosphatase; 1.80A {Pseudomonas syringae PV} PDB: 3nrj_A Back     alignment and structure
>2arf_A Wilson disease ATPase; P-type ATPase,ATP7B, copper transport, nucleotide binding, ATP binding, hydrolase; NMR {Homo sapiens} PDB: 2koy_A Back     alignment and structure
>3n28_A Phosphoserine phosphatase; HAD family hydrolase, structural genomics, PSI, protein STRU initiative, nysgrc; 2.30A {Vibrio cholerae} Back     alignment and structure
>3mmz_A Putative HAD family hydrolase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 1.84A {Streptomyces avermitilis} Back     alignment and structure
>3ij5_A 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; IDP022 hydrolase, lipopolysaccharide biosynthesis, magnesium, STRU genomics; 1.95A {Yersinia pestis} Back     alignment and structure
>1k1e_A Deoxy-D-mannose-octulosonate 8-phosphate phosphat; structural genomics, KDO 8-P phosphatase, structure function project, S2F; HET: MES; 1.67A {Haemophilus influenzae RD} SCOP: c.108.1.5 PDB: 1j8d_A* Back     alignment and structure
>3n1u_A Hydrolase, HAD superfamily, subfamily III A; structural genomics, PSI-2; 1.80A {Legionella pneumophila} SCOP: c.108.1.0 Back     alignment and structure
>3n07_A 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; structural genomics, phosphatase, PSI-2, protein structure initiative; HET: MSE; 1.76A {Vibrio cholerae} Back     alignment and structure
>3ewi_A N-acylneuraminate cytidylyltransferase; beta barrel, HAD-like, rossmannoid fold, nucleotidyltransferase, nucleus; 1.90A {Mus musculus} Back     alignment and structure
>1l6r_A Hypothetical protein TA0175; structural genomics, putative hydrolas midwest center for structural genomics, MCSG, PSI; 1.40A {Thermoplasma acidophilum} SCOP: c.108.1.10 PDB: 1kyt_A Back     alignment and structure
>3e8m_A Acylneuraminate cytidylyltransferase; 2-keto-3-deoxynononic acid 9-phosphate phosphohydrolase, nucleotidyltransferase; HET: PEG PG4 EDO PGE; 1.10A {Bacteroides thetaiotaomicron} PDB: 3e84_A 3e81_A* Back     alignment and structure
>2r8e_A 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase; YRBI, divalent metal, HAD superfamily, KDO 8-P, hydrolase; 1.40A {Escherichia coli O6} PDB: 2r8x_A 2r8y_A 2r8z_A 3hyc_A 3i6b_A* Back     alignment and structure
>3p96_A Phosphoserine phosphatase SERB; ssgcid, structural genomics, structural genomics center for infectious disease, hydrolas; 2.05A {Mycobacterium avium} Back     alignment and structure
>3m1y_A Phosphoserine phosphatase (SERB); NYSGXRC, PSI II, phophoserine phosphatase, protein structure initiative, structural genomics; 2.40A {Helicobacter pylori} SCOP: c.108.1.0 Back     alignment and structure
>4eze_A Haloacid dehalogenase-like hydrolase; magnesium binding site, enzyme function initiativ; 2.27A {Salmonella enterica subsp} Back     alignment and structure
>1l7m_A Phosphoserine phosphatase; rossmann fold, four-helix bundle, B-hairpin, structural genomics, BSGC structure funded by NIH; 1.48A {Methanocaldococcus jannaschii} SCOP: c.108.1.4 PDB: 1f5s_A 1l7n_A 1l7p_A* 1l7o_A* 1j97_A* Back     alignment and structure
>2p9j_A Hypothetical protein AQ2171; secsg, riken, PSI, structural GENO protein structure initiative, southeast collaboratory for S genomics; 2.40A {Aquifex aeolicus} Back     alignment and structure
>4ap9_A Phosphoserine phosphatase; hydrolase, haloacid dehalogenase superfamily, NDSB; HET: 1PS; 1.78A {Thermococcus onnurineus} PDB: 4b6j_A Back     alignment and structure
>4dw8_A Haloacid dehalogenase-like hydrolase; HAD, putative phosphatase, enzyme function initiative, EFI, structural genomics; 1.50A {Bacteroides thetaiotaomicron} PDB: 3niw_A 4dwo_A Back     alignment and structure
>3m9l_A Hydrolase, haloacid dehalogenase-like family; HAD family hydrolase, structural genomics, PSI, protein structure initiative; HET: MSE; 1.60A {Pseudomonas fluorescens} PDB: 2ybd_A* 3r09_A* Back     alignment and structure
>3kd3_A Phosphoserine phosphohydrolase-like protein; csgid, niaid, S genomics, national institute of allergy and infectious DISE (niaid); 1.70A {Francisella tularensis subsp} Back     alignment and structure
>3dnp_A Stress response protein YHAX; structural PSI-2, protein structure initiative, midwest center for STR genomics, MCSG, unknown function; HET: MSE; 1.85A {Bacillus subtilis} SCOP: c.108.1.0 Back     alignment and structure
>3dao_A Putative phosphatse; structural genomics, joint center for S genomics, JCSG, protein structure initiative, PSI-2, hydrol; HET: MSE 1PE CIT; 1.80A {Eubacterium rectale} Back     alignment and structure
>3pgv_A Haloacid dehalogenase-like hydrolase; structural genomics, joint center for structural genomics, J protein structure initiative; HET: EPE; 2.39A {Klebsiella pneumoniae subsp} Back     alignment and structure
>4ex6_A ALNB; modified rossman fold, phosphatase, magnesium binding, hydro; 1.25A {Streptomyces SP} PDB: 4ex7_A Back     alignment and structure
>1rku_A Homoserine kinase; phosphoserine phosphatase, phosphoserine:homoserine phosphotransferase, THRH, phosphoserine phosphoryl donor; 1.47A {Pseudomonas aeruginosa} SCOP: c.108.1.11 PDB: 1rkv_A Back     alignment and structure
>3mpo_A Predicted hydrolase of the HAD superfamily; SGX, PSI, structural genomics, protein structure initiative; 2.90A {Lactobacillus brevis} SCOP: c.108.1.0 Back     alignment and structure
>1y8a_A Hypothetical protein AF1437; structural genomics, protein structu initiative, PSI, midwest center for structural genomics; 1.40A {Archaeoglobus fulgidus} SCOP: c.108.1.24 Back     alignment and structure
>1nnl_A L-3-phosphoserine phosphatase; PSP, HPSP, phospho-aspartyl, hydrolase; 1.53A {Homo sapiens} SCOP: c.108.1.4 PDB: 1l8l_A* 1l8o_A Back     alignment and structure
>3mc1_A Predicted phosphatase, HAD family; PSI2, NYSGXRC, structural genomics, protein structure initiative; 1.93A {Clostridium acetobutylicum} SCOP: c.108.1.0 Back     alignment and structure
>2pq0_A Hypothetical conserved protein GK1056; hyopthetical protein, structural genomics, unknown function; 2.60A {Geobacillus kaustophilus} PDB: 2qyh_A Back     alignment and structure
>3r4c_A Hydrolase, haloacid dehalogenase-like hydrolase; haloalkanoate dehalogenase enzyme superfamily, phosphohydrol hydrolase; 1.82A {Bacteroides thetaiotaomicron} SCOP: c.108.1.0 Back     alignment and structure
>3fvv_A Uncharacterized protein; unknown function, structural genomics, PSI,MCSG, protein STR initiative, midwest center for structural genomics; 2.10A {Bordetella pertussis} Back     alignment and structure
>3umb_A Dehalogenase-like hydrolase; 2.20A {Ralstonia solanacearum} Back     alignment and structure
>3s6j_A Hydrolase, haloacid dehalogenase-like family; structural genomics, PSI-2; 2.20A {Pseudomonas syringae PV} Back     alignment and structure
>1te2_A Putative phosphatase; structural genomics, phosphates, PSI, protein S initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.76A {Escherichia coli} SCOP: c.108.1.6 Back     alignment and structure
>1rkq_A Hypothetical protein YIDA; two domain structure with beta-alpha sandwich. stucture contains A magnesium ION., PSI, protein structure initiative; 1.40A {Escherichia coli} SCOP: c.108.1.10 Back     alignment and structure
>3fzq_A Putative hydrolase; YP_001086940.1, putative haloacid dehalogenase-like hydrolas structural genomics, joint center for structural genomics; HET: MSE; 2.10A {Clostridium difficile} SCOP: c.108.1.0 Back     alignment and structure
>2nyv_A Pgpase, PGP, phosphoglycolate phosphatase; structural genomics, PSI-2, protein structure initiative; 2.10A {Aquifex aeolicus} PDB: 2yy6_A Back     alignment and structure
>3l7y_A Putative uncharacterized protein SMU.1108C; hydrolase; 2.00A {Streptococcus mutans} Back     alignment and structure
>1swv_A Phosphonoacetaldehyde hydrolase; HAD enzyme superfamily, phosphonotase, metal binding; 2.30A {Bacillus cereus} SCOP: c.108.1.3 PDB: 1sww_A 2iof_A* 2ioh_A 1rql_A 1rqn_A 2iof_K* 1rdf_A 1fez_A Back     alignment and structure
>1wr8_A Phosphoglycolate phosphatase; alpha / beta core domain, HAD superfamily, structural genomi structural genomics/proteomics initiative, RSGI; 1.60A {Pyrococcus horikoshii} SCOP: c.108.1.10 Back     alignment and structure
>2hsz_A Novel predicted phosphatase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: UNL; 1.90A {Haemophilus somnus 129PT} SCOP: c.108.1.6 Back     alignment and structure
>3um9_A Haloacid dehalogenase, type II; haloacid dehalogenase-like hydrolase protein superfamily, defluorinase, hydrolase; 2.19A {Polaromonas SP} Back     alignment and structure
>2om6_A Probable phosphoserine phosphatase; rossmann fold, B-hairpin, four-helix bundle, structural GENO NPPSFA; 2.20A {Pyrococcus horikoshii} Back     alignment and structure
>3e58_A Putative beta-phosphoglucomutase; structu genomics, PSI-2, protein structure initiative, midwest CENT structural genomics; 1.86A {Streptococcus thermophilus lmg 18311} Back     alignment and structure
>3d6j_A Putative haloacid dehalogenase-like hydrolase; structural genomics, PSI-2, protein structure initiative; 2.00A {Bacteroides fragilis nctc 9343} Back     alignment and structure
>4gxt_A A conserved functionally unknown protein; structural genomics, PSI-biology; 1.82A {Anaerococcus prevotii} Back     alignment and structure
>3sd7_A Putative phosphatase; structural genomics, haloacid dehalogenase-like hydrolase, H center for structural genomics of infectious diseases; HET: PGE; 1.70A {Clostridium difficile} Back     alignment and structure
>3nas_A Beta-PGM, beta-phosphoglucomutase; PSI, structural genomics, protein structure initiative, NEW research center for structural genomics; 3.00A {Bacillus subtilis} Back     alignment and structure
>3l8h_A Putative haloacid dehalogenase-like hydrolase; HAD superfamily, GMHB, D-glycero-D-manno-heptose-1, 7-bispho phosphatase; HET: FX1; 1.68A {Bordetella bronchiseptica} Back     alignment and structure
>2go7_A Hydrolase, haloacid dehalogenase-like family; structural genomics, joint center for structural genomics, J protein structure initiative; 2.10A {Streptococcus pneumoniae} SCOP: c.108.1.6 Back     alignment and structure
>2gmw_A D,D-heptose 1,7-bisphosphate phosphatase; Zn-binding protein, hydrolase; 1.50A {Escherichia coli} SCOP: c.108.1.19 PDB: 3esq_A 3esr_A 3l1u_A 3l1v_A 3l8e_A 3l8f_A 3l8g_A* Back     alignment and structure
>3u26_A PF00702 domain protein; structural genomics, PSI-biology, northeast structural genom consortium, NESG, unknown function; 1.59A {Pyrococcus horikoshii} SCOP: c.108.1.1 PDB: 1x42_A Back     alignment and structure
>2no4_A (S)-2-haloacid dehalogenase IVA; HAD superfamily, rossman fold, hydrol; 1.93A {Burkholderia cepacia} PDB: 2no5_A* Back     alignment and structure
>2hcf_A Hydrolase, haloacid dehalogenase-like family; NP_662590.1, ST genomics, PSI-2, protein structure initiative; 1.80A {Chlorobaculum tepidum} SCOP: c.108.1.6 Back     alignment and structure
>2wf7_A Beta-PGM, beta-phosphoglucomutase; transition state analogue, haloacid dehalogenase superfamily, isomerase, phosphotransferase; HET: G7P; 1.05A {Lactococcus lactis} PDB: 1o03_A* 1z4n_A* 1z4o_A* 1zol_A 2wf5_A* 2wf6_A* 1o08_A* 2wf8_A* 2wf9_A* 2wfa_A 2whe_A 1lvh_A* 3fm9_A Back     alignment and structure
>1zrn_A L-2-haloacid dehalogenase; hydrolase; 1.83A {Pseudomonas SP} SCOP: c.108.1.1 PDB: 1zrm_A 1jud_A 1qh9_A Back     alignment and structure
>3qxg_A Inorganic pyrophosphatase; hydrolase, magnesium binding site, NEW YORK research center for structural genomics; HET: TLA; 1.24A {Bacteroides thetaiotaomicron} PDB: 3qu2_A* 3qx7_A 3quq_A* 3r9k_A 3qut_A 3qu9_A* 3qu7_A 3qu5_A 3qyp_A 3quc_A 3qub_A 3qu4_A Back     alignment and structure
>1rlm_A Phosphatase; HAD family, rossman fold, hydrolase; 1.90A {Escherichia coli} SCOP: c.108.1.10 PDB: 1rlt_A 1rlo_A* 2hf2_A Back     alignment and structure
>3dv9_A Beta-phosphoglucomutase; structural genomics, APC60149, PSI- protein structure initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.72A {Bacteroides vulgatus} Back     alignment and structure
>3kzx_A HAD-superfamily hydrolase, subfamily IA, variant; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ehrlich chaffeensis; 1.90A {Ehrlichia chaffeensis} Back     alignment and structure
>4eek_A Beta-phosphoglucomutase-related protein; hydrolase, magnesium binding site, enzyme function initiativ; 1.60A {Deinococcus radiodurans} PDB: 4eel_A* 4een_A Back     alignment and structure
>1nf2_A Phosphatase; structural proteomics, HAD NEW fold, structural genomics, BSGC structure funded by NIH structure initiative, PSI; 2.20A {Thermotoga maritima} SCOP: c.108.1.10 Back     alignment and structure
>3nuq_A Protein SSM1, putative nucleotide phosphatase; suppresses the 6-AU sensitivity of transcription elongation II; 1.70A {Saccharomyces cerevisiae} PDB: 3onn_A 3opx_A* Back     alignment and structure
>3ib6_A Uncharacterized protein; structural genomics, unknown function, PSI-2, protein struct initiative; 2.20A {Listeria monocytogenes} Back     alignment and structure
>2hdo_A Phosphoglycolate phosphatase; NP_784602.1, structur genomics, PSI-2, protein structure initiative, joint center structural genomics; HET: MSE; 1.50A {Lactobacillus plantarum} SCOP: c.108.1.6 Back     alignment and structure
>2hoq_A Putative HAD-hydrolase PH1655; haloacid dehalogenase, structural genomics, NPPSFA, national on protein structural and functional analyses; 1.70A {Pyrococcus horikoshii} Back     alignment and structure
>2fea_A 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase; 2633731, structural genomics, joint center for structural GE JCSG; HET: MSE; 2.00A {Bacillus subtilis} SCOP: c.108.1.20 Back     alignment and structure
>3ddh_A Putative haloacid dehalogenase-like family hydrol; hydrolase, HAD superfamily, ST genomics, PSI-2, protein structure initiative; 2.00A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3qnm_A Haloacid dehalogenase-like hydrolase; structural genomics, PSI-2, protein structure initiative; 1.70A {Bacteroides thetaiotaomicron} SCOP: c.108.1.0 Back     alignment and structure
>3iru_A Phoshonoacetaldehyde hydrolase like protein; phosphonoacetaldehyde hydrolase like P structural genomics, PSI-2, protein structure initiative; 2.30A {Oleispira antarctica} SCOP: c.108.1.0 Back     alignment and structure
>3ed5_A YFNB; APC60080, bacillus subtilis subsp. subtilis STR. 168, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.72A {Bacillus subtilis} PDB: 3i76_A Back     alignment and structure
>1qq5_A Protein (L-2-haloacid dehalogenase); hydrolase; 1.52A {Xanthobacter autotrophicus} SCOP: c.108.1.1 PDB: 1qq6_A* 1qq7_A* 1aq6_A Back     alignment and structure
>2w43_A Hypothetical 2-haloalkanoic acid dehalogenase; hydrolase, metabolic process; HET: MES; 1.66A {Sulfolobus tokodaii} PDB: 2w11_A Back     alignment and structure
>3umc_A Haloacid dehalogenase; HY; 2.15A {Pseudomonas aeruginosa} Back     alignment and structure
>3umg_A Haloacid dehalogenase; defluorinase, hydrolase; 2.25A {Rhodococcus jostii} Back     alignment and structure
>3smv_A S-(-)-azetidine-2-carboxylate hydrolase; haloacid dehalogenase superfamily, L-azetidine-2- carboxylate; HET: GOL; 1.38A {Pseudomonas} Back     alignment and structure
>2zos_A MPGP, mannosyl-3-phosphoglycerate phosphatase; haloacid dehalogenase like hydrolase, mannosylglycerate, cytoplasm, hydrolase, magnesium; 1.70A {Pyrococcus horikoshii} PDB: 1wzc_A Back     alignment and structure
>2wm8_A MDP-1, magnesium-dependent phosphatase 1; haloacid dehalogenase, protein phosphatase, hydrolase, magne metal-binding; 1.75A {Homo sapiens} PDB: 1u7o_A 1u7p_A Back     alignment and structure
>3gyg_A NTD biosynthesis operon putative hydrolase NTDB; PF05116, PF08282, MCSG, PSI-2, haloacid dehalogenase-like HY structural genomics; 2.45A {Bacillus subtilis subsp} Back     alignment and structure
>3k1z_A Haloacid dehalogenase-like hydrolase domain-conta protein 3; HDHD3, haloacid dehalogenase-like hydrolase domain containin structural genomics; 1.55A {Homo sapiens} Back     alignment and structure
>2ah5_A COG0546: predicted phosphatases; MCSG, structural genomics, hydrola haloacid dehalogenase-like, PSI; 1.74A {Streptococcus pneumoniae} SCOP: c.108.1.6 Back     alignment and structure
>1xvi_A MPGP, YEDP, putative mannosyl-3-phosphoglycerate phosphatase; hypothetical protein, conserved protein, phophatase-like domain; HET: 1PE PG4 PGE; 2.26A {Escherichia coli K12} SCOP: c.108.1.10 Back     alignment and structure
>2fdr_A Conserved hypothetical protein; SAD, structural genomics, agrobacter tumefaciens, HAD-superfamily hydrolase; 2.00A {Agrobacterium tumefaciens str} SCOP: c.108.1.6 Back     alignment and structure
>2hi0_A Putative phosphoglycolate phosphatase; YP_619066.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.51A {Lactobacillus delbrueckii} Back     alignment and structure
>3l5k_A Protein GS1, haloacid dehalogenase-like hydrolase domain- containing protein 1A; HDHD1A, haloacid dehalogenase-like hydrolase domain containing 1A; 2.00A {Homo sapiens} Back     alignment and structure
>2qlt_A (DL)-glycerol-3-phosphatase 1; APC7326, RHR2P, saccharom cerevisiae, structural genomics, PSI-2, protein structure initiative; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2o2x_A Hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, hydrolase; 1.50A {Mesorhizobium loti} SCOP: c.108.1.19 Back     alignment and structure
>2pke_A Haloacid delahogenase-like family hydrolase; NP_639141.1, ST genomics, joint center for structural genomics, JCSG; 1.81A {Xanthomonas campestris PV} Back     alignment and structure
>3kbb_A Phosphorylated carbohydrates phosphatase TM_1254; hydrolase, arbohydrate metabolism, COBA magnesium, manganese, metal-binding, nickel; HET: MSE GOL; 1.74A {Thermotoga maritima MSB8} Back     alignment and structure
>2fi1_A Hydrolase, haloacid dehalogenase-like family; structural genomics, haloacid dehalogenase-like F PSI, protein structure initiative; 1.40A {Streptococcus pneumoniae} SCOP: c.108.1.3 Back     alignment and structure
>3qgm_A P-nitrophenyl phosphatase (PHO2); structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE; 2.00A {Archaeoglobus fulgidus} SCOP: c.108.1.0 Back     alignment and structure
>2pr7_A Haloacid dehalogenase/epoxide hydrolase family; NP_599989.1, uncharacterized protein, structural genomics; 1.44A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>2gfh_A Haloacid dehalogenase-like hydrolase domain conta; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 1.90A {Mus musculus} SCOP: c.108.1.6 PDB: 2w4m_A Back     alignment and structure
>2oda_A Hypothetical protein pspto_2114; haloacid dehalogenase, phosphonoacetaldehyde hydrolase, protein binding; HET: EPE; 1.90A {Pseudomonas syringae PV} Back     alignment and structure
>3vay_A HAD-superfamily hydrolase; rossmann fold, haloacid dehalogenase; 1.98A {Pseudomonas syringae PV} Back     alignment and structure
>3cnh_A Hydrolase family protein; NP_295428.1, predicted hydrolase of haloacid dehalogenase-LI superfamily; HET: MSE PG4; 1.66A {Deinococcus radiodurans R1} Back     alignment and structure
>3pdw_A Uncharacterized hydrolase YUTF; structural genomics, PSI2, NYSGXRC, protein structure initia YORK SGX research center for structural genomics; 1.60A {Bacillus subtilis} SCOP: c.108.1.0 Back     alignment and structure
>2i6x_A Hydrolase, haloacid dehalogenase-like family; HAD superfamily, struct genomics, PSI-2, protein structure initiative; HET: MSE; 2.40A {Porphyromonas gingivalis} Back     alignment and structure
>1u02_A Trehalose-6-phosphate phosphatase related protein; structural genomics, PSI; 1.92A {Thermoplasma acidophilum} SCOP: c.108.1.15 Back     alignment and structure
>1qyi_A ZR25, hypothetical protein; structural genomics, PSI, protein structure initiative, NORT structural genomics consortium, NESG; 2.50A {Staphylococcus aureus subsp} SCOP: c.108.1.13 Back     alignment and structure
>2b30_A Pvivax hypothetical protein; SGPP, structural genomics, PSI, protein structure initiative; 2.70A {Plasmodium vivax} SCOP: c.108.1.10 Back     alignment and structure
>1nrw_A Hypothetical protein, haloacid dehalogenase-like hydrolase; structural genomics, PSI, protein structure initiative; 1.70A {Bacillus subtilis} SCOP: c.108.1.10 Back     alignment and structure
>4dcc_A Putative haloacid dehalogenase-like hydrolase; magnesium binding site, enzyme function initiativ; 1.65A {Bacteroides thetaiotaomicron} PDB: 4dfd_A 4f71_A 4f72_A Back     alignment and structure
>1s2o_A SPP, sucrose-phosphatase; phosphohydrolase, HAD superfamily, cyanobacteria; 1.40A {Synechocystis SP} SCOP: c.108.1.10 PDB: 1tj3_A 1tj4_A* 1tj5_A* 1u2s_A* 1u2t_A* 2b1q_A* 2b1r_A* 2d2v_A* Back     alignment and structure
>2b0c_A Putative phosphatase; alpha-D-glucose-1-phosphate, structural genomic protein structure initiative, midwest center for structural genomics, MCSG; HET: G1P; 2.00A {Escherichia coli} SCOP: c.108.1.2 Back     alignment and structure
>3ocu_A Lipoprotein E; hydrolase, outer membrane; HET: NMN; 1.35A {Haemophilus influenzae} PDB: 3ocv_A* 3ocw_A* 3ocx_A* 3ocz_A* 3ocy_A* 3sf0_A* 2hlk_A 2hll_A 3et4_A 3et5_A Back     alignment and structure
>3epr_A Hydrolase, haloacid dehalogenase-like family; structural genomics, unknown function, HAD superfamily hydro PSI-2; 1.55A {Streptococcus agalactiae serogroup V} SCOP: c.108.1.14 PDB: 1ys9_A 1wvi_A 1ydf_A Back     alignment and structure
>2rbk_A Putative uncharacterized protein; HAD-like phosphatase, unknown function; 1.00A {Bacteroides thetaiotaomicron} SCOP: c.108.1.10 PDB: 1ymq_A 2rb5_A 2rav_A 2rar_A Back     alignment and structure
>3pct_A Class C acid phosphatase; hydrolase, outer membrane; 1.85A {Pasteurella multocida} Back     alignment and structure
>3zx4_A MPGP, mannosyl-3-phosphoglycerate phosphatase; hydrolase, haloalkanoid acid dehalogenase-like phosphatase, crystallographic snapshot; HET: 2M8; 1.74A {Thermus thermophilus} PDB: 3zty_A 3zu6_A* 3ztw_A* 3zw7_A* 3zwd_A* 3zwk_A 3zup_A* 3zx5_A* Back     alignment and structure
>4gib_A Beta-phosphoglucomutase; rossmann fold, HAD-like, structural genomics, center for structural genomics of infectious DISE csgid, isomerase; 2.27A {Clostridium difficile} Back     alignment and structure
>4as2_A Phosphorylcholine phosphatase; hydrolase, HAD superfamily, alkylammonium compounds; HET: BTB; 2.12A {Pseudomonas aeruginosa} PDB: 4as3_A* Back     alignment and structure
>2p11_A Hypothetical protein; putative haloacid dehalogenase-like hydrolase, structural GE joint center for structural genomics, JCSG; 2.20A {Burkholderia xenovorans} Back     alignment and structure
>2fpr_A Histidine biosynthesis bifunctional protein HISB; histidinola phosphate phosphatase, bifunctional enzyme structural genomics; 1.70A {Escherichia coli} SCOP: c.108.1.19 PDB: 2fps_A 2fpu_A* 2fpx_A 2fpw_A* Back     alignment and structure
>1vjr_A 4-nitrophenylphosphatase; TM1742, structural genomics, JCSG, protein structure initiative, joint center for structural G hydrolase; 2.40A {Thermotoga maritima} SCOP: c.108.1.14 PDB: 1pw5_A* Back     alignment and structure
>1yns_A E-1 enzyme; hydrolase fold; HET: HPO; 1.70A {Homo sapiens} SCOP: c.108.1.22 PDB: 1zs9_A Back     alignment and structure
>2x4d_A HLHPP, phospholysine phosphohistidine inorganic pyrophos phosphatase; hydrolase; 1.92A {Homo sapiens} Back     alignment and structure
>2zg6_A Putative uncharacterized protein ST2620, probable 2-haloalkanoic; probable 2-haloalkanoic acid dehalogenase, hydrolase, structural genomics; 2.40A {Sulfolobus tokodaii} Back     alignment and structure
>3gwi_A Magnesium-transporting ATPase, P-type 1; P-type ATPase, nucleotide binding, ATP binding, MGTA, membra protein, cell inner membrane; 1.60A {Escherichia coli} Back     alignment and structure
>1ltq_A Polynucleotide kinase; phosphatase, alpha/beta, P-loop, transferase; HET: ADP; 2.33A {Enterobacteria phage T4} SCOP: c.108.1.9 c.37.1.1 PDB: 1rc8_A* 1rpz_A* 1rrc_A* 2ia5_A Back     alignment and structure
>2c4n_A Protein NAGD; nucleotide phosphatase, HAD superfamily, UMP phosphatase, carbohydrate metabolism, hydrolase; 1.8A {Escherichia coli} SCOP: c.108.1.14 Back     alignment and structure
>4g9b_A Beta-PGM, beta-phosphoglucomutase; HAD, putative phosphoglucomutase, enzyme function initiative structural genomics, isomerase; 1.70A {Escherichia coli} Back     alignment and structure
>2i33_A Acid phosphatase; HAD superfamily, hydrolase; 1.57A {Bacillus anthracis} PDB: 2i34_A Back     alignment and structure
>2g80_A Protein UTR4; YEL038W, UTR4 protein (unknown transcript 4 protein), struct genomics, PSI, protein structure initiative; 2.28A {Saccharomyces cerevisiae} SCOP: c.108.1.22 Back     alignment and structure
>2fue_A PMM 1, PMMH-22, phosphomannomutase 1; enzyme-product complex, protein glycosyl carbohydrate-deficient glycoprotein syndrome; HET: MSE M1P; 1.75A {Homo sapiens} SCOP: c.108.1.10 PDB: 2fuc_A* Back     alignment and structure
>2ho4_A Haloacid dehalogenase-like hydrolase domain containing 2; HDHD2, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; 2.20A {Mus musculus} PDB: 3hlt_A Back     alignment and structure
>2b82_A APHA, class B acid phosphatase; DDDD acid phosphatase, metallo-ENZ hydrolase; HET: ADN; 1.25A {Escherichia coli} SCOP: c.108.1.12 PDB: 2b8j_A* 2hf7_A 1rmt_A* 1n9k_A 1rmq_A 1n8n_A* 1rmy_A* 2g1a_A* 3cz4_A 2heg_A* 1z5g_A 1z5u_A* 1z88_A 2aut_A Back     alignment and structure
>2amy_A PMM 2, phosphomannomutase 2; HS.459855, HS.313504, BC008310, phosphatase, PFAM PF03332, H superfamily, jaecken disease; 2.09A {Homo sapiens} SCOP: c.108.1.10 PDB: 2q4r_A Back     alignment and structure
>3zvl_A Bifunctional polynucleotide phosphatase/kinase; hydrolase-transferase complex, base excision repair, BER, non-homologous END-joining, NHEJ; 1.65A {Mus musculus} PDB: 3zvm_A* 3zvn_A* 1yj5_A 3u7e_B* 3u7f_B* 3u7h_B* 3u7g_A* Back     alignment and structure
>2i7d_A 5'(3')-deoxyribonucleotidase, cytosolic type; hydrolase; HET: DUR; 1.20A {Homo sapiens} PDB: 2jar_A* 2jao_A* Back     alignment and structure
>3i28_A Epoxide hydrolase 2; aromatic hydrocarbons catabolism, detoxification, magnesium, metal-binding, peroxisome; HET: 34N; 1.95A {Homo sapiens} PDB: 1s8o_A* 1zd2_P* 1vj5_A* 1zd4_A* 1zd5_A* 3i1y_A* 1zd3_A* 3koo_A* 3otq_A* 4hai_A* 1cqz_A 1cr6_A* 1ek1_A* 1ek2_A* 3ans_A* 3ant_A* 3pdc_A* Back     alignment and structure
>1yv9_A Hydrolase, haloacid dehalogenase family; hypothetical protein, struc genomics, PSI, protein structure initiative; 2.80A {Enterococcus faecalis} SCOP: c.108.1.14 Back     alignment and structure
>2oyc_A PLP phosphatase, pyridoxal phosphate phosphatase; structural genomics, NYSGXRC, NEW YORK SGX research center for structural genomics, PSI-2; 1.72A {Homo sapiens} PDB: 2p27_A 2p69_A* 2cft_A* 2cfs_A 2cfr_A* Back     alignment and structure
>1q92_A 5(3)-deoxyribonucleotidase; alpha-beta rossman fold, hydrolase; HET: DRM; 1.40A {Homo sapiens} SCOP: c.108.1.8 PDB: 1mh9_A* 1q91_A* 1z4m_A* 1z4i_A* 1z4j_A* 1z4l_A* 1z4k_A* 1z4p_X* 1z4q_A* 2jau_A* 2jaw_A* 3u19_A* 3u13_A 4e88_A Back     alignment and structure
>2hhl_A CTD small phosphatase-like protein; CTD phosphatase, keggins anion, structural genomics, PSI, protein structure initiative; HET: KEG; 2.10A {Homo sapiens} Back     alignment and structure
>2ght_A Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1; protein-peptide complex, HAD superfamily, hydrolase; HET: SEP; 1.80A {Homo sapiens} PDB: 2ghq_A* 3pgl_A* 1t9z_A* 1ta0_A* 3l0c_A 3l0y_A 3l0b_A* 2q5e_A Back     alignment and structure
>2obb_A Hypothetical protein; structural genomics, PSI-2, PR structure initiative, midwest center for structural genomic unknown function; 2.20A {Bacteroides thetaiotaomicron} SCOP: c.108.1.25 Back     alignment and structure
>3bwv_A Putative 5'(3')-deoxyribonucleotidase; NP_764060.1, deoxyribonucleotidase-like protein; HET: MSE; 1.55A {Staphylococcus epidermidis} Back     alignment and structure
>1nrw_A Hypothetical protein, haloacid dehalogenase-like hydrolase; structural genomics, PSI, protein structure initiative; 1.70A {Bacillus subtilis} SCOP: c.108.1.10 Back     alignment and structure
>1zjj_A Hypothetical protein PH1952; alpha/beta hydrolase fold, HAD superfamily, structural genom riken structural genomics/proteomics initiative; 1.85A {Pyrococcus horikoshii} Back     alignment and structure
>1zjj_A Hypothetical protein PH1952; alpha/beta hydrolase fold, HAD superfamily, structural genom riken structural genomics/proteomics initiative; 1.85A {Pyrococcus horikoshii} Back     alignment and structure
>3f9r_A Phosphomannomutase; trypanosome glycobiology structural genomics, isomerase, structural genomics consortium, SGC; 1.85A {Trypanosoma brucei} SCOP: c.108.1.0 PDB: 2i54_A* 2i55_A* Back     alignment and structure
>3kc2_A Uncharacterized protein YKR070W; HAD-like, mitochondral protein, PSI, MCSG, structural genomi protein structure initiative; HET: MSE; 1.55A {Saccharomyces cerevisiae} PDB: 3rf6_A* Back     alignment and structure
>2b30_A Pvivax hypothetical protein; SGPP, structural genomics, PSI, protein structure initiative; 2.70A {Plasmodium vivax} SCOP: c.108.1.10 Back     alignment and structure
>2hx1_A Predicted sugar phosphatases of the HAD superfamily; ZP_00311070.1, possible sugar phosphatase, structural genomics; HET: MSE EPE; 2.10A {Cytophaga hutchinsonii} Back     alignment and structure
>2rbk_A Putative uncharacterized protein; HAD-like phosphatase, unknown function; 1.00A {Bacteroides thetaiotaomicron} SCOP: c.108.1.10 PDB: 1ymq_A 2rb5_A 2rav_A 2rar_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 473
d2b8ea1135 c.108.1.7 (A:416-434,A:548-663) Cation-transportin 2e-22
d1wpga2168 c.108.1.7 (A:344-360,A:600-750) Calcium ATPase, ca 1e-18
d2b8ea2113 d.220.1.1 (A:435-547) Cation-transporting ATPase { 7e-10
d2feaa1226 c.108.1.20 (A:2-227) 2-hydroxy-3-keto-5-methylthio 4e-08
d1qyia_380 c.108.1.13 (A:) Hypothetical protein MW1667 (SA154 1e-07
d1nnla_217 c.108.1.4 (A:) Phosphoserine phosphatase {Human (H 2e-07
d1rkua_206 c.108.1.11 (A:) Homoserine kinase ThrH {Pseudomona 2e-06
d1j97a_210 c.108.1.4 (A:) Phosphoserine phosphatase {Archaeon 5e-05
d1k1ea_177 c.108.1.5 (A:) Probable phosphatase YrbI {Haemophi 8e-05
d2a29a1136 d.220.1.1 (A:316-451) Potassium-transporting ATPas 2e-04
d1nrwa_285 c.108.1.10 (A:) Hypothetical protein YwpJ {Bacillu 0.001
d1rkqa_271 c.108.1.10 (A:) Hypothetical protein YidA {Escheri 0.002
d1wr8a_230 c.108.1.10 (A:) Phosphoglycolate phosphatase, PGPa 0.003
>d2b8ea1 c.108.1.7 (A:416-434,A:548-663) Cation-transporting ATPase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 135 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: HAD-like
superfamily: HAD-like
family: Meta-cation ATPase, catalytic domain P
domain: Cation-transporting ATPase
species: Archaeon Archaeoglobus fulgidus [TaxId: 2234]

 Score = 90.5 bits (224), Expect = 2e-22
 Identities = 49/134 (36%), Positives = 76/134 (56%), Gaps = 3/134 (2%)

Query: 216 YVYLGATPVGTFSLSDSCRSGALEAIKDLKSLGIKSFILAGDSHAAALYAQDQLDHAFDM 275
            V    T   T    D+ +  A  A+++LK +GIK  ++ GD+  +A     +L+    +
Sbjct: 5   AVIFDKTGTLTKGKPDTLKESAKPAVQELKRMGIKVGMITGDNWRSAEAISRELNLDLVI 64

Query: 276 VYAELLPQHKEELVELLKKDGATAMVGDGINDAPALAAVDIGISMGISGSALAMESGHVI 335
                 P  K E V+ L+     A VGDGINDAPALA  D+GI++G SGS +A+ESG ++
Sbjct: 65  AEVL--PHQKSEEVKKLQAKEVVAFVGDGINDAPALAQADLGIAVG-SGSDVAVESGDIV 121

Query: 336 LMSNDIRKIPKAIK 349
           L+ +D+R +  AI+
Sbjct: 122 LIRDDLRDVVAAIQ 135
>d1wpga2 c.108.1.7 (A:344-360,A:600-750) Calcium ATPase, catalytic domain P {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 168 Back     information, alignment and structure
>d2b8ea2 d.220.1.1 (A:435-547) Cation-transporting ATPase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 113 Back     information, alignment and structure
>d2feaa1 c.108.1.20 (A:2-227) 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase MtnX {Bacillus subtilis [TaxId: 1423]} Length = 226 Back     information, alignment and structure
>d1qyia_ c.108.1.13 (A:) Hypothetical protein MW1667 (SA1546) {Staphylococcus aureus [TaxId: 1280]} Length = 380 Back     information, alignment and structure
>d1nnla_ c.108.1.4 (A:) Phosphoserine phosphatase {Human (Homo sapiens) [TaxId: 9606]} Length = 217 Back     information, alignment and structure
>d1rkua_ c.108.1.11 (A:) Homoserine kinase ThrH {Pseudomonas aeruginosa [TaxId: 287]} Length = 206 Back     information, alignment and structure
>d1j97a_ c.108.1.4 (A:) Phosphoserine phosphatase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 210 Back     information, alignment and structure
>d1k1ea_ c.108.1.5 (A:) Probable phosphatase YrbI {Haemophilus influenzae, HI1679 [TaxId: 727]} Length = 177 Back     information, alignment and structure
>d2a29a1 d.220.1.1 (A:316-451) Potassium-transporting ATPase B chain, KdpB {Escherichia coli [TaxId: 562]} Length = 136 Back     information, alignment and structure
>d1nrwa_ c.108.1.10 (A:) Hypothetical protein YwpJ {Bacillus subtilis [TaxId: 1423]} Length = 285 Back     information, alignment and structure
>d1rkqa_ c.108.1.10 (A:) Hypothetical protein YidA {Escherichia coli [TaxId: 562]} Length = 271 Back     information, alignment and structure
>d1wr8a_ c.108.1.10 (A:) Phosphoglycolate phosphatase, PGPase {Pyrococcus horikoshii [TaxId: 53953]} Length = 230 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query473
d2b8ea1135 Cation-transporting ATPase {Archaeon Archaeoglobus 99.97
d1wpga2168 Calcium ATPase, catalytic domain P {Rabbit (Orycto 99.96
d1qyia_380 Hypothetical protein MW1667 (SA1546) {Staphylococc 99.77
d2b8ea2113 Cation-transporting ATPase {Archaeon Archaeoglobus 99.48
d2a29a1136 Potassium-transporting ATPase B chain, KdpB {Esche 99.37
d1wr8a_230 Phosphoglycolate phosphatase, PGPase {Pyrococcus h 99.23
d1k1ea_177 Probable phosphatase YrbI {Haemophilus influenzae, 99.17
d1nnla_217 Phosphoserine phosphatase {Human (Homo sapiens) [T 99.17
d1l6ra_225 Phosphoglycolate phosphatase, PGPase {Archaeon The 99.12
d1nrwa_285 Hypothetical protein YwpJ {Bacillus subtilis [TaxI 99.07
d1rkqa_271 Hypothetical protein YidA {Escherichia coli [TaxId 99.07
d1rlma_269 Sugar phosphatase SupH (YbiV) {Escherichia coli [T 99.03
d2feaa1226 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate 98.98
d1j97a_210 Phosphoserine phosphatase {Archaeon Methanococcus 98.9
d2b30a1283 PFL1270w orthologue {Plasmodium vivax [TaxId: 5855 98.87
d1nf2a_267 Hypothetical protein TM0651 {Thermotoga maritima [ 98.85
d1wzca1243 Putative mannosyl-3-phosphoglycerate phosphatase M 98.81
d2rbka1260 Sugar-phosphate phosphatase BT4131 {Bacteroides th 98.78
d1rkua_206 Homoserine kinase ThrH {Pseudomonas aeruginosa [Ta 98.78
d1xvia_232 Putative mannosyl-3-phosphoglycerate phosphatase M 98.54
d1s2oa1244 Sucrose-phosphatase Slr0953 {Synechocystis sp. pcc 98.49
d2hsza1224 Phosphoglycolate phosphatase Gph {Haemophilus somn 98.25
d2hcfa1228 Hypothetical protein CT1708 {Chlorobium tepidum [T 98.25
d1u02a_229 Trehalose-6-phosphate phosphatase related protein 98.14
d1te2a_218 Phosphatase YniC {Escherichia coli [TaxId: 562]} 98.1
d1swva_257 Phosphonoacetaldehyde hydrolase {Bacillus cereus [ 98.09
d1wpga4472 Calcium ATPase, transmembrane domain M {Rabbit (Or 98.0
d2fuea1244 Phosphomannomutase 1 {Human (Homo sapiens) [TaxId: 97.94
d2gmwa1182 D,D-heptose 1,7-bisphosphate phosphatase GmhB {Esc 97.82
d2ah5a1210 predicted phosphatase SP0104 {Streptococcus pneumo 97.77
d1zs9a1253 E-1 enzyme {Human(Homo sapiens) [TaxId: 9606]} 97.68
d1x42a1230 Hypothetical protein PH0459 {Archaeon Pyrococcus h 97.67
d2go7a1204 Hypothetical protein SP2064 {Streptococcus pneumon 97.66
d2bdua1291 Cytosolic 5'-nucleotidase III {Mouse (Mus musculus 97.6
d2hdoa1207 Phosphoglycolate phosphatase {Lactobacillus planta 97.56
d1u7pa_164 Magnesium-dependent phosphatase-1, Mdp1 {Mouse (Mu 97.38
d2gfha1247 N-acylneuraminate-9-phosphatase NANP {Mouse (Mus m 97.3
d1q3ia_214 Sodium/potassium-transporting ATPase alpha chain { 97.26
d2fi1a1187 Putative hydrolase SP0805 {Streptococcus pneumonia 97.25
d2amya1243 Phosphomannomutase 2 {Human (Homo sapiens) [TaxId: 97.22
d1yv9a1253 Putative hydrolase EF1188 {Enterococcus faecalis [ 97.08
d1zrna_220 L-2-Haloacid dehalogenase, HAD {Pseudomonas sp., s 97.07
d2o2xa1209 Hypothetical protein Mll2559 {Mesorhizobium loti [ 97.0
d1y8aa1308 Hypothetical protein AF1437 {Archaeon Archaeoglobu 96.9
d1ltqa1149 Polynucleotide kinase, phosphatase domain {Bacteri 96.82
d1vjra_261 Hypothetical protein TM1742 {Thermotoga maritima [ 96.71
d1wvia_253 Putative phosphatase SMU.1415c {Streptococcus muta 96.55
d2b82a1209 Class B acid phosphatase, AphA {Escherichia coli [ 96.53
d2c4na1250 NagD {Escherichia coli [TaxId: 562]} 96.52
d2fdra1222 Hypothetical protein Atu0790 {Agrobacterium tumefa 96.5
d1qq5a_245 L-2-Haloacid dehalogenase, HAD {Xanthobacter autot 96.19
d1o08a_221 beta-Phosphoglucomutase {Lactococcus lactis [TaxId 96.19
d2fpwa1161 Histidine biosynthesis bifunctional protein HisB, 95.94
d1cr6a1222 Epoxide hydrolase, N-terminal domain {Mouse (Mus m 94.98
d1zd3a1225 Epoxide hydrolase, N-terminal domain {Human (Homo 93.97
d2b0ca1197 Putative phosphatase YihX {Escherichia coli [TaxId 91.82
d1wpga3239 Calcium ATPase {Rabbit (Oryctolagus cuniculus) [Ta 86.18
>d2b8ea1 c.108.1.7 (A:416-434,A:548-663) Cation-transporting ATPase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: HAD-like
superfamily: HAD-like
family: Meta-cation ATPase, catalytic domain P
domain: Cation-transporting ATPase
species: Archaeon Archaeoglobus fulgidus [TaxId: 2234]

Probab=99.97  E-value=8.6e-31  Score=226.55  Aligned_cols=132  Identities=40%  Similarity=0.603  Sum_probs=116.6

Q ss_pred             eEeeeCCeEEEEEEecCccCCchHHHHHHHHhCCCeEEEEcCCCHHHHHHHHHHcCCCccceehccChhhHHHHHHHHhh
Q 038599          215 GYVYLGATPVGTFSLSDSCRSGALEAIKDLKSLGIKSFILAGDSHAAALYAQDQLDHAFDMVYAELLPQHKEELVELLKK  294 (473)
Q Consensus       215 i~va~d~~~lG~i~l~d~lr~~a~~~I~~L~~~gi~v~mlTGD~~~~a~~~a~~~gi~~~~v~a~~~P~~K~~~v~~l~~  294 (473)
                      .++..|++..+.++++|++|++++++|+.||++|++++|+|||+..++.++|+++||+  ++|++++|++|..+|+.+|+
T Consensus         4 ~~~~~d~~~~~~~g~~D~lr~~a~~~I~~L~~~Gi~v~ilTGD~~~~a~~ia~~lgI~--~v~~~~~p~~k~~~v~~~q~   81 (135)
T d2b8ea1           4 TAVIFDKTGTLTKGKPDTLKESAKPAVQELKRMGIKVGMITGDNWRSAEAISRELNLD--LVIAEVLPHQKSEEVKKLQA   81 (135)
T ss_dssp             CEEEEECCCCCBCSCCCCBCTTHHHHHHHHHHTTCEEEEECSSCHHHHHHHHHHHTCS--EEECSCCHHHHHHHHHHHTT
T ss_pred             EEEEECCceEEEEecCCCCCccHHHHHHHHHHcCCEEEEEcCcchhhhhHHHhhhhhh--hhccccchhHHHHHHHHHHc
Confidence            3556677777788999999999999999999999999999999999999999999998  99999999999999999998


Q ss_pred             CCcEEEEcCCcccHHHHHHCCeeEEeCCCCCccccccccEEEecCCcccHHHHHH
Q 038599          295 DGATAMVGDGINDAPALAAVDIGISMGISGSALAMESGHVILMSNDIRKIPKAIK  349 (473)
Q Consensus       295 ~g~v~mvGDG~ND~~al~~AdvgIa~g~~~~~~a~~~ad~vl~~~~l~~l~~~i~  349 (473)
                      .+.|+|+|||.||+|||++|||||+++ ++++.++++||+++++++|+.|+.+++
T Consensus        82 ~~~v~~vGDg~nD~~aL~~Advgia~~-~~~~~~~~aADivl~~~~l~~i~~aI~  135 (135)
T d2b8ea1          82 KEVVAFVGDGINDAPALAQADLGIAVG-SGSDVAVESGDIVLIRDDLRDVVAAIQ  135 (135)
T ss_dssp             TSCEEEEECSSSSHHHHHHSSEEEEEC-CC--------SEEESSCCTHHHHHHHC
T ss_pred             CCEEEEEeCCCCcHHHHHhCCeeeecC-ccCHHHHHhCCEEEECCCHHHHHHHhC
Confidence            789999999999999999999999998 889999999999999999999998764
>d1wpga2 c.108.1.7 (A:344-360,A:600-750) Calcium ATPase, catalytic domain P {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1qyia_ c.108.1.13 (A:) Hypothetical protein MW1667 (SA1546) {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2b8ea2 d.220.1.1 (A:435-547) Cation-transporting ATPase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2a29a1 d.220.1.1 (A:316-451) Potassium-transporting ATPase B chain, KdpB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wr8a_ c.108.1.10 (A:) Phosphoglycolate phosphatase, PGPase {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1k1ea_ c.108.1.5 (A:) Probable phosphatase YrbI {Haemophilus influenzae, HI1679 [TaxId: 727]} Back     information, alignment and structure
>d1nnla_ c.108.1.4 (A:) Phosphoserine phosphatase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l6ra_ c.108.1.10 (A:) Phosphoglycolate phosphatase, PGPase {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1nrwa_ c.108.1.10 (A:) Hypothetical protein YwpJ {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1rkqa_ c.108.1.10 (A:) Hypothetical protein YidA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rlma_ c.108.1.10 (A:) Sugar phosphatase SupH (YbiV) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2feaa1 c.108.1.20 (A:2-227) 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase MtnX {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1j97a_ c.108.1.4 (A:) Phosphoserine phosphatase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2b30a1 c.108.1.10 (A:18-300) PFL1270w orthologue {Plasmodium vivax [TaxId: 5855]} Back     information, alignment and structure
>d1nf2a_ c.108.1.10 (A:) Hypothetical protein TM0651 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1wzca1 c.108.1.10 (A:1-243) Putative mannosyl-3-phosphoglycerate phosphatase MPGP (YedP) {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2rbka1 c.108.1.10 (A:2-261) Sugar-phosphate phosphatase BT4131 {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d1rkua_ c.108.1.11 (A:) Homoserine kinase ThrH {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1xvia_ c.108.1.10 (A:) Putative mannosyl-3-phosphoglycerate phosphatase MPGP (YedP) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1s2oa1 c.108.1.10 (A:1-244) Sucrose-phosphatase Slr0953 {Synechocystis sp. pcc 6803 [TaxId: 1148]} Back     information, alignment and structure
>d2hsza1 c.108.1.6 (A:1-224) Phosphoglycolate phosphatase Gph {Haemophilus somnus [TaxId: 731]} Back     information, alignment and structure
>d2hcfa1 c.108.1.6 (A:2-229) Hypothetical protein CT1708 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1u02a_ c.108.1.15 (A:) Trehalose-6-phosphate phosphatase related protein {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1te2a_ c.108.1.6 (A:) Phosphatase YniC {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1swva_ c.108.1.3 (A:) Phosphonoacetaldehyde hydrolase {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1wpga4 f.33.1.1 (A:1-124,A:240-343,A:751-994) Calcium ATPase, transmembrane domain M {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d2fuea1 c.108.1.10 (A:13-256) Phosphomannomutase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gmwa1 c.108.1.19 (A:24-205) D,D-heptose 1,7-bisphosphate phosphatase GmhB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ah5a1 c.108.1.6 (A:1-210) predicted phosphatase SP0104 {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1zs9a1 c.108.1.22 (A:4-256) E-1 enzyme {Human(Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x42a1 c.108.1.1 (A:1-230) Hypothetical protein PH0459 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2go7a1 c.108.1.6 (A:3-206) Hypothetical protein SP2064 {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d2bdua1 c.108.1.21 (A:7-297) Cytosolic 5'-nucleotidase III {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2hdoa1 c.108.1.6 (A:1-207) Phosphoglycolate phosphatase {Lactobacillus plantarum [TaxId: 1590]} Back     information, alignment and structure
>d1u7pa_ c.108.1.17 (A:) Magnesium-dependent phosphatase-1, Mdp1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2gfha1 c.108.1.6 (A:1-247) N-acylneuraminate-9-phosphatase NANP {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1q3ia_ d.220.1.1 (A:) Sodium/potassium-transporting ATPase alpha chain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2fi1a1 c.108.1.3 (A:4-190) Putative hydrolase SP0805 {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d2amya1 c.108.1.10 (A:4-246) Phosphomannomutase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yv9a1 c.108.1.14 (A:4-256) Putative hydrolase EF1188 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1zrna_ c.108.1.1 (A:) L-2-Haloacid dehalogenase, HAD {Pseudomonas sp., strain YL [TaxId: 306]} Back     information, alignment and structure
>d2o2xa1 c.108.1.19 (A:8-216) Hypothetical protein Mll2559 {Mesorhizobium loti [TaxId: 381]} Back     information, alignment and structure
>d1y8aa1 c.108.1.24 (A:1-308) Hypothetical protein AF1437 {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1ltqa1 c.108.1.9 (A:153-301) Polynucleotide kinase, phosphatase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1vjra_ c.108.1.14 (A:) Hypothetical protein TM1742 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1wvia_ c.108.1.14 (A:) Putative phosphatase SMU.1415c {Streptococcus mutans [TaxId: 1309]} Back     information, alignment and structure
>d2b82a1 c.108.1.12 (A:4-212) Class B acid phosphatase, AphA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2c4na1 c.108.1.14 (A:1-250) NagD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fdra1 c.108.1.6 (A:3-224) Hypothetical protein Atu0790 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1qq5a_ c.108.1.1 (A:) L-2-Haloacid dehalogenase, HAD {Xanthobacter autotrophicus [TaxId: 280]} Back     information, alignment and structure
>d1o08a_ c.108.1.6 (A:) beta-Phosphoglucomutase {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d2fpwa1 c.108.1.19 (A:3-163) Histidine biosynthesis bifunctional protein HisB, phosphatase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1cr6a1 c.108.1.2 (A:4-225) Epoxide hydrolase, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zd3a1 c.108.1.2 (A:2-224) Epoxide hydrolase, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b0ca1 c.108.1.2 (A:8-204) Putative phosphatase YihX {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wpga3 d.220.1.1 (A:361-599) Calcium ATPase {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure